Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
2020-01-23 Council Agenda Packet
Corcoran City Council Agenda January 23, 2020 - 7:00pm 1.Call to Order / Roll Call 2.Pledge of Allegiance 3.Agenda Approval 4.Commission Representatives* 5.Open Forum 6.Presentations/Recognitions a.Resolution Honoring Outgoing Councilmember Mike Keefe* 7.Consent Agenda a.Draft Minutes of January 9, 2019 Council Meeting* b.Financial Claims* c.2020 Part-time Recreation Coordinator Wage* d.Code Enforcement Violation Extension Request* e.2020 Election Judge Appointments* f.Authorization to Bid/Quote 2020 Road Materials* 8.Planning Business a.Final PUD Development Plan and Final Plat for Ravinia 14th Addition* b.Environmental Assessment Worksheet for Wessel Residential Development* c.Sketch Plan for 10409 County Road 101* 9.Unfinished Business 10.New Business a.2020 Legislative Priorities* b.2020 CIP Squad Car Purchase* c.Special Election Options* d.City Council Appointment* e.2020 CIP Truck Purchase* 11.Staff Reports a.Active Corcoran Planning Applications* 12.2020 City Council Schedule* 13.Adjournment *Includes Materials - Materials relating to these agenda items can be found in the House Agenda Packet by Door. The complete Council Agenda Packet is available electronically on the website at www.ci.corcoran.mn.us. The City of Corcoran will provide high quality public services in a cost effective, responsible, and professional manner in order to create a preferred environment to live, work, play, and conduct business. MISSION STATEMENT The City of Corcoran will become a vibrant community focused around a thriving Town Center while preserving its natural character and agricultural roots. In order to achieve this vision, the City will seek to work with partners to accomplish the following outcomes: A variety of housing options for all ages and stages of life existing in cohesion with the natural environment. A well connected parks and trails system with options for year-round recreation and opportunities for residents to connect with nature. A safe and clean community where residents can be proud to live, work, and play. A variety of high quality schools are available to residents and work in cohesion with the City’s vision. A variety of commercial and industrial businesses exist to provide for most services and jobs for the community. VISION STATEMENT The following values are fundamental to the City of Corcoran’s success and the fulfillment of our mission: Honesty, Ethics, Integrity We believe that honesty, ethics, and integrity are the foundation blocks of public trust and confidence. Community Pride and Partnership We believe in creating a strong sense of community through partnerships with civic organizations, school districts, and local businesses. Efficient and Effective Service Delivery We believe providing services to residents and businesses in an efficient and effective manner makes government easier to work with and creates a business friendly environment. Community Safety We will protect the community by maintaining or improving safety through police and fire protection and by investing and maintaining the infrastructure of the City. Fiscal Responsibility We believe that the prudent stewardship and opportunistic investment of public funds is essential for confidence in government and to position the City for future success. Transparency We believe that open an honest communication is essential for an informed and involved citizenry. Processes and decision making should include opportunities to educate citizens and receive feedback. Responsible Decision Making We believe it is the responsibility of the City to address difficult issues now in order to avoid larger more difficult issues in the future. ADOPTED MARCH 8, 2018 VALUES STATEMENT ADOPTED JANUARY 24, 2019 ACTION STEPS The City of Corcoran has identified the following action steps for 2019: Develop a master plan, finance plan, and select amenities for City Park. Develop a needs assessment, action plan, and finance plan for fire service. Complete the update to the southeast district and town center plan; complete a stormwater management plan for the town center. Decide on request for contribution to the Dayton Parkway Interchange project. Develop a low cost option to pave gravel roads; establish criteria to select roads for paving; push legislative priorities which includes street funding options. Identify all existing easements/right-of-way the City has obtained for trails, etc. Complete a feasibility study for trails along selected County Roads. Identify preferred snowmobile routes. Evaluate staffing and space needs for public safety. Evaluate the need for a City Planner. Complete studies needed for water system options. Investigate options to reduce the use of salt/chloride; apply for funding to complete an additional sub watershed assessment. Provide an update on the existing crime/drug action plan; create a new plan for next steps. Execute code enforcement plan. Consider updates to the Open Space and Preservation ordinance and other ordinances to establish incentives for protecting/preserving the natural environment through development. Review compost site options. STAFF REPORT Agenda Item 4. Council Meeting: January 23, 2020 Prepared By: Brad Martens Topic: Commission Representatives Action Required: None – Informational Summary: The advisory commission representatives for the January 23rd Council meeting are as follows: • Planning Commission: Jeff Dickman • Parks and Trails Commission: John Dugan Financial/Budget: N/A Options: N/A Recommendation N/A Council Action: N/A Attachments: N/A 8200 County Road 116, Corcoran, MN 55340 763-420-2288 www.ci.corcoran.mn.us Date: 1 �420 Open Forum: Y( or No �� Ifyou are not sveaon an afenda item, you will speak at Open Forum Name of (Zpeaker: (PLEA SE PRINT CLEARL V) Related to Agenda Item: Yes or.,No Agenda Item Number: Meeting Rules of Conduct: • Fill out and turn in white comment caId to a staff member. • When called upon, approach podium and state name and address. • Indicate if representing a group. • Limit remarks to S minutes. Representing: j � u I Address:•�-s l.�JIOUC) % {+i ��-C Telephone (optional): q� �' � �cJ� Please note your public comment card will become part of the permanent record. Please approach the podium to speak when called upon. Comments: City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-07 Page 1 of 1 Motion By: Seconded By: A RESOLUTION HONORING OUTGOING COUNCILMEMBER MIKE KEEFE WHEREAS, Mike Keefe was elected to the City Council for a four-year term beginning January 1, 2015; and WHEREAS, Councilmember Keefe was re-elected to an additional four-year term on the City Council in 2018; and WHEREAS, Councilmember Keefe has decided to resign from the City Council in order to spend more time with his family; and WHEREAS, Councilmember Keefe has placed considerable time, effort, and thought into his role of City Councilmember for his five years in office; and WHEREAS, during his tenure as Councilmember, Corcoran improved its staffing structure, extended water and sewer infrastructure including the downtown utility and street project, reviewed and approved several development proposals, updated the southeast district design guidelines and adopted the 2040 Comprehensive Plan, upgraded the City’s bond rating, increased communication, purchased park land and established a new park, received recognition as a safe city, established a new code enforcement process; and enhanced services while decreasing the overall tax rate; and WHEREAS, the City of Corcoran wishes to recognize the time, energy, dedication, and leadership provided by Mike Keefe to the City of Corcoran. NOW, THEREFORE BE IT RESOLVED, by the City of Corcoran, that the City Council hereby honors Mike Keefe for his distinguished service to the City of Corcoran and residents of the City. VOTING AYE VOTING NAY Thomas, Ron Thomas, Ron Bottema, Jonathan Bottema, Jonathan Dejewski, Brian Dejewski, Brian Schultz, Alan Schultz, Alan Whereupon, said Resolution is hereby declared adopted on this 23rd day of January, 2020. ________________________________ Ron Thomas - Mayor ATTEST: City Seal ____________________________________ Jessica Beise – Administrative Services Director Agenda Item 6a. CITY OF CORCORAN City Council Meeting Minutes January 9, 2020 - 7:00 pm The Corcoran City Council met on January 9, 2020, at City Hall in Corcoran, Minnesota. Present were Mayor Thomas, Councilor Schultz, and Councilor Dejewski. Excused was Councilor Bottema. Also present were City Administrator Martens, City Attorney Thames, Administrative Services Director Beise, Public Works Director Mattson, Lieutenant Burns, and Director of Public Safety Gottschalk. 1.Call to Order / Roll Call Mayor Thomas called the meeting to order at 7:00 pm. 2.Pledge of Allegiance Mayor Thomas invited all in attendance to rise and join in the Pledge of Allegiance. 3.Agenda Approval City Administrator Martens requested agenda item 6a. Years of Service Recognition – Josh Hunter be moved to a different date and requested the addition of agenda item 10h. Snowplow Operator Hours. City Administrator Martens asked Council to consider agenda item 7e. Finance Agreement Transfer for Corcoran Crossroads as a separate item on the consent agenda as the agreement was provided the day of the meeting. MOTION: made by Schultz, seconded by Dejewski to approve the agenda as modified. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) 4.Commission Representatives Mayor Thomas noted Planning Commission Chair Jacobs and Parks and Trails Commissioner Strehler were present. The Commissioners were invited to speak on items related to their respective commissions. 5.Open Forum Mayor Thomas invited residents to speak. No residents came forward to speak. 6.Presentations/Recognitions 7.Consent Agenda a.Draft Minutes of December 19, 2019 Council Meeting b.Financial Claims c.National Incident-Based Reporting System Joint Powers Agreement d.Waiver Request for Amplified Sound – 20201 County Road 50 e.Finance Agreement Transfer – Corcoran Crossroads f.Establishing an Absentee Ballot Board g.Tobacco License for Corcoran Crossroads h.2020 Open Book Meeting Council asked consent agenda items 7c. and 7e. be considered separately for further discussion. City Administrator Martens noted Council request within 7a. Draft Minutes of December 19, 2019 Council Meeting, under section 10b., to rephrase rental units to residential lots. MOTION: made by Dejewski, seconded by Schultz to approve the consent agenda items 7a., 7b., 7d., 7f., 7g., and 7h. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) Regarding item 7c., Council inquired about the total cost expected. Director of Public Safety Gottschalk explained if the Bureau of Criminal Apprehension grant funding is not received, the City of Corcoran’s cost would reflect one-fourteenth of the total cost of $8,000, as the cost would be Agenda Item 7a. 2 split between the fourteen cities making up the consortium applying for the grant. Council reiterated if the grant funding is approved by the Bureau of Criminal Apprehension, there is no cost to the City or to the consortium. Council and staff discussed new federal requirements for agency reporting. Council and Director of Public Safety Gottschalk discussed the Corcoran Police Department’s history and role within the consortium. MOTION: made by Dejewski, seconded by Schultz to approve the consent agenda item 7c. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) Administrator Services Director Beise noted item 7e. Finance Agreement Transfer for Corcoran Crossroads allows for the ten-year sewer and water utility fees assessment by the City to be transferred to the new owners of Corcoran Crossroads. Administrator Services Director Beise further noted the finance agreement transfer would be filed and recorded with Hennepin County in the case the property sells again before the ten-year utility assessment is paid in full. MOTION: made by Dejewski, seconded by Schultz to approve the consent agenda item 7c. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) 8. Planning Business No planning business was presented. 9. Unfinished Business a. Low Cost Paving Options – Assessment Policy Review City Administrator Martens reviewed the shape and pave approach discussion and the request for staff to provide two road paving options at a future date. City Administrator Martens asked for Council feedback on the assessment policy including the use of 90 percent of low value benefit in calculating the assessment; indirect benefitting properties; and assessments for each building right. Council discussed the 90 percent low value benefit assessment and if the assessment is fair across a range of different home values on a specific road. Council discussed the assessed cost of the road could be affected by higher valued property and lower valued property on the same road. Council continued the assessment discussion for indirect benefitting properties, and assessment impact if there are additional, secondary roads in the neighborhood, and if secondary roads impact assessment calculations. Council discussed impacts of paving a main road, and later paving the secondary road, and credits for the original indirect benefit assessment. City Administrator Martens explained the benefits determination to a property regarding main road access and secondary road access is an assessor determination. Staff and Council discussed future City policies regarding paving roads and how surrounding, or indirect properties would benefit, and how assessment calculation should be a case by case basis to accommodate unique situations. Council discussion moved to calculating assessments by property building rights. City Administrator Martens outlined the current assessment policy and reviewed examples of properties located between two gravel roads, and the assessment option challenges dependent on each property’s building rights. Council asked for clarification on current policy regarding how properties are currently assessed in relation to building rights. City Administrator Martens stated each building right after the first building right would be categorized as a deferred assessment for the original property. Council discussed the financial aspects of assessments, the depreciation of roads on properties with building rights not currently developed but may develop in the future, and how the existing and depreciated assessments for road repair and maintenance would be assessed and maintained to these properties. b. 2020 Strategic Planning Work Session City Administrator Martens reviewed dates for the strategic planning work session. Council and staff discussed timelines and dates. MOTION: made by Schultz, seconded Dejewski to approve the 2020 Strategic Planning Work Session for February 10, 2020, at 4:00 pm . Voting Aye: Thomas, Dejewski, and Schultz 3 (Motion carried 3:0) c. 2020 City Calendar Council noted the Open Book meeting on April 9, 2020. Administrative Services Director Beise indicated Council did not need to be present for the Open Book meeting and only the city assessor would need to be present at the meeting. Administrative Services Director Beise noted the Open Book Meeting is regularly held the second Thursday in April each calendar year. MOTION: made by Dejewski, seconded Schultz to approve the 2020 City Calendar as presented. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) 10. New Business a. Charter Commission Resignation and Recognition – Rich Asleson Mayor Thomas read Resolution 2020-02 honoring outgoing Commission Richard Asleson. MOTION: made by Schultz, seconded Dejewski to approve the 2020-02 Honoring Outgoing Commissioner Richard Asleson. Mayor Thomas shared words of appreciation and thanked Commissioner Asleson for his service on the City Council and the Charter Commission. Voting Aye: Thomas, Dejewski, and Schultz. (Motion carried 3:0) b. Request for Water and Sewer Connection with Maple Grove City Administrator Martens outlined the formal request by a Corcoran resident for water and sewer utilities connection through Maple Grove located at 8025 Ridge Court. City Administrator Martens gave a brief history of the neighborhood, including remaining Corcoran properties with septic, well , and gravel within the neighborhood. City Administrator Martens reviewed policy considerations, the necessary primary and secondary agreements with the City of Maple Grove, and the current property owner for current and future related water and sewer utility costs. City Administrator Martens noted a planned 2021 Maple Grove street improvement project with the option for Corcoran to participate in the project. City Administrator Martens indicated City staff would hold a neighborhood meeting sometime in February with a goal to have a recommendation to Council in the summer of 2020 regarding City options for participation in the Maple Grove street improvement project. Council discussed the option of a one-time connection for sewer and water for 8025 Ridge Court. Council discussed reviewing the options available with the City of Maple Grove with the upcoming 2021 street improvement project. Council asked if there would be any cost to the City for the utility connection at 8025 Ridge Court, including the cost of staff time. Council and staff considered financial aspects of allowing utility connections. MOTION: made by Dejewski, seconded Schultz to authorize staff to formally request the City of Maple Grove to draft a connection agreement for 8025 Ridge Court, to draft an agreement for additional connection requests within the neighborhood, and to draft a comprehensive cost plan for the 2021 Maple Grove street improvement project as it relates to Appaloosa Woods neighborhood in Corcoran. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) c. Recreation Coordinator Appointment City Administrator Martens reviewed the completed hiring process for the Recreation Coordinator position and the recommendation to hire Jessica Christensen Buck. MOTION: made by Schultz, seconded Thomas to approve the appointment of Jessica Christensen Buck to the full-time Recreation Coordinator position effective February 3, 2020. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) d. Council Liaison Schedule City Administrator Martens discussed current Council liaisons on each City commission, the recent liaison vacancy on the Parks and Trails Commission and requested discussion on how the Council would like to move forward. Council discussed the vacant Council position, and once appointed, 4 would maintain the Council liaison for the Parks and Trails Commission. City Administrator Martens confirmed Councilmember Schultz will continue as the 2020 Planning Commission liaison, and Councilmember Bottema will continue as the Elm Creek W atershed Commission liaison. e. Property Acquisition Process – Gleason Parkway Extension and Trunk Sewer Extension Projects Greg Hoglund, 19220 Hackamore Road, addressed Council asking for clarification on the process of and which Council members would vote on the eminent domain item 10e. Council clarified that it cannot determine if a vote will be made at tonight’s meeting until the discussion is complete. Mr. Hoglund noted concerns with the eminent domain process. Mr. Hoglund discussed the Lennar development on the Wessel property and his perspective on the future growth of the City. Mr. Hoglund shared his opinion on the recent nuisance violations in Corcoran and the future election impact regarding the vacant Council seat. Mr. Hoglund provided comments on the strategic planning regarding downtown, fire department and police departments. City Administrator Martens invited Mr. Hoglund to meet at City Hall to review concerns and documentation. City Administrator Martens outlined the background history of the Gleason Parkway Extension Project and Trunk Sewer Extension Project and indicated the project dates to the 1980’s and has been a planned connection for many years. City Administrator Martens noted there is a signed developer’s agreement with Mr. Mason, who is one of the property owners of the focus within the eminent domain process. City Administrator Martens noted the difference of rules and processes relating to stormwater, land slopes, and MSA rules that did not exist in the 1980’s. The process of recent conversations for the Gleason Parkway Extension began in 2013, with significant discussion in 2017. In Southeast Corcoran, the Gleason Parkway Extension continues Gleason Parkway from County Road 101, through the Ravinia development, to County Road 116. The planned trunk sewer extension covers Southeast Corcoran and was included as a trunk sewer extension through the last two comprehensive plans. City Administrator Martens added the water extension project extends water from existing downtown to the Southeast Corcoran community. The next steps in the project include testing, surveying, and easement and right-of-way purchases. City Administrator Martens explained the next steps in the land acquisition process includes meeting with property owners, obtaining right-of-entry, appraisals, and negotiating a purchase price. City Administrator Martens reviewed the properties surrounding the Gleason Extension project including one land owner who is unwilling to sign a right-of entry request and controls several properties along the proposed extension, directly impacting the Gleason Parkway and Trunk Sewer projects. City Administrator Martens outlined the options of the current extension projects and include abandoning the project, redesigning the project, or moving to the least desirable option of eminent domain. City Administrator Martens stated one of the most important services a City can provide to residents are roads, water and sewer, and reiterated the Gleason Parkway Extension has been envisioned in Corcoran for almost 40 years. City Administrator Martens discussed the future importance of the Gleason Parkway Extension Project and Trunk Sewer Extension Project and the need for eminent domain. City Administrator Martens discussed Council action includes approving the resolution, which would allow obtaining the appraised value of several properties owned by three individuals, offers for compensation, and acquisition by eminent domain for the projects if needed. Council questioned the proposed location of a stormwater collection pond and asked if the stormwater collection pond could be moved to another parcel to the west. Public Works Director Mattson responded before a decision can be made on stormwater ponds, the City first needs permission to access the proposed site and can then proceed with evaluating the site. Public Works Director Mattson indicated a stormwater pond cannot be placed within a wetland site. Public Works Director Mattson discussed the property that is identified has more potential upland, or non-wetland areas that may be sized to support the stormwater pond design, and with right of entry, the City could analyze and confirm the whole process. Public Works Director Mattson noted currently the City has not received permission to enter some parcels and has not been able to evaluate any of the proposed plan or finalize the designs. Council discussed the easements along 5 County Road 116 and why two of the easements are narrower than the others on the south side of County Road 116. Public Works Director Mattson explained the easements along County Road 116 vary in size because of the land topography, wetland areas, and required widths of the turn lane. Council asked about the appraisal process on the land and if value is based on current land value. City Administrator Martens stated value is based on the current land value. City Administrator Martens referenced temporary construction easements are a percentage for utilizing the land for a specific time for construction, and indicated the City has no intention of completing a special assessment process at this time. Council stated for the record, no property owners affected by the proposed Gleason Parkway Extension have contacted Council. Council inquired about a parcel of land that is unbuildable land and if the City is looking at that as an option with the extension. Public Works Director Mattson clarified the parameters for how the properties were determined in the extension proposal. Council requested clarification if the building rights of the properties would be impacted. Public Works Director Mattson expressed that upon review of the properties the building rights would not be affected on respective properties. Council discussed the necessity of eminent domain for the other two property owners who are working with the City. City Administrator Martens reiterated the eminent domain process requires many notices and timelines, is project driven, and allows the City the access that may be necessary to adhere to project timelines. City Administrator Martens noted there currently exists a level of cooperation with two property owners and there is always the possibility that properties may change hands, and approving the resolution allows staff to utilize the most optimal path forward. City Administrator Martens pointed out Council approval of authorization for eminent domain does not mean that eminent domain will proceed, and is only in place to allow for options in the event or circumstance of change in the future. Council debated eminent domain and inclusion of all property owners in the eminent domain process for Gleason Parkway. After much discussion, Council requested only the property owner who is opposed to cooperate with the City for right of entry be included in the eminent domain process. Council discussed potential future delays by excluding some property owners from the eminent domain process. Council also requested the least amount of property be utilized on eminent domain properties. Council inquired if all properties would be listed within the eminent domain process to alert future buyers regarding the eminent domain process. Council discussed property values of the properties included within the eminent domain process and how the property’s value is impacted. MOTION: made by Dejewski, seconded Schultz to approve Resolution 2020-03 authorizing approval of appraised values, offers for compensation, and acquisition by eminent domain for the 66th Avenue Corridor Improvement Project with the amendment to exclude PID’s 36-119-23-23- 0001, 36-119-23-23-0002, and 36-119-23-32-0002. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) f. Annual Appointments City Administrator Martens explained the annual appointments and changes from the previous year and included the addition of Administrative Services Director Jessica Beise as an official signatory, and to appoint an acting Mayor. Council discussed the best options for continuity in the acting Mayor appointment, and Council discussed appointing Councilmember Bottema as acting Mayor in 2020. MOTION: made by Dejewski, seconded Schultz to approve Resolution 2020-01 Establishing Annual Appointments for the City of Corcoran for 2020 and appointing Councilmember Bottema as acting Mayor in 2020, in Mayor Thomas’ absence. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) g. City Council Resignation and Declaration of Vacancy City Administrator Martens outlined the required action by Council is to accept the resignation of Councilmember Keefe, declare a vacancy and temporarily fill the vacancy until a special election 6 takes place. City Administrator Martens and staff recommended holding the election at the State Primary Election on August 11, or the General Election on November 3, with an appointment by Council to fill the vacant position until the scheduled election. Council and staff reviewed the options available to Council per Minnesota Statute 412.02 subdivision 2a. MOTION: made by Schultz, seconded Dejewski to accept the resignation of Councilmember Keefe effective December 31, 2019, and to declare a vacancy on the City Council as of December 31, 2019. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) Council discussed appointment options to fill the vacancy on the City Council. Council discussed appointing Parks and Trails Commissioner Anderson to fill the temporary vacancy position on the City Council. Council also reviewed other possible options for the vacancy, timelines and processes in appointment of the position. Council discussed waiting until the next meeting when Councilmember Bottema could also have input. City Administrator Martens reviewed a timeline, stated there are Parks and Trails and Charter commissioners interested, that the City Administrator can send an inquiry to City Commission members, and Council could decide at the next Council meeting. City Administrator Martens also noted the communication challenge in the short timeline of getting the information out to inform the community of the vacancy on Council. Council inquired about the general public application, and Administrative Services Director Beise stated the commissioner application could be utilized for the process. Council and staff reviewed due dates for the general public for completing the application, and when the Council would be able to review the applications. City Administrator Martens confirmed the due date for applications to be submitted to City Hall is Wednesday, January 22, 2020, by 12:00 pm. Council and staff determined a Council Work Session is necessary to review applications for the vacancy on City Council. Mayor Thomas called for a Council Work Session on Thursday, January 23, 2020, at 6:30 pm for the purpose of reviewing applications for the vacant Council position. Council further discussed appointing an applicant at the regular Council meeting on Thursday, January 23, 2020. h. Snow Plow Operations and General Assistance for Public Works City Administrator Martens reviewed the impact of the vacant position in the Public Works Department, noting vacancy since October 14, 2019, and with the search for qualified candidates in the first round of interviews unsuccessful, and the reopening of the position, it is likely the position will remain vacant until mid-March. City Administrator Martens outlined the request for an additional allocation of 100 hours for snow plow operator position to assist the Public Works department with snow plowing and other duties as needed or assigned. City Administrator Martens noted the additional 100 hours would allow a total of 200 hours to the seasonal snow plow operator position in 2020. MOTION: made by Dejewski, seconded Schultz to approve the additional 100-hour allocation, allowing a total of 200 hours to the seasonal snow plow operator position. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) 11. Staff Reports 12. 2020 City Council Schedule City Administrator Martens reviewed the upcoming items for future Council meetings. 13. Adjournment MOTION: made by Dejewski, seconded by Schultz to adjourn. Voting Aye: Thomas, Dejewski, and Schultz (Motion carried 3:0) Meeting adjourned at 8:45 pm. ________________________________ Michelle Friedrich – Deputy Clerk Agenda Item 7b. Council Meeting Date: 1/23/2020 FINANCIAL CLAIMS Prepared By: jrotz CHECKRANGE FUND #500 ESCROW CLAIMSAgendaItem: 7b. Paid toAmountProject name 500-20468$68.50LANDFORM - Meyer Lot Line Adjustment 18-039 500-20475$60.75LANDFORM - Lithgow Auto CUP/SP 19-013 500-20332$779.25LANDFORM - Lennar Wessel Feasibility 19-018 500-20470$40.50LANDFORM - Rolling Hills FP 19-020 500-20469$909.00LANDFORM - Ravinia 14th FP and FPUD 19-022 500-20482$768.00LANDFORM - Nelson Sketch Plan 19-023 500-20480$125.00WENCK ASSOCIATES, INC. - Nelson - Wetland Review 500-20481$410.50WENCK ASSOCIATES, INC. - Landspec Fund 2Wetland Review 500-20335$5,317.70WENCK ASSOCIATES, INC. - LENNAR - ENGINEERING 500-20376$92.80WENCK ASSOCIATES, INC. - PARK PLACE STORAGE 500-20438$848.20WENCK ASSOCIATES, INC. - Bass Lake Crossing M/IHome 17-012 Engineering 500-20423$162.40WENCK ASSOCIATES, INC. - Bass Lake Estates Sketch PUD 17-015 500-20474$144.12WENCK ASSOCIATES, INC. - ComLink Midwest CUP 19-011 500-20459$937.50WENCK ASSOCIATES, INC. - Refuge of Rush Creek FP 18-028 Wetland Escrow 500-20436$2,744.46WENCK ASSOCIATES, INC. - Pulte Encore - PUD Skch 17-029 500-20332$3,270.60WENCK ASSOCIATES, INC. - Wessel Property Feasibility Study 500-20471$62.50WENCK ASSOCIATES, INC. - St. Therese Sketch Plan 19-006 500-20332$679.40WENCK ASSOCIATES, INC. - Wessel Property Feasibility Study 500-20390$16.20WRIGHT HENNEPIN - Ravinia Street Lights Total 17,437.38 Total Fund #500 = 17,437.38 See attached Payments Detail) ALL OTHER FINANCIAL CLAIMSAgendaItem:7b.$ 156,058.15$ 173,495.53Total Checks See attached Check Detail Register) Total of Auto Deductions 97,858.40 TOTAL EXPENDITURES FOR APPROVAL$ 271,353.93 Auto Deductions / Electronic Fund Transfer / Other Disbursements DatePaid toAmount 1/9/2020Olives - Mankato, MN$ 34.68PD Training 1/9/2020Chipotle - Minneapolis, MN$ 48.66PD Training 1/9/2020Ummies - Mankato, MN$ 124.70PD Training 1/9/2020Paypal - Ehlers$ 295.00City Administrator Training 1/10/2020Mankato City Center Hotel - Mankato, MN$ 197.36PD Training 1/10/2020Mankato City Center Hotel - Mankato, MN$ 197.36PD Training 1/10/2020Mankato City Center Hotel - Mankato, MN$ 197.36PD Training 1/10/2020Mankato City Center Hotel - Mankato, MN$ 197.36PD Training 1/10/2020Mankato City Center Hotel - Mankato, MN$ 197.36PD Training 1/10/2020Olives - Mankato, MN$ 42.68PD Training 1/10/2020Flask - Mankato, MN$ 89.76PD Training 1/16/2020Rah Raw LLC - Osseo, MN$ 76.99K9 Supplies 1/17/2020UPS$ 14.92PD Shipping 1/8/2020Revtrak SV9T$ 251.23Credit Card Fees for December 1/9/2020Payroll Taxes$ 670.92payroll taxes 1/9/2020PERA$ 15,401.58Pension plan 1/9/2020State of MN - MSRS$ 2,251.34State of MN healthcare savings plan 1/9/2020State of MN - Roth$ 2,129.43Deferred compensation payment to State of MN 1/13/2020MN Dept of Revenue Payroll Taxes $ 100.92payroll taxes 1/13/2020MN DEPT OF REVEN, MN Rev pay$ 161.03Monthly fuel tax 1/13/2020Optum - H S A$ 3,049.88Health savings account 1/16/2020ADP Wage Garnishment$ 542.77Garnishment 1/16/2020Payroll Taxes$ 19,411.58payroll taxes 1/16/2020Net Payroll PP02$ 52,173.53Net payroll PP02 Total 97,858.40 H:\\CityHallInformation\\CITYGOVERNMENT\\Council, Commissions & Committees\\CouncilInformation\\CouncilClaims\\2020ClaimsWorkbook.xls 10100FarmersStateBankUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaid E100-43100-226SignRepairMaterialsE100-43100-210OperatingSupplies (GENERAL)E100-42100-223BuildingRepairSuppliesE100-43100-417UniformsE100-43100-417UniformsE100-41941-210OperatingSupplies (GENERAL)E100-43100-417UniformsE100-43100-417UniformsE100-41941-210OperatingSupplies (GENERAL)E100-42100-223BuildingRepairSuppliesE100-43100-210OperatingSupplies (GENERAL)E100-41941-380Utility & Services (GENERAL)E100-45200-380Utility & Services (GENERAL)E100-43100-212MotorFuelsE100-41951-210OperatingSupplies (GENERAL)E100-42100-200OfficeSupplies (GENERAL)E100-43100-229CulvertsE100-41941-300ProfessionalSrvs (GENERAL)E100-45200-210OperatingSupplies (GENERAL)E100-45200-210OperatingSupplies (GENERAL)E100-45200-210OperatingSupplies (GENERAL)E100-41540-300 Professional Srvs (GENERAL)Total CENTERPOINTENERGYHOUSTONTotal ADVANCEDDRAINAGESYSTEMSTotal AMAZONCAPITALSERVICESTotal ABDO, EICK & MEYERS, LLPTotal BEAUDRYOILCOMPANY Total 3DSPECIALTIESTotal ACMETOOLS3DSPECIALTIESCINTAS - 470CENTERPOINTENERGYHOUSTONBEAUDRYOILCOMPANYAMAZONCAPITALSERVICESADVANCED DRAINAGESYSTEMSADP, LLCACMETOOLSABDO,EICK & MEYERS, LLPTotal ADP, LLC$2,067.03$4,636.80$6,000.00($144.00)$144.00$146.20$638.82$252.50$72.00$49.94$64.33$63.19$93.15$82.47$93.15$63.19$82.59$75.99$94.61$35.13$88.80$53.31213612404013182740401318204040131810404013177140395288554039528805403952877740395287714039528751403952873980000141434180000141434119GX-3QRR-617DG-NLM3-D548894210724487072410797226402423810SIGNREPAIRMATERIALSPUBLICWORKSFLOOR MATS - POLICEUNIFORMSUNIFORMSCITY HALL - RUGSUNIFORMSUNIFORMSCITYHALLFLOOR MATS - POLICEPUBLICWORKSNATURALGASNATURALGASDIESELFUELCITYI.T. - COMPUTEROFFICESUPPLIESCULVERTSUPPLIESWORKFORCENOWPAYROLLSOLUTIONSBUNDLESUPPLIESSUPPLIESSUPPLIESAUDITSERVICESFY12-31-1901/17/201:22PMCITYOFCORCORAN2,067.03$4,636.80$6,000.00$252.50$181.33$638.82$142.11$72. 00 Page 1 Check Detail Register© January 2020 Check UnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaid E100-41941-210OperatingSupplies (GENERAL)G100-20205ReimbursementsE100-43100-131EmployerPaidHealthE100-42102-131EmployerPaidHealthE100-42100-131EmployerPaidHealthE100-41400-131EmployerPaidHealthE100-41300-131EmployerPaidHealthE602-49450-380Utility & Services (GENERAL)E601-49400-380Utility & Services (GENERAL)E601-49400-215WaterMetersE601-49400-215WaterMetersG100-20205ReimbursementsE100-43100-131EmployerPaidHealthE100-42100-131EmployerPaidHealthE100-41400-131EmployerPaidHealthG100-20205ReimbursementsE100-43100-131EmployerPaidHealthE100-42100-131EmployerPaidHealthE100-41400-131EmployerPaidHealthE100-41941-210OperatingSupplies (GENERAL)E202-42100-213PoliceK9E100-41951-300ProfessionalSrvs (GENERAL)E100-42100-321 TelephoneE 100-41941-321 TelephoneE 100-41941-210 OperatingSupplies (GENERAL)Total CORCORANPETCARECENTER, LLCTotal COMPUTERINTEGRATIONTECHTotal CULLIGANBOTTLED WATERTotal FERGUSONWATERWORKSTotal GOPHERSTATEONECALL Total COMCAST-INTERNETTotal DELTADENTALTotal CINTAS - 470COMCAST-INTERNETHEALTH PARTNERSGOPHER STATEONECALLFERGUSON WATERWORKSDELTA DENTALCULLIGAN BOTTLED WATERCORCORAN PETCARECENTER, LLCCOMPUTER INTEGRATION TECH$1,321.80$1,767.53$6,922.87$8,891.60$3,096.30$324.00$747.66$751.06$101.25$101.25$271.90$187.40$132.05$187.40$132.05$110.86$217.86$82.59$63.00$92.10$63.00$92.10$72.42$72.43$82.474040131862947803239478032394780323947803239478032394780323910030991003090348976-10348976RIS000258745RIS000258745RIS000258745RIS000258745CNS00003805CNS00003805CNS00003805CNS00003805114X73818805107362875280109200109204040131864CITYHALLHEALTHPARTNERS2/20INVOICEHAMILTONHEALTHPARTNERS2/20INVOICEHEALTHPARTNERS2/20INVOICEHEALTHPARTNERS2/20INVOICEHEALTHPARTNERS2/20INVOICEHEALTHPARTNERS2/20 INVOICESERVICESERVICEMETERSMETERSDENTALINSURANCE - HAMILTONDENTALINSURANCEDENTALINSURANCEDENTAL INSURANCEDENTALINSURANCEHAMILTONDENTALINSURANCEDENTALINSURANCEDENTALINSURANCEK9VETCAREIT MANAGEDSERVICE - MTHPDInternetCityHall InternetCITYHALL - RUGS01/17/201:22 PM CITYOFCORCORAN1,593.70$927.67$202.50$949.10$110.86$217.86$324.00$ 144.85 Page 2 Check Detail Register© January 2020 UnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaid G100-20205ReimbursementsE425-43100-530ImprovementsOtherThanBldgsE602-49450-310OtherProfessionalServicesE602-49450-312MCESSewageTreatmentE100-41900-433DuesandMembershipsE100-41951-207ComputerSuppliesE100-43100-220Repair/MaintSupply (GENERAL)E100-41910-300ProfessionalSrvs (GENERAL)E100-41910-300ProfessionalSrvs (GENERAL)G500-20482NelsonSketchPlan19-023G500-20469Rav11-1318-040, 19-002 & 012G500-20470RollingHillsAcresPP19-004G500-20332LennarWesselFeasibilityG500-20475LithgowAutoCUP/SP19-013E100-41920-300ProfessionalSrvs (GENERAL)G500-20468MeyerLotLineAdjust18-039E100-42100-212MotorFuelsE100-42100-301PrisonerE100-43100-210OperatingSupplies (GENERAL)E100-42100-323 Radio UnitsTotal METROPOLITAN COUNCIL ENVIROTotal METROPOLITAN COUNCIL MCESTotal HENN CO SHERIFF-MC131 Total HOLIDAYCOMPANIESTotal LCTRANSPORTLLCTotal HEALTHPARTNERSTotal METROCITIESTotal LANDFORMHENNCOSHERIFF-MC131MNDEPTOFTRANSPORTATIONMETROPOLITAN COUNCILMCESMETROPOLITANCOUNCILENVIROMETROCITIESLETGLLCLCTRANSPORTLLCLANDFORMHOLIDAY COMPANIESTotal LETGLLC$56,583.45$1,058.82$3,882.84$2,499.00$3,366.00$2,567.00$1,269.48$195.57$363.31$37500$200.00$768.00$909.00$779.25$48.00$98.33$40.50$60.75$68.50$26.5994780323P000112440117204572661692019-4312300423004230042300423004230042300423004130039011020100014186910001415681000141501HEALTH PARTNERS 2/20INVOICE SCHUTTEStieg Road RealignmentSAC ACTIVITYMATERIAL TREATMENT2020 MEMBERSHIP DUESLETG MAINTENANCE ANDSUPPORT ANNUAL FEE PLOWTRUCKTOWING FEECityMeetingsCorcoran PlanningNelson SketchPlan19-023Ravinia14thFPandFPUD19-022RollingHillsFP19-020LennarWesselFeasibility19-018LithgowAutoCUP/SP19-013CodeEnforcementMeyer LotLineAdjustment 18-039FuelPurchasePrisoner Fees - Booking / HousingRadio Fees - PublicWorksRadioFees / MDC - (Inv. )01/17/20 1:22 PMCITYOFCORCORAN23,235.84$56,583.45$1,513.05$3,882.84$2,499.00$8,759.00$375.00$26.59$98.33 2020 Page 3 Check Detail Register© January 2020 Check AmtInvoiceComment UnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaidUnpaid E100-43100-140UnemploymentComp (GENERALE100-43100-220Repair/MaintSupply (GENERAL)E100-42100-300ProfessionalSrvs (GENERAL)E100-41941-400Repairs & MaintCont (GENERAL)E100-42102-131EmployerPaidHealthE100-43100-131EmployerPaidHealthE100-42100-131EmployerPaidHealthE100-41920-131EmployerPaidHealthE100-41400-131EmployerPaidHealthE100-41300-131EmployerPaidHealthE100-41941-210OperatingSupplies (GENERAL)E100-41951-207ComputerSuppliesE100-41900-300ProfessionalSrvs (GENERAL)E100-45200-140 Unemployment Comp (GENERALTotal TRANSUNION RISK & ALTERNATIVETotal R&RSPECIALTIES OFWISCONSINTotal MNUNEMPLOYMENT INSURANCETotal MNDEPTOFTRANSPORTATIONTotal NORTHLAND SECURITIES INCTotal RITEWAY BUSINESS FORMS Total SUNLIFEFINANCIALTotal SERVICECHAMPTotal PERMITWORKSMN UNEMPLOYMENTINSURANCEWAYZATA, CITYOFTRANSUNIONRISK & ALTERNATIVETEGRETESUNLIFEFINANCIALSERVICECHAMPRITEWAYBUSINESSFORMSR&RSPECIALTIESOFWISCONSINPERMITWORKSNORTHLAND SECURITIESINCTotal TEGRETE$2,664.69$2,990.00$2,775.00$100.00$380.00$296.14$506.54$175.01$209.24$225.00$840.00$62.27$19.25$50.00$40.34$47.82$67.7920194QUI87635237687-2020-0237687-2020-0237687-2020-0237687-2020-0237687-2020-0237687-2020-05870826IN20-300790069597-IN2020-00135946593120194QUI20194THQUARTERUNEMPLOYMENTBENEFITSVEHICLEREGISTRATIONSERVICEMONTHLYCITYHALLCLEANINGEMPLOYERPAIDHEALTHEMPLOYERPAIDHEALTHEMPLOYERPAIDHEALTHEMPLOYERPAIDHEALTHEMPLOYERPAIDHEALTHEMPLOYERPAIDHEALTHSUPPLIESSUPPLIES (APCHECKS)SUPPLIES2020 BUILDING PERMIT SOFTWAREFINANCIAL REPORTINGFINANCIAL MANAGEMENT PLAN2019 4TH QUARTER UNEMPLOYMENT BENEFITS 01/17/20 1:22 PMCITYOFCORCORAN2,764.69$1,133.64$2,990.00$3,615.00$363.31$380.00$209.24$225.00$62.27$50.00 PAIDPAID Page 4 Check Detail Register© January 2020 Check AmtInvoiceComment Unpaid E100-43100-220Repair/MaintSupply (GENERAL)G500-20332LennarWesselFeasibilityE425-43100-530ImprovementsOtherThanBldgsE425-43100-530ImprovementsOtherThanBldgsG500-20471St. ThereseSketchPlan19-006G500-20332LennarWesselFeasibilityE427-43100-530ImprovementsOtherThanBldgsE425-49450-530ImprovementsOtherThanBldgsG500-20436PulteEncore - PUDSkch17-029G500-20459RefugeofRushCreekFP18-028G500-20474ComLinkMidwestCUP19-011G500-20423BassLakeEstSkchPUD17-015G500-20438BassLkCRM/IHomeEngineeringG500-20376ParkPlaceStorageE427-43100-530ImprovementsOtherThanBldgsE419-43100-303EngineeringFeesG500-20335LennarEngPlanReview/ModificE101-41911-300ProfessionalSrvs (GENERAL)E601-49400-303EngineeringFeesE602-49450-303EngineeringFeesG500-20481LandspecFund2WetlandReviewG500-20480NelsonWetlandReviewE100-43170-299WatershedLGUE100-43170-300ProfessionalSrvs (GENERAL)E601-49400-303EngineeringFeesE100-43170-300ProfessionalSrvs (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-41920-210OperatingSupplies (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220Repair/MaintSupply (GENERAL)E100-43100-220 Repair/MaintSupply (GENERAL) Total WAYZATA, CITY OFWENCK ASSOCIATES, INC.$4,243.60$7,621.60$1,928.72$3,270.60$2,744.46$2,588.70$5,317.70$2,158.45$6,150.70$1,268.80$668.90$679.40$125.00$937.50$144.12$162.40$848.20$287.50$549.10$410.50$125.00$375.00$19.25$62.50$98.00$92.80$19.25$19.25$19.25$19.25$19.25$19.25$19.2519.25$19.25$19.25$19.25$19.25$19.25$19.25$19.25$19.25$19.25$19.25$19.2500SBCJ0-120011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620011620N298D052020M2430V03420M2430V03120M1630X15320L1200W10220K0810V99920J2930M04620J257C065320J0950P42220H3230W2612H187E041520H1360T63120H1050Z29320H1050Z29220G243C014320F3350S77720F2970V21320F2950Z45820F1380Q73820VEHICLEREGISTRATIONWesselPropertyFeasibilityStudyCSAH101andStiegRoadTurnLanesStiegRoadDesignandConstructionSt. ThereseSketchPlan19-006WesselPropertyFeasibilityStudy66thStreetDesignand ConstructionPulteEncore - NETrunk SewerPulteEncore - PUDSkch17-029RefugeofRushCreekFP18-028WetlandEscrowComLinkMidwestCUP19-011BassLakeEstatesSketchPUD17-015BassLakeCrossingM/IHome17-012EngineeringPARKPLACESTORAGE66thStreetDesignandConstructionHACKAMOREROAD IMPROVEMENTS2294-0028LENNAR - ENGINEERINGCITY PARKMASTER PLANWater - EngineeringSanitarySewer - EngineeringLandspecFund2Wetland ReviewWCALGUStormWater - Engineering2019TrunkWaterMainImprovementsGeneralEngServicesVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATIONVEHICLEREGISTRATION01/17/20 1:22PMCITY OF CORCORAN 404.25 Page 5 Check Detail Register© UnpaidUnpaidUnpaid E100-43100-381Street/SignalLightsE100-43100-210OperatingSupplies (GENERAL)E100-45200-210OperatingSupplies (GENERAL)E100-43100-381Street/SignalLightsE100-43100-381Street/SignalLightsE100-43100-381Street/SignalLightsE100-43100-380Utility & Services (GENERAL)E100-41941-380Utility & Services (GENERAL)E100-45200-380Utility & Services (GENERAL)E100-45200-380Utility & Services (GENERAL)E100-43100-381Street/SignalLightsE100-43100-381Street/SignalLightsE100-43100-381Street/SignalLightsE100-43100-381Street/SignalLightsE100-43100-381Street/SignalLightsG500-20390RaviniaStreetLightsE100-45200-380Utility & Services (GENERAL)E100-41941-380Utility & Services (GENERAL)E602-49450-380Utility & Services (GENERAL)E602-49450-380Utility & Services (GENERAL)E100-43100-380Utility & Services (GENERAL)E601-49400-380Utility & Services (GENERAL)E100-41941-380Utility & Services (GENERAL)E100-41941-380Utility & Services (GENERAL)E100-42100-380Utility & Services (GENERAL)E100-42100-380Utility & Services (GENERAL)E 100-45200-380 Utility & Services (GENERAL)Total WRIGHT HENNEPINCOOPELECTTotal WENCK ASSOCIATES, INC. Total ZEPSALES & SERVICETotal XCELENERGYWRIGHT HENNEPIN COOPELECTZEP SALES & SERVICEXCEL ENERGY$917.19$426.40$426.40$135.86$128.87$167.70$108.83$216.74$64.61$28.08$27.95$10.37$20.35$20.35$18.11$20.35$16.20$16.32$42.33$33.00$16.20$26.46$15.74$15.74$64.84$9.83$9.8301152090048108899004810889668055305667583113667488670011520011520011520011520011520011520011520011520011520011520011520011520011520011520011520011520011520011520011520011520011520CTYRD10/116000-0100-1469SUPPLIESSUPPLIESSTREETLIGHTINGCR19/CR30STREETLIGHTING9525CAINROADSTREETLIGHTING9100CtyRd19: 150-1688-84638200Cty Rd116: 150-1684-203375thAve/Hwy116:120-1246-79008200CtyRd116: 120-1246-7800Cty10/Stanchion:120-1246-7600CTY10/StThomas:120-1246-7500CTY 10/Treptaus: 120-1246-7400Cty10/MapleHi: 120-1246-7300WildflowerTrl/GleasonParkway150-1694-4774BaseballFields/Irrigation: 150-1693-68558200 CR116/SIGN: 150-1693-661220120CTY10LIF:150-1691-6661BrocktonLn: 150-1689-68719525CainRd: 150-1689-523019090BassLakeRd/WtrFlow150-1687-75108200CtyRd116: 120-1255-6300SchoolProperty: 120-1247-9600Maple HillEst: 120-1246-8100Ballpark: 120-1246-720001/17/201:22 PM CITYOFCORCORAN42,859.25$1,859.04$292.81$852.80 10100 Farmers StateBank$173, 495.53 Page 6 Check Detail Register© January 2020 FundSummary10100FarmersStateBank100GENERALFUND602SEWER601WATER500ESCROWHOLDINGFUND427GLEASON/66THPARKWAYEXTENSION425PULTEENCORE/BELLWETHERPROJEC419HACKAMOREUPGRADELENNAR)202 POLICE DONATION FUND101 LONG-TERM PLANNING FUND$67,121.35$61,442.21$12,105.45$17,437.38$10,038.63$2,158.45$2,686.70$217.86$287.5001/17/20 1:22 PMCITYOFCORCORAN 173,495.53 Page 7 Check Detail Register© January 2020 Check AmtInvoiceComment CityofCorcoran ConsultantSummary 1/23/2020 NameInvoice DateAmount Due Carson, Clelland & Schreder Landform01/10/20 8,759.00 Metro West Inspection Rolf Erickson Enterprises Wenck Associates01/16/20 42,859.25 Total$ 51,618.25 H:\\CityHallInformation\\CITYGOVERNMENT\\Council, Commissions & Committees\\CouncilInformation\\Council Claims\\2020ClaimsWorkbook.xls STAFF REPORT Agenda Item. 7c. Council Meeting: January 23, 2020 Prepared By: Brad Martens, City Administrator Topic: 2020 Part-time Recreation Coordinator Wage Action Required: Approval Summary: The adopted 2020 wage schedule did not include a wage for the part-time Recreation Coordinator position. This position will exist until it moves to full-time on February 3, 2020. The wage for 2020 should be $18.54 which is a 3% increase from the 2019 wage. Financial/Budget: Wages as presented have been included in the approved 2020 budget. Council Action: Establish the Part-time Recreation Coordinator wage at $18.54 per hour for 2020. Attachments: None 105 South Fifth Avenue Suite 513 Minneapolis, MN 55401 Tel: 612-252-9070 www.landform.net Landform® and Site to Finish® are registered service marks of Landform Professional Services, LLC. Agenda Item: 7d. TO: Corcoran City Council FROM: Kevin Shay through Kendra Lindahl, Landform DATE: January 15, 2020 for the January 23, 2020 City Council Meeting RE: Code Enforcement Violation Extension for Westside Tire REVIEW DEADLINE: N/A 1. Description of Request Westside Tire is requesting an extension to the January 31, 2020 deadline for a land use application to be submitted to the City. 2. Background On November 14th the City Council reviewed a code enforcement violation for properties owned by Westside Tire at 19925 and 19950 75th Avenue North. The Council approved a motion which required that land use applications be submitted to the City by December 31, 2019 to solve the existing code enforcement issues. The Council approved a subsequent request from the owner, asking that the requirement be delayed until January 31, 2020. The owner of Westside Tire met with city staff and the mayor on January 15th. Westside is working with an engineer to develop a plan, but they cannot complete a survey of the property until the snow melts in March or April. They are asking for an extension to the January 31, 2020 deadline and staff recommends that the deadline for submittal of the application be extended to the end of April. 3.Recommendation Staff recommends that the Council extend the deadline for submittal of the land use applications to April 30, 2020. Attachments 1.Exhibit from Property Owner dated January 6, 2020 STAFF REPORT Agenda Item. 7e. Council Meeting: January 23, 2020 Prepared By: Jessica Beise Topic: 2020 Election Judge Appointments Action Required: Approval Summary: Each election cycle, the City accepts applications and hires election judges who meet the criteria of Minn Stat 204B.19. Election judges assist with election equipment testing, assist with direct balloting, and serve in the polls on election day. Election judges receive training and compensation for their service. As additional applications to serve continue to come in, staff will furnish a final list of election judges for appointment prior to the Council meeting with an updated resolution. Financial/Budget: Election judge wages are included in the 2020 budget. Council Action: Approve Resolution 2020-12 Appoint Election Judges for the 2020 Election Cycle. Attachments: City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020- Page 1 of 2 Motion By: Seconded By: A RESOLUTION APPOINTING ELECTION JUDGES FOR THE 2020 ELECTION CYCLE WHEREAS, a Presidential Nomination Primary will be held on March 3, 2020, a State Primary Election will be held on August 14, 2020, and a State General Election will be held on November 6, 2020; and WHEREAS, MN Statute 204B.21, subd.2, requires election judges for precincts in a municipality be appointed by the governing body of the municipality; and WHEREAS, the City of Corcoran has three voting precincts; and WHEREAS, the following Minnesota residents have agreed to serve as election judges and have met the qualifications established by the State of Minnesota, or will be receiving training prior to the elections and will be eligible to serve after meeting th e qualifications established by the State of Minnesota; and NOW, THEREFORE, BE IT RESOLVED, that the City of Corcoran hereby appoints the following persons to be eligible election judges for the 2020 Presidential Nomination Primary, State Primary, General Elections, with the understanding that amendments may be necessary to the appointments in order to fill vacancies and meet party splits; and approves payment of an hourly wage of $10.00 per hour for elections judges and, $10.50 per hour for head judges for election judge training, direct balloting assistance, and time served on election day. VOTING AYE VOTING NAY Thomas, Ron Thomas, Ron Bottema, Jon Bottema, Jon Dejewski, Brian Dejewski, Brian Keefe, Mike Keefe, Mike Schultz, Alan Schultz, Alan Whereupon, said Resolution is hereby declared adopted on this 23rd day of January 2020. City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020- Page 2 of 2 ________________________________ Ron Thomas - Mayor ATTEST: ____________________________________ City Seal Jessica Beise – Administrative Services Director City of Corcoran County of Hennepin State of Minnesota RESOLUTION NO. 2020-12 Motion By: Seconded By: January 23, 2020 ":+e 0 A RESOLUTION APPOINTING ELECTION JUDGES FOR THE 2020 ELECTION CYCLE WHEREAS, a Presidential Nomination Primary will be held on March 3, 2020, a State Primary Election will be held on August 14, 2020, and a State General Election will be held on November 6, 2020; and WHEREAS, MN Statute 204B.21, subd.2, requires election judges for precincts in a municipality be appointed by the governing body of the municipality; and WHERE AS, the City of Corcoran has three voting precincts; and WHEREAS, the following Minnesota residents have agreed to serve as election judges and have met the qualifications established by the State of Minnesota, or will be receiving training prior to the elections and will be eligible to serve, after meeting the qualifications established by. fihe State of Minnesota; and NOW, THEREFORE, BE IT RESOLVED, that the City of Corcoran hereby appoints the following persons to be eligible election judges for the 2020 Presidential Nomination Primary, State Primary, General Elections, with the understanding that amendments may be necessary to the appointments in order to fill vacancies and meet party splits; and approves payment of an hourly wage of $10.00 per hour for elections judges and, $10.50 per hour for head judges for election judge training, direct balloting assistance, and time served on election day. oil Gail Pro son Shelia Schouv VOTING AYE ❑ Thomas, Ron ❑ Bottema, Jon ❑ Dejewski, Brian ❑ Keefe, Mike ❑ Schultz, Alan VOTING NAY ❑ Thomas, Ron ❑ Bottema, Jon ❑ Dejewski, Brian ❑ Keefe, Mike ❑ Schultz, Alan Page 1 of 2 City of Corcoran ?County of Hennepin • `� 'State of Minnesota RES®L.0 I IUN N®. 2020-12 January z4 2uu Whereupon, said Resolution is hereby declared adopted on this 4*3 day of January 2020. ATTEST: Jessica Beise — Ron Thomas - Mayor Administrative Services Director City Seal STAFF REPORT Agenda Item 7f. Council Meeting: January 23, 2020 Prepared By: Jessica Beise Topic: Authorization to Bid/Quote 2020 Road Materials Action Required: Approval Summary: Annually the City contracts for various road materials. Staff requests authorization to obtain quotes and bids for asphalt maintenance, dust control, sealcoating/fog seal, gravel, and gravel hauling services. Financial/Budget: Costs to purchase the above services are included in the 2020 budget. Staff will adjust the ultimate project scope depending on the cost of the quotes and bids received. Council Action: Authorize staff to obtain quotes and bids for asphalt maintenance, dust control, sealcoating/fog seal, gravel, and gravel hauling services. Attachments: N/A 105 South Fifth Avenue Suite 513 Minneapolis, MN 55401 Tel: 612-252-9070 Fax: 612-252-9077 www.landform.net Landform® and Site to Finish® are registered service marks of Landform Professional Services, LLC. TO: Corcoran City Council FROM: Kevin Shay through Kendra Lindahl, Landform DATE: January 16, 2020 for the January 23, 2020 City Council Meeting RE: Final PUD Development Plan and Final Plat for U.S. Home Corporation (dba Lennar) for Ravinia 14th Addition (City File 19-022) 60-Day Review Deadline: February 7, 2020 1.Application Request Lennar submitted a request for approval of a final plat and final PUD development plan for “Ravinia 14th Addition” to allow 33 single-family detached home lots and four outlots. 2.Planning Commission The Planning Commission reviewed the Final PUD Development Plan at their regularly scheduled meeting on January 2, 2020. The applicant was the only person to speak on the item. The Commissioners discussed the proposed plan and had a question related to the water facility. After discussion, the Planning Commission voted 5-0 to recommend approval of the Final PUD Development Plan with no revisions to staff’s recommendation. 3. Context Level of City Discretion in Decision-Making The City’s discretion in approving a final PUD development plan is limited to whether the proposed plan is in substantial conformance with the approved preliminary PUD development plan. If it meets these standards, the City must approve the final PUD development plan. The City’s discretion in approving a final plat is limited to whether the proposed plat meets the standards outlined in the City’s subdivision and zoning ordinance and the conditions of preliminary plat approval. If it meets these standards, the City must approve the final plat. Background The City Council approved the Ravinia rezoning to PUD (Planned Unit Development), Preliminary PUD Development Plan and Preliminary Plat on December 23, 2013. The Final PUD Development Plan and Final Plat for Phase I was approved by City Council on April 24, 2014. Agenda Item: 8a. Lennar Final PUD Development Plan – Ravinia 14th Addition (19-022) 2 January 23, 2020 There have been thirteen phases of Ravinia granted final approval and several PUD amendments since the 2014 approval. 4. Analysis of Request Staff has reviewed the application for consistency with the approved preliminary plans, as well as City policies. The City Engineer’s comments are incorporated into this staff report and resolution and the detailed comments are included in the attached engineering memo dated November 20, 2019. Staff has included a condition that the applicant must comply with the memo. The applicant is requesting approval for 33 75-foot lots for Classic homes. Final PUD Development Plan Architecture The 14th Addition will feature the classic style homes. Each home must be consistent with the previous Ravinia approvals. Streets The streets shown have a 50-foot right-of-way. The streets must be named in compliance with the City’s street naming policy. Parking will be allowed on one side of these local streets. Street Lights The street lighting plan shows ornamental poles located at each intersection. This is consistent with the previous Ravinia phases. Driveway Locations Driveway locations are indicated on the plans submitted. Staff will review the driveway location to ensure that there are no conflicts with planned infrastructure and landscaping. Staff will also review the plans to ensure that there is a minimum of 22 feet between the garage and the right-of-way. Sidewalks and Trails The plans show sidewalks on one side of the street as required. A paved trail will be installed on the south side of the phase boundary that connects to the intersection of Hunter Road and 63rd Avenue. Lennar Final PUD Development Plan – Ravinia 14th Addition (19-022) 3 January 23, 2020 Setbacks The previous phases have approved the following dimensional requirements for the 75-foot wide lots: Approved 75- foot lots Front, From County Road 101* 100 feet Front, From all other streets 20 feet Front Porch (≤ 120 square feet) 15 feet Side 5 feet Rear 25 feet Maximum Principal Building Height 35 feet Landscaping The applicant’s plans show 71 trees where 33 are required for the residential lots. Each of the single-family homes has one tree per lot. The additional trees provided are planted adjacent to the outlot areas, the sub-monument sign and the bituminous trail. As a condition of approval, no certificate of occupancy will be issued for a home that does not have a street tree planted. Signage A sub-monument sign is proposed at the entrance off Gleason Parkway. The landscape plan is being updated to include the sign detail that is consistent with the amended Ravinia approvals. Mail Delivery Two centralized mailbox locations are shown on the landscape plans. The location of mailboxes must be approved by the US Postal Service. The applicant will need to provide proof of the approved location to the City. Water Facility The preliminary approvals required dedication of a city owned water facility shown as Outlot B, Ravinia 14th Addition. Outlot B is required to be platted as a lot and will be deeded to the City with this phase of the development. Final Plat The applicant is requesting approval of a final plat to create 33 lots and four outlots. If this subdivision is approved, it would bring the total number of platted lots to 448 of 480 approved: • Phase 1 = 38 Units • Phase 2 = 36 units Lennar Final PUD Development Plan – Ravinia 14th Addition (19-022) 4 January 23, 2020 • Phase 3 = 27 units • Phase 4 = 44 units • Phase 5 = 47 units • Phase 6 = 23 units • Phase 7 = 37 units • Phase 8 = 20 units* • Phase 9 = 49 units • Phase 10 = 26 units • Phase 11 = 14 units** • Phase 12 = 0 units • Phase 13 = 54 units • Phase 14 = 33 units Total Units = 448 units (93% of the approved lots) *The Ravinia 8th Addition added land and units to the Ravinia project and the total increased from 446 to 466 units and 268.07 gross acres to 274.07 gross acres. **The Ravinia 11th Addition added land and units to the Ravinia project and the total increased from 466 to 480 units and 274.07 gross acres to 279.68 gross acres. Conclusion Staff has reviewed the plan for consistency with the applicable standards outlined in the preliminary approvals, Zoning Ordinance and Subdivision Ordinance. 5. Recommendation The City Council should move to adopt the following: a. Resolution 2020-08 approving the final PUD development plan b. Resolution 2020-09 approving the final plat and development contract Attachments a. Resolution 2020-08 approving the final PUD development plan b. Resolution 2020-09 approving the final plat and development contract c. Draft Development Contract d. Location Map e. Engineer’s Memo dated November 20, 2019 f. Site Graphics dated January 6, 2020 g. Final Plat dated December 27, 2019 h. Landscape Plan dated December 13, 2019 City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-08 Page 1 of 3 Motion By: Seconded By: APPROVING FINAL PLANNED UNIT DEVELOPMENT (PUD) PLAN FOR “RAVINIA 14TH ADDITION” FOR THE LENNAR CORPORATION (PID 36-119-23-42-0056) (CITY FILE 19-022) WHEREAS, The Lennar Corporation (“the applicant”) has requested approval of a final PUD plan for 33 single family homes and four outlots on property legally described as: Outlot A, Ravinia 12th Addition WHEREAS, the Planning Commission has reviewed the plan at a public meeting and recommends approval, and; NOW, THEREFORE, BE IT HEREBY RESOLVED BY THE CITY COUNCIL OF THE CITY OF CORCORAN, MINNESOTA, that it should and hereby does approve the request for a final PUD development plan, subject to the following conditions: 1. A final PUD plan is approved to allow the creation of 33 single family lots for Ravinia 14th Addition on 14.67 acres, in accordance with the application materials and plans received by the City on October 15, 2019 and revised materials received November 11, 2019, except as amended by this resolution. 2. All conditions of the preliminary approvals in Resolutions 2013-60 and 2013-61 remain in place and must be met, except as modified by this resolution. 3. All conditions of the final approvals in Resolution 2014-20 and 2014-21 remain in place and must be met, except as modified by this resolution. 4. Approval is contingent upon City Council approval of the final plat and development contract. 5. The approval is subject to the review and approval by the Elm Creek Watershed Management Commission. The applicant shall comply with any conditions of approval from the watershed. Where the standards of the City and Watershed conflict, the more restrictive standard shall apply. 6. The application shall comply with all conditions in the City Engineer’s memo dated November 20, 2019. City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-08 Page 2 of 3 7. The PUD is hereby approved to allow 75-foot wide lots in this plat. All platted residential lots shall comply with the following: 75-foot lots Front, From County Road 101 100 feet Front, From all other streets 20 feet Front Porch (≤ 120 square feet) 15 feet Side 5 feet Rear 25 feet Maximum Principal Building Height 35 feet 8. All lots must comply with the required wetland buffer and wetland buffer setbacks for all structures, decks and patios. 9. All garages must have a minimum 22-foot parking area in front of the garage that does not overlap into sidewalks, drives or streets. 10. A trail easement is needed for the portion located on Lot 1, Block 3. The trail easement document must be submitted in recordable form for review and approval by the City. 11. The plans show centralized mailbox locations. These mailbox locations shall be approved by the US Postal Service and proof of the approved locations shall be provided to the City, prior to issuance of building permits. 12. The project is subject to the PUD standards, which were amended to allow flexibility in building materials and were granted PUD flexibility to allow the face of the garage to exceed 55% of the building face, subject to certain standards as outlined in the PUD approvals. Except: a. The 75-foot lots are approved for all Classic home types, which are designed with garages flush with the home. 13. The applicant shall plat Outlot B as a lot and dedicate the lot to the City of Corcoran for a water facility. 14. Trees shall be planted outside of the right-of-way in the easement to ensure even spacing along the street. 15. All homes must have street trees planted before a certificate of occupancy will be issued. 16. All permanent wetland buffer monument signs must be erected along the wetland buffer line as required by Section 1050.010, Subd. 7 of the Zoning Ordinance. a. Wetland signs shall be purchased from the City. b. The final locations must be inspected and approved by City staff. c. Monuments and signs shall be installed prior to approval of the building permit. City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-08 Page 3 of 3 17. The development shall comply with the City’s requirements regarding fire access, fire protection and fire flow calculations, the location of fire hydrants, fire department connections and fire lane signage. 18. The following conditions be met prior to issuance of building permits: a. The applicant must record the approving resolutions and associated documents at Hennepin County and provide proof of recording to the City. b. The applicant shall provide the approved preliminary and final plan drawings to the City in an electronic (AutoCAD) format. VOTING AYE VOTING NAY Thomas, Ron Thomas, Ron Bottema, Jon Bottema, Jon Dejewski, Brian Dejewski, Brian Schultz, Alan Schultz, Alan Whereupon, said Resolution is hereby declared adopted on this 23rd day of January 2020. ________________________________ Ron Thomas - Mayor ATTEST: ____________________________________ City Seal Jessica Beise – Administrative Services Director City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-09 Page 1 of 2 Motion By: Seconded By: APPROVING FINAL PLAT AND DEVELOPMENT CONTRACT FOR “RAVINIA 14TH ADDITION” FOR THE LENNAR CORPORATION (PID 36-119-23-42-0056) (CITY FILE 19-022) WHEREAS, The Lennar Corporation (“the applicant”) has requested approval of a final plat for 33 single family homes and four outlots on property legally described as: Outlot A, Ravinia 12th Addition NOW, THEREFORE, BE IT HEREBY RESOLVED BY THE CITY COUNCIL OF THE CITY OF CORCORAN, MINNESOTA, that the Corcoran City Council approves the request for a final plat; and; FURTHER, that the development contract for said plat shall be completed by city staff and the Mayor and that the City Administrator be authorized to execute the development contract on behalf of the City; and FURTHER, that the approval is granted based on the following findings and conditions: 1. A final plat is approved to allow the creation of 33 lots and four outlots in accordance with the application materials and plans received by the City October 15, 2019 and revisions received on November 11, 2019, except as amended by this resolution. 2. Development is subject to the Ravinia preliminary approvals and amendments, except as otherwise amended. 3. The developer must submit a final plat for each future phase of development. No final approvals are granted at this time for future phases. 4. The applicant shall comply with all requirements of the City Engineer’s memo, dated November 20, 2019. 5. The following conditions must be met prior to release of the final plat for recording: a. The development contract must be executed by the developer and the City and must be filed with the final plat. b. The developer must comply with all conditions in the PUD approvals (Resolution 2020-08). c. The developer must apply for an easement vacation for the drainage and utility easements over the existing outlots. The vacation documents must be filed at Hennepin County. City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-09 Page 2 of 2 d. Temporary cul de sac easements must be submitted for City review and approval. The documents must be filed at Hennepin County. 6. The following conditions be met prior to issuance of building permits: a. The applicant must file the final plat at Hennepin County within 2 years of the date of approval or the approval shall expire. b. The applicant must record the approving resolutions and associated documents at Hennepin County and provide proof of recording to the City. c. Wetland buffer monument signs must be purchased from the City and installed by the applicant in accordance with the standards in Section 1050.010. d. The applicant shall provide the approved preliminary and final plan drawings to the City in an electronic (AutoCAD) format. 7. The following conditions be met prior to release of remaining escrow: a. Lot corner monuments shall be installed as required by the Subdivision Ordinance. As part of the development contract, a financial guarantee is required to ensure installation per city requirements. VOTING AYE VOTING NAY Thomas, Ron Thomas, Ron Bottema, Jon Bottema, Jon Dejewski, Brian Dejewski, Brian Schultz, Alan Schultz, Alan Whereupon, said Resolution is hereby declared adopted on this 23rd day of January 2020. ________________________________ Ron Thomas - Mayor ATTEST: ____________________________________ City Seal Jessica Beise – Administrative Services Director (reserved for recording information) DEVELOPMENT CONTRACT (Developer Installed Improvements) RAVINIA 14TH ADDITION CONTRACT dated ____________________, 2020, by and between the CITY OF CORCORAN, a Minnesota municipal corporation (“City”), and U.S. Home Corporation (dba Lennar) (the “Developer”). This is an amendment to the Ravinia Development Contract dated June 12, 2014. 1. REQUEST FOR PLAT APPROVAL. The Developer has asked the City to approve a plat for Ravinia 14th Addition (referred to in this Contract as the "plat"). The land is situated in the County of Hennepin, State of Minnesota, and is legally described in Exhibit A. 2. CONDITIONS OF PLAT APPROVAL. The Developer shall enter into this Contract, furnish the security required by it, and record the plat upon City approval with the County Recorder or Registrar of Titles. 3. RIGHT TO PROCEED. Unless separate written approval has been given by the City, within the plat or land to be platted, the Developer may not grade or otherwise disturb the earth, remove trees, construct sewer lines, water lines, streets, utilities, public or private improvements, or any buildings until all the following conditions have been satisfied: 1) this agreement has been fully executed by both parties and filed with the City Clerk, 2) the necessary security has been received by the City, 3) the plat, development contract and other associated documents have been recorded with the Hennepin County Recorder's Office and proof of recording has been provided to the City, and 4) the City has issued written notice that all conditions have been satisfied and that the Developer may proceed. However, the Developer may be allowed to begin grading the site when items 1, 2 and 4 of the previous sentence have been satisfied. 4. PHASED DEVELOPMENT. If the plat is a phase of a multi-phased preliminary plat, the City may refuse to approve final plats of subsequent phases if the Developer has failed to fulfill all obligations in this Contract and the failure has not been remedied. Development of subsequent phases may not proceed until Development Contracts for such phases are approved by the City. Park charges and area charges for sewer and water referred to in this Contract are not being imposed on outlots, if any, in the plat that are designated in an approved preliminary plat for future subdivision into lots and blocks. Such charges will be calculated and imposed when the outlots are final platted into lots and blocks. - 2 – 5. PRELIMINARY PLAT STATUS. If the plat is a phase of a multi-phased preliminary plat, the preliminary plat approval for all phases not final platted shall lapse and be void unless final platted into lots and blocks, not outlots, within nine (9) years after preliminary plat approval. 6. CHANGES IN OFFICIAL CONTROLS. For nine (9) years from the date of this Contract, no amendments to the City's Comprehensive Plan or official controls shall apply to or affect the use, development density, lot size, lot layout or dedications of the approved final plat unless required by state or federal law or agreed to in writing by the City and the Developer. Thereafter, notwithstanding anything in this Contract to the contrary, to the full extent permitted by state law, the City may require compliance with any amendments to the City's Comprehensive Plan, official controls, platting or dedication requirements enacted after the date of this Contract. 7. DEVELOPMENT PLANS. The plat shall be developed in accordance with the following plans. The plans shall not be attached to this Contract. If the plans vary from the written terms of this Contract, the written terms shall control. The plans are: Exhibit A – Legal Description Plan A – Final Plat, dated December 27, 2019 Plan B – Final Grading, Drainage, and Erosion Control Plan, dated December 26, 2019 Plan C – Final Tree Preservation and Reforestation Plan, dated October 19, 2019 Plan D – Plans and Specifications for Public Improvements, dated January 2, 2020 Plan E – Final Street Lighting Plan, December 26, 2019 Plan F – Final Landscape Plan, dated December 13, 2019 8. IMPROVEMENTS. The Developer shall install and pay for all of the following improvements: • Streets • Sanitary Sewer • Watermain • Surface Water Facilities (pipe, ponds, rain gardens, etc.) • Grading and Erosion Control • Sidewalks/Trails • Street Lighting • Underground Utilities • Street Signs and Traffic Control Signs • Landscaping Required by Section 1060 of the Zoning Ordinance • Tree Preservation • Wetland Mitigation and Buffers • Monuments Required by Minnesota Statutes • Miscellaneous Facilities The Developer shall submit plans and specifications which have been prepared by a competent registered professional engineer to the City for approval by the city engineer or designee. The Developer shall instruct its engineer to provide full-time field inspection personnel in order for the Developer's engineer to be able to certify that the construction work meets the approved City standards as a condition of City acceptance. In addition, the City may, at the City's discretion and at the Developer's expense, have one or more City inspectors and a soil engineer inspect the work on a full or - 3 – part-time basis. The Developer, its contractors and subcontractors, shall follow all instructions received from the City's inspectors. The Developer and/or the Developer’s engineer shall provide for on-site project management. The Developer's engineer is responsible for design changes and contract administration between the Developer and the Developer's contractor. The Developer or his or her engineer shall schedule a pre-construction meeting at a mutually agreeable time at City Hall with all parties concerned, including the City staff, to review the program for the construction work. All labor and work shall be done and performed in the best and most workmanlike manner and in strict conformance with the approved plans and specifications. No deviations from the approved plans and specifications will be permitted unless approved in writing by the city engineer or designee. The Developer agrees to furnish to the City a list of contractors being considered for retention by the Developer for the performance of the work required by the contract. The Developer shall not do any work or furnish any materials not covered by the plans and specifications and special conditions of this contract, for which reimbursement is expected from the City, unless such work is first approved in writing by the city engineer or designee. The Developer shall be responsible for construction of all improvements in conformance with the approved plans and specs. 9. CONTRACTORS/SUBCONTRACTORS. City Council members, City employees, and City Planning Commission members, and corporations, partnerships, and other entities in which such individuals have greater than a 25% ownership interest or in which they are an officer or director may not act as contractors or subcontractors for the public improvements identified in Paragraph 8 above. 10. PERMITS. The Developer shall obtain or require its contractors and subcontractors to obtain all necessary permits, including but not limited to: • Minnesota Department of Health for Watermains/Wells • NPDES Permits • MPCA for Sanitary Sewer and Hazardous Material Removal and Disposal • City of Corcoran for Building Permits and Building Demolition • MCES for Sanitary Sewer Connections • Watershed Permits 11. TIME OF PERFORMANCE. The Developer shall install all required public improvements in this phase by October 31, 2020, with the exception of the final wear course of asphalt on streets. The City will not accept new public streets in phase 14 until 80% of the homes in phase 14 have received a certificate of occupancy and the streets have weathered a full winter season. Final wear course placement outside of this time frame must have the written approval of the City Engineer. The Developer may, however, request an extension of time from the City. If an extension is granted, it shall be conditioned upon updating the security posted by the Developer to reflect cost increases and the extended completion date. 12. LICENSE. The Developer hereby grants the City, its agents, employees, officers and contractors a license to enter the plat to perform all work and inspections deemed appropriate by the City in conjunction with plat development. - 4 – 13. CONSTRUCTION ACCESS. Construction traffic access and egress for grading, public utility construction, and street construction is restricted to access the subdivision via Gleason Parkway. No construction traffic is permitted on other adjacent local streets. 14. GRADING PLAN. The plat shall be graded in accordance with the approved grading drainage and erosion control plan, Plan "B". The plan shall conform to City of Corcoran Engineering Design Standards. 15. EROSION CONTROL. Prior to initiating site grading, the erosion control plan, Plan B, shall be implemented by the Developer and inspected and approved by the City. Erosion control practices must comply with the Minnesota Pollution Control Agency’s Best Management Practices. The City may impose additional erosion control requirements if they would be beneficial. All erosion control shall comply with Section 950 (Erosion Control) of the Corcoran City Code and the Corcoran Engineering Design Standards. No development, utility or street construction will be allowed and no building permits will be issued unless the plat is in full compliance with the approved erosion control plan. 16. STREET MAINTENANCE DURING CONSTRUCTION. The Developer shall be responsible for all street maintenance until the streets are accepted by the City. Warning signs shall be placed when hazards develop in streets to prevent the public from traveling on the same and to direct attention to detours. If and when streets become impassable, such streets shall be barricaded and closed. In the event residences are occupied prior to completing streets, the Developer shall maintain a smooth surface and provide proper surface drainage to ensure that the streets are passable to traffic and emergency vehicles. The Developer shall be responsible for keeping streets within and without the subdivision swept clean of dirt and debris that may spill, track, or wash onto the street from Developer’s operation. 17. OWNERSHIP OF IMPROVEMENTS. Upon completion of the work and construction required by this Contract and acceptance of the work by the City, the improvements lying within public easements or right-of-way shall become City property. Prior to acceptance of the improvements by the City, the Developer must furnish the following affidavits: • Contractor’s Certificate • Engineer’s Certificate • Land Surveyor’s Certificate 18. PARK DEDICATION. Park dedication is based on the development of the entire Ravinia site and shall be land dedication totaling approximately 32.12 net acres, due at the time of final plat for the phases that include public park dedication. No park dedication is proposed or accepted with this phase; however, the phase does include dedication of the 1.32 acre well site. 19. WATERMAIN / STORAGE TRUNK LINE AREA CHARGE (TLAC). This plat is subject to a watermain/storage trunk line area charge (TLAC). The charge is calculated as follows: 14.63 net acres (based on pre-developable area) $5,948.00 per acre = $87,019.24 for Ravinia 14th Addition. Future phases shall be cash with the final plat for each future phase subject to the then-current rates. 20. WATER CONNECTION CHARGE. This plat is subject to a water connection charge calculated as follows: 33 units x $1,182.00 per unit = $39,006.00. The fees shall be paid at the time of building permit. Future development shall be cash at the time of issuance of each building permit at the then- current rates. - 5 – The developer will be responsible for payment of the then-current water connection charge set by the City of Maple Grove. 21. SANITARY SEWER TRUNK LINE AREA CHARGE (TLAC). This plat is subject to a sanitary sewer trunk line area charge (TLAC). The charge is calculated as follows: The charge is calculated as follows: 14.63 net acres (based on pre-developable area) x $3,925.00 per acre = $57,422.75 for Ravinia 14th Addition. Future phases shall be cash with the final plat for each future phase subject to the then-current rates. The developer will also be responsible for payment of the then-current SAC fee set by the Metropolitan Council. 22. SANITARY SEWER CONNECTION CHARGE. This plat is subject to a sanitary sewer connection charge calculated as follows: 33 units x $1,182 per unit = $39,006.00. The fees shall be paid at the time of building permit. Future development shall be cash at the time of issuance of each building permit at the then-current rates. 23. BUILDING PERMITS/CERTIFICATES OF OCCUPANCY. A. Curbing, and one lift of asphalt shall be installed on all public and private streets prior to issuance of any certificate of occupancy, except one model home on a lot acceptable to the City Planner may be issued a certificate of occupancy if needed for the Parade of Homes. B. The Developer shall comply with the City of Corcoran Engineering Design Standards. C. Prior to issuance of building permits, wetland buffer monuments shall be placed in accordance with the City’s zoning ordinance. Specifications for the monuments are available from the City Planner. D. Failure to fulfill any of the terms of this Contract by the Developer, including nonpayment of billings from the City, shall be grounds for denial of building permits, including lots sold to third parties, and the halting of all work in the plat. E. If building permits are issued prior to the acceptance of public improvements, the Developer assumes all liability and costs resulting in delays in completion of public improvements and damage to public improvements caused by the City, Developer, their contractors, subcontractors, materialmen, employees, agents, or third parties. No sewer and water connection permits may be issued until the streets needed for access have been paved with a bituminous surface and the utilities are tested and approved by the City Engineer. 24. STREET REGULATORY SIGNS/TRAFFIC CONTROL SIGNS. Street name signs shall be installed by the Developer in accordance with the City of Corcoran Engineering Design Standards. The Developer shall install traffic control signs in accordance with the plan approved by the City Engineer and Minnesota Manual on Uniform Traffic Control Devices. All signs must be installed prior to final building inspection approval or earlier if necessary as determined by the City Engineer. 25. STREET LIGHT INSTALLATION AND OPERATION COSTS. The developer shall pay for and install all street lights. The street light shall be of a design approved by the City. The developer - 6 – shall be responsible for street light operation and maintenance costs until such time as the City accepts the public street where the streetlights are located. After the acceptance the City shall be responsible for all costs, subject to the street lighting policy. The costs of operation are dependent upon the operation costs for Wright Hennepin Electric under contract franchise with the City of Corcoran. 26. RESPONSIBILITY FOR COSTS. A. Except as otherwise specified herein, the Developer shall pay all costs incurred by it or the City in conjunction with the development of the plat, including but not limited to legal, planning, engineering and inspection expenses incurred in connection with approval and acceptance of the plat, the preparation of this Contract, review of construction plans and documents, and all costs and expenses incurred by the City in monitoring and inspecting development of the plat. The City may require Developer to post funds in an escrow account, at its discretion. In the event the cash escrow amount is insufficient, Developer shall post additional escrow funds as determined by the City Planner within ten (10) days of written demand. Failure to make payment of the additional escrow amount shall permit the City to supplement those amounts from any other sureties posted by Developer. B. The Developer shall hold the City and its officers, employees, and agents harmless from claims made by itself and third parties for damages sustained or costs incurred resulting from plat approval and development. The Developer shall indemnify the City and its officers, employees, and agents for all costs, damages, or expenses which the City may pay or incur in consequence of such claims, including attorneys' fees. C. The Developer shall reimburse the City for costs incurred in the enforcement of this Contract, including engineering and attorneys' fees. D. The Developer shall pay, or cause to be paid when due, and in any event before any penalty is attached, all special assessments referred to in this contract. This is a personal obligation of the Developer and shall continue in full force and effect even if the Developer sells one or more lots, the entire plat, or any part of it. E. The Developer shall pay in full all bills submitted to it by the City for obligations incurred under this Contract within thirty (30) days after receipt. Bills not paid within thirty (30) days shall accrue interest at the rate of eight percent (8%) per year. F. In addition to the charges and special assessments referred to herein, other charges and special assessments may be imposed such as but not limited to sewer availability charges ("SAC"), City water connection charges, City sewer connection charges, and building permit fees. 27. SPECIAL PROVISIONS. The following special provisions shall apply to plat development: A. Compliance with the conditions of the original approvals, PUD Amendments, including the PUD Final Development Plan (Resolution 2020-08) and Final Plat approval (Resolution 2020- 09), which are attached as Exhibit B. - 7 – B. Before the City signs the final plat, the Developer shall convey the Park to the City by warranty deed, free and clear of any and all encumbrances. Before the City signs the final plat, the developer shall convey the required trail easements to the City in a form satisfactory to the City C. The Developer shall post a $3,300 security for the final placement of interior subdivision iron monuments at property corners. The security was calculated as follows: 33 lots at $100.00 per lot. The security will be held by the City until the Developer's land surveyor certifies that all irons have been set following site grading and utility and street construction. In addition, the certificate of survey must also include a certification that all irons for a specific lot have either been found or set prior to the issuance of a building permit for that lot. D. The Developer must obtain a sign permit from the City Building Official prior to installation of any subdivision identification signs. E. The Developer shall supply a complete set of the approved construction plans in an AutoCAD.DWG electronic file format before the preconstruction conference. F. The Developer shall include the “City of Corcoran’s Standard Detail Specifications” (all applicable sections) in the contract documents of their improvement project. 28. MISCELLANEOUS. A. The Developer may not assign this Contract without the written permission of the City Council. The Developer's obligation hereunder shall continue in full force and effect even if the Developer sells one or more lots, the entire plat, or any part of it. Notwithstanding anything herein to the contrary, in conjunction with a sale of the entire land, the Developer may, without the consent of the City, assign this Contract to a limited liability company or other entity in which the Developer or an affiliate thereof has a controlling membership or other controlling ownership interest, provided that such assignee assumes in writing the obligations of Developer under this Contract. B. Certain retaining walls will require a Building Permit. Retaining walls that require a building permit shall be constructed in accordance with plans and specifications prepared by a structural or geotechnical engineer licensed by the State of Minnesota. Following construction, a certification signed by the design engineer shall be filed with the Building Official evidencing that the retaining wall was constructed in accordance with the approved plans and specifications. All retaining walls identified on the development plans or by special conditions referred to in this Contract shall be constructed before any other building permit is issued for a lot on which a retaining wall is required to be built. C. Appropriate legal documents including, but not limited to, those regarding Homeowner Association documents, conservation easements, covenants and restrictions, as approved by the City Attorney, shall be filed with the Final Plat. D. Developer shall take out and maintain or cause to be taken out and maintained until six (6) months after the City has accepted the public improvements, public liability and property damage insurance covering personal injury, including death, and claims for property damage which may arise out of Developer's work or the work of its subcontractors or by one directly or - 8 – indirectly employed by any of them. Limits for bodily injury and death shall be not less than $500,000 for one person and $1,000,000 for each occurrence; limits for property damage shall be not less than $200,000 for each occurrence; or a combination single limit policy of $1,000,000 or more. The City shall be named as an additional insured on the policy, and the Developer shall file with the City a certificate evidencing coverage prior to the City signing the plat. The certificate shall provide that the City must be given thirty (30) days advance written notice of the cancellation of the insurance. The insurance shall be primary and non-contributory as to any policy maintained by the City. E. Third parties shall have no recourse against the City under this Contract. F. If any portion, section, subsection, sentence, clause, paragraph, or phrase of this Contract is for any reason held invalid, such decision shall not affect the validity of the remaining portion of this Contract. G. The action or inaction of the City shall not constitute a waiver or amendment to the provisions of this Contract. To be binding, amendments or waivers shall be in writing, signed by the parties and approved by written resolution of the City Council. The City's failure to promptly take legal action to enforce this Contract shall not be a waiver or release. H. This Contract shall run with the land and may be recorded against the title to the property. The Developer covenants with the City, its successors and assigns, that the Developer has fee title to the property being final platted and/or has obtained consents to this Contract, in the form attached hereto, from all parties who have an interest in the property; that there are no unrecorded interests in the property being final platted; and that the Developer will indemnify and hold the City harmless for failure to fulfill any of the foregoing covenants. I. Each right, power or remedy herein conferred upon the City is cumulative and in addition to every other right, power or remedy, express or implied, now or hereafter arising, available to City, at law or in equity, or under any other agreement, and each and every right, power and remedy herein set forth or otherwise so existing may be exercised from time to time as often and in such order as may be deemed expedient by the City and shall not be a waiver of the right to exercise at any time thereafter any other right, power or remedy. J. The Developer represents to the City that the plat complies with all city, county, metropolitan, state, and federal laws and regulations, including but not limited to: subdivision ordinances, zoning ordinances, and environmental regulations. If the City determines that the plat does not comply, the City may, at its option, refuse to allow construction or development work in the plat until the Developer does comply. Upon the City’s demand, the Developer shall cease work until there is compliance. 29. DEVELOPER’S DEFAULT. In the event of default by the Developer as to any of the work to be performed by it hereunder, the City may, at its option, perform the work and the Developer shall promptly reimburse the City for any expense incurred by the City, provided the Developer, except in an emergency as determined by the City, is first given notice of the work in default, not less than 48 hours in advance. This contract is a license for the City to act, and it shall not be necessary for the City to seek a court order for permission to enter the land. When the City does any such work, the City may, in addition to its other remedies, assess the cost in whole or in part. - 9 – 30. WARRANTY/PERFORMANCE GUARANTEE. The Developer warrants all improvements required to be constructed by it pursuant to this Contract against poor material and faulty workmanship. The Developer shall submit either 1) a warranty/maintenance bond for 100% of the cost of the improvement, or 2) a letter of credit or performance bond for twenty-five percent (25%) of the amount of the original cost of the improvements. A. The required warranty period for materials and workmanship for the utility contractor installing public sewer and water mains shall be two (2) years from the date of final written City acceptance of the work. B. The required warranty period for all work relating to street construction, including concrete curb and gutter, sidewalks and trails, materials and equipment shall be subject to one (1) year from the date of final written acceptance, unless the wearing course is placed during the same construction season as the bituminous base course. In those instances, the subdivider shall guarantee all work, including street construction, concrete curb and gutter, sidewalks and trails, material and equipment for a period of two (2) years from the date of final written City acceptance of the work. C. The required warranty period for sod, trees, and landscaping is one full growing season following installation. Following construction, a certification signed by the design landscape architect shall be filed with the City evidencing that the sod, trees, and landscaping was installed in accordance with the approved plans and specifications. 31. SUMMARY OF SECURITY REQUIREMENTS. To guarantee compliance with the terms of this contract, payment of special assessments, payment of the costs of all public improvements, and construction of all public improvements, the Developer shall furnish the City with a letter of credit, in a form acceptable to the City, from a bank, cash escrow or a combination cash escrow and Letter of Credit ("security") for $998,795.24 which represents 100 percent of the estimated cost of the Improvements. The letter of credit shall include an automatic renewal clause. The letter of credit shall guarantee to the City the construction and satisfactory completion of all items to be completed by the developer; that the letter of credit shall be reduced from time to time as work is performed and accepted in a satisfactory manner; that the city engineer may reduce the letter of credit to the amount reasonably estimated by the City engineer to be necessary to cover the remaining construction obligations; however, the letter of credit shall not be reduced below the amount estimated by the City to cover all obligations of development including payment of costs and expenses incurred by the City for legal, engineering, planning and any other costs until a maintenance bond for period of one year, satisfactory to the city attorney and the city engineer has been provided by the developer or its subcontractor. The amount of the security was calculated as follows: - 10 – ESTIMATED COSTS City Project Developer ITEM No._______(1) Installed (2) Private (3) Total Street Construction* $313,980.50 $313,980.50 Sanitary Sewer System $159,641.91 $159,641.91 Watermain System $148,116.50 $148,116.50 Storm Sewer System $107,946.50 $107,946.50 Boulevard and Drainage Swale Sod $0 $0 Pond Construction $0 $0 Rain Garden $0 $0 Street and Traffic Control Signs $0 Sidewalk Improvements $0 Trail Improvements $0 $0 Landscaping $25,000.00 $25,000.00 Street Lighting $0 Site Grading & Drainage Imp.** $170,125.00 $170,125.00 Setting Iron Monuments $0 $0 Tree Preservation and Reforestation $0 Wetland Buffer Monuments $0 SUB-TOTAL: $924,810.41 $924,810.41 Design, Admin, Insp, As-Builts (8%) $73,984.83 $73,984.83 Total: $998,795.24 $998,795.24 Total Project Cost $998,795.24 (1) Public Improvement/City Project. City to own and maintain after development complete. (2) Developer Installed Public Improvements. City to own and maintain after development complete. (3) Private - Property owner and/or property owners' association to maintain after development completed. *Street Construction includes costs for sidewalk and trail improvements **Note: If a grading permit was issued and the financial guarantee released and/or expired, these monies may be used for the required maintenance of the erosion and sediment control plan. 32. This breakdown is for historical reference; it is not a restriction on the use of the security. The bank shall be subject to the approval of the City Administrator. The City may draw down the security, without notice, for any violation of the terms of this contract or if the security is allowed to lapse prior to the end of the required term. If the required public improvements are not completed at least 30 days prior to the expiration of the security, the City may also draw it down. If the security is drawn down, the proceeds shall be used to cure the default. Upon receipt of proof satisfactory to the city engineer or designee that work has been completed and financial obligations to the City have been satisfied, with city engineer or designee approval the security may be reduced from time to time by 75% of the financial obligations that have been satisfied. Twenty-five percent (25%) of the amounts certified by the Developer's engineer shall be retained as security until: (1) all improvements have been completed; (2) - 11 – iron monuments for lot corners have been installed; (3) all financial obligations to the City satisfied; (4) the required "record" plans have been received by the City; (5) a warranty security is provided; and (6) the public improvements are accepted by the City. 33. SUMMARY OF CASH REQUIREMENTS. The following is a summary of the cash requirements under this Contract which must be furnished to the City at the time of final plat approval: Water Supply Trunk line area charge (TLAC) $ 87,019.24 Sanitary Sewer Trunk line area charge (TLAC) 57,422.75 Engineering Escrow 75,000.00 TOTAL CASH REQUIREMENTS LEVIED: $ 219,441.99 34. NOTICES. Required notices to the Developer shall be in writing, and shall be either hand delivered to the Developer, its employees or agents, or mailed to the Developer by certified mail at the following address: _______________________________ _______________________________ _______________________________ Notices to the City shall be in writing and shall be either hand delivered to the City Administrator, or mailed to the City by certified mail in care of the City Administrator at the following address: Corcoran City Hall, 8200 County Road 116, Corcoran, MN 55340. The Developer shall notify the City within five (5) days of change of address. CITY OF CORCORAN: BY: ______________________________________ Ron Thomas, Mayor (SEAL) AND _____________________________________ Brad Martens, City Administrator STATE OF MINNESOTA ) ( ss. COUNTY OF HENNEPIN ) The foregoing instrument was acknowledged before me this _______ day of ________________, 20____, by Ron Thomas and by Brad Martens, the mayor and city administrator of the City of Corcoran, a Minnesota municipal corporation, on behalf of the corporation and pursuant to the authority granted by its City Council. ______________________________________ NOTARY PUBLIC DEVELOPER: By: ______________________________________ Its: ______________________________________ STATE OF MINNESOTA ) ( ss. COUNTY OF HENNEPIN ) The foregoing instrument was acknowledged before me this ________ day of ________________, 20____, by __________________________________ the ____________________________________ of ______________________________________ on its behalf. ______________________________________ NOTARY PUBLIC DRAFTED BY: CITY OF CORCORAN 8200 County Road 116 Corcoran, MN 55340 FEE OWNER CONSENT TO DEVELOPMENT CONTRACT _______________________________________________________, fee owners of all or part of the subject property, the development of which is governed by the foregoing Development Contract, affirm and consent to the provisions thereof and agree to be bound by the provisions as the same may apply to that portion of the subject property owned by them. Dated this _____ day of ____________, 2_____. ______________________________________ ______________________________________ STATE OF MINNESOTA ) ( ss. COUNTY OF HENNEPIN ) The foregoing instrument was acknowledged before me this _____ day of _____________, 2____, by ______________________________________________________. ________________________________________ NOTARY PUBLIC DRAFTED BY: CITY OF CORCORAN 8200 County Road 116 Corcoran, MN 55340 MORTGAGE CONSENT TO DEVELOPMENT CONTRACT _______________________________________________________, which holds a mortgage on the subject property, the development of which is governed by the foregoing Development Contract, agrees that the Development Contract shall remain in full force and effect even if it forecloses on its mortgage. Dated this _____ day of ____________, 2_____. ______________________________________ ______________________________________ STATE OF MINNESOTA ) ( ss. COUNTY OF HENNEPIN ) The foregoing instrument was acknowledged before me this _____ day of ________________, 2_____, by __________________________________________________________________________. ________________________________________ NOTARY PUBLIC DRAFTED BY: CITY OF CORCORAN 8200 County Road 116 Corcoran, MN 55340 CONTRACT PURCHASER CONSENT TO DEVELOPMENT CONTRACT _______________________________________________________________, which/who has a contract purchaser's interest in all or part of the subject property, the development of which is governed by the foregoing Development Contract, hereby affirms and consents to the provisions thereof and agrees to be bound by the provisions as the same may apply to that portion of the subject property in which there is a contract purchaser's interest. Dated this _____ day of ____________, 2_____. ______________________________________ ______________________________________ STATE OF MINNESOTA ) ( ss. COUNTY OF HENNEPIN ) The foregoing instrument was acknowledged before me this _____ day of ________________, 2____, by ____________________________________________________________________________. ________________________________________ NOTARY PUBLIC DRAFTED BY: CITY OF CORCORAN 8200 County Road 116 Corcoran, MN 55340 EXHIBIT “A” TO DEVELOPMENT CONTRACT Legal Description of Property Being Final Platted as RAVINIA 14TH ADDITION The Registered portion being that part of Outlot A, Ravinia 12th Addition, embraced within Lot 1, Block 1, Farrell 2nd Addition EXHIBIT “B” TO DEVELOPMENT CONTRACT APPROVING RESOLUTIONS Henn e p in Co u nty Prop erty Map Da te : 11 /26/2019 Com ments: 1 inc h = 4 00 feet Divisio n in Proces s The d isp layed p arc e l b oun da ry may n ot be the actual boundarybecause th is pr op er ty is in the p roc ess of being dividedor r epla tt ed. PID : 3 611 923420056ADDRESS: 5 2 Add res s Pe nd ing, Corc oran MN 00000 This dat a (i) is fur nished 'AS IS' wit h no represent at ion as t o com plet enes s or acc ura cy ; (ii) is furnis hed with no war rant y of an y k ind; an d (i ii) is not s uit able for lega l, engi neering or s urv ey ing purpos es . Hen nepin C ounty s hall not be liable f or any damage, in jury o r los s r esu lt ing f rom t his data. CO PYRIG HT © HENNEPIN CO UN TY 20 19 Technical Memo Wenck | Colorado | Georgia | Minnesota | North Dakota | Wyoming Toll Free 800-472-2232 Web wenck.com To: Kevin Mattson, PE, Director of Public Works From: Kent Torve, PE Nick Wyers Rowdy Schmidt Date: November 20, 2019 Subject: Ravinia – 14th Addition Plan Review Lennar submitted plans for the Ravinia development 14th Addition for City of Corcoran review. Plans dated October 15th, 2019 have been received October 15th, 2019 for the proposed Ravinia development. The following comments are regarding the plans submitted and should be considered and addressed. 1.0 Transportation 1.1 Cross slope on pedestrian ramp does not meet 2% ADA standards. 2.0 Trails 2.1 Trail to be graded and paved to Hunter Road. Provide plan and profile. 2.1.1 Trail elevation to maintain existing wetland 8 normal water level. 2.1.2 Trail elevation to provide 2’ freeboard elevation to existing home low openings. 2.1.3 Provide additional information on the existing property low openings 2.2 Trail easement required on Lot 1 Block 3. 2.3 Install concrete pedestrian ramp with phase 5 sidewalk and phase 14 trail. 3.0 Sewer 3.1 Include note by drop manholes that says “all drop MH to be lined with GSE studliner or approved equal” 3.2 Update note #2 on sheet 6 to read as “SDR 26 for depths between 16’ and 25’, PVC C900 over 25’” 3.3 Pipe material to be SDR 26 from E29 to MH 15, asbuilts from Phase 5 show SDR 26 stubbed from MH E29 3.4 Verify sanitary sewer is below 10 FPS 3.5 Relocate MH 11 to Bridle Path. Install stub for sanitary sewer to Outlot A. Stub west of the storm sewer. 4.0 Water 4.1 Hydrants to be installed at high point of watermain. 4.2 Hydrant spacing to be reviewed by public safety. Engineer’s Memo November 20, 2019 2 4.3 Install gate valve near STA 5+75. Install in location to be out of curb. 4.4 Install valve to Hunter neighborhood 2’ south of ROW 4.5 Pipe insulation when vertical separation is 2’ or less. 5.0 Grading and Stormwater Storm Sewer 5.1 Install additional CBs on Prairie Sage Lane to conform with City of Corcoran guidelines (200-250-ft spacing). 5.2 Show utility crossings on storm sewer profiles. 5.3 There are 2 options for EX CBMH 37. Either replace EX CBMH with a sump structure, or change grade from EX CBMH 37 and CBMH 64 to lessen drop in EX CBMH 37 to 1’ and change grade from EX CBMH 37 to CBMH 61 to lessen drop. Coordinate with Engineer 5.4 Revise easements on Lots 2 and 3 Block 1 to cover storm sewer. (Plat has this easement correct) 5.5 Relocate CBMH 69 and CB 70 to be relocated to approximate STA 7+00 for grade transition from steep to flat. 5.6 Stormsewer to be designed and installed under the trail to Hunter Road. Storm sewer to be constructed on Ravinia property for Wetland #8 overflow. 5.7 Revise rear yard storm sewer to bypass Wetland 8 and outlet to Wetland #9. Stormwater 5.8 Revise starting water level of Wet 8 to be at outlet elevation. Existing Outlet elevation to be at EOF of 985.6. 5.9 Provide markup of flow path for Time of Concentration calculations for Wet 8. 5.10 Revise drainage area for Wet 8 per attached markup. 5.11 Provide overflow on trail for Wetland #8. EOF elevation to match existing conditions. Location of EOF to remain on Ravinia property. Coordinate with Engineer. 5.12 Provide outlet for Wetland #8. Coordinate with Engineer. 5.13 Review drainage at Elderberry Court and Bridle Path. Coordinate with Engineer. Grading 5.14 Revise grading plan along retaining wall. Swale is graded at less than 2%. 5.15 Verify and label Outlot A EOF 5.16 Retaining walls 4’ or greater to be designed by licensed engineer. 5.16.1 Submit retaining wall design for review 5.17 LMOR F may be needed for lots adjacent to Wetland #9. 5.18 Lot 2 Block 2 does not meet 2’ freeboard over 996.5 EOF 5.19 Provide EOF elevation for Block 1. Engineer’s Memo November 20, 2019 3 6.0 Erosion Control 6.1 City of Corcoran is an MS4 city and site visits to be conducted weekly. 6.2 Provide rock construction entrance 7.0 General 7.1 Revise tree preservation plan to match what occurred in field. 7.2 Lighting plan to be reviewed by City Staff. 7.3 Street sign plan to be reviewed by City Staff. 7.4 Use updated detail plates 7.5 Provide additional information on offsite trail and future utilities connecting to Hunter Road. Coordinate with Engineer. 8.0 Plat 8.1 Easement required for retaining wall on Lot 10 Block 3 to put entire wall in D/U easement. 8.1.1 Encroachment agreement required on retaining wall. 8.2 Easement required on Lot 1 Block 3 to include trail. 8.3 Blanket drainage and utility easement over Outlot C required. 8.4 Outlot B to be platted as a Lot (Lot 16 or other) Existing Home 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 242526 27 2829 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 5960 61 62 63 64 65 6667 68 69CARRIAGE WAYBRIDLE PAT H BR I D L E P A T H STEEPLECHASELANECIRCLEBLUESTEMSAGE LAN E GLEASON PARKWAY CAR RI A G E W A Y BIRDLE PATHGALLOWAY CIRCLE ANNABELLE LANE SNOWBERRY COURTME A DOW R U E C O U R T STEEPLE G O L D E N R O D LUPINE L A N E L U P I N E L A N E CHASE L A N E T R A I LSTEEPLECHASELANE LANELAR K S P U R COURTLARKSPURPADD O C K L A N E S O R R E L C T . PENN Y R O Y A L C T . GLEASON PARKWAY SUNFLOW E R PRIM R O S E LANEWIL D F LOW E R TR A I L LARKSPURLANER O A D 2 SEE SHEET 2 PHASE LIMIT Phone (952) 937-5150 12701 Whitewater Drive, Suite #300 Fax (952) 937-5822 Minnetonka, MN 55343 Toll Free (888) 937-5150 Planting NotesPlanting Details Mailbox Unit (Post Mount) 37 38 39 40 41 42 43CARRIAGE WAYBR I D L E P A T H STEEPLECHASELANECIRCLEBLUESTEMSAGE LAN E CAR RI A G E W A Y S O R R E L C T . PEN N Y R O Y A L C T . GLEASON PARKWAY PRIOR PHASE LANDSCAPING (TYP.) CITY PARK PRIOR PHASE LANDSCAPING (TYP.) SEE SUBMONUMENT DETAIL PRIOR PHASE LANDSCAPING (TYP.) SEE MAILBOX DETAIL SEE MAILBOX DETAIL Phone (952) 937-5150 12701 Whitewater Drive, Suite #300 Fax (952) 937-5822 Minnetonka, MN 55343 Toll Free (888) 937-5150 Phase 14 Final Tree Schedule Phase 14 Final Understory Plant Schedule Mailbox Unit (Typ. of 2) Monument Column Detail (Typ. of 1) · 1"= 20' 1"= 20' · 105 South Fifth Avenue Suite 513 Minneapolis, MN 55401 Tel: 612-252-9070 www.landform.net Landform® and Site to Finish® are registered service marks of Landform Professional Services, LLC. Agenda Item: 8b. TO: Corcoran City Council FROM: Kendra Lindahl, Landform DATE: January 16, 2020 for the January 23, 2020 City Council Meeting RE: Environmental Assessment Worksheet for the U.S. Home Corporation dba Lennar for “Wessel Residential Development” an approximately 551-unit development from Lennar at 20020 Hackamore Road (city file 19-018) REVIEW DEADLINE: February 1, 2020 1.Description of Request An Environmental Assessment Worksheet (EAW) is required for the approximately 551-unit development proposed on an approximately 270-acre site. The property is located west of County Road 116 and north of Hackamore Road. The Minnesota Environmental Review Program requires a mandatory EAW for residential developments with more than 250 detached units or 375 attached units for a city within the seven-county Twin Cities metropolitan area that has filed certification that it has adopted a comprehensive plan with the Minnesota Environmental Quality Board (EQB). 2.Comments Received on the EAW Section 4410.1600 of the Environmental Rules states that comments received on the EAW shall address the accuracy and completeness of the material, potential environmental impacts that may warrant further investigation before the project is commenced and the need for an EIS on the proposed project. The 30-day EAW comment period ended on January 2, 2020 at the end of business day. The response to the EAW comments was prepared and is listed as attachment called the “Record of Decision”. This document includes all written comments submitted by the public and governmental agencies as well as the responses. 3.Level of City Discretion in Decision-Making Under Minnesota Environmental Review Program rules, the City is the governmental unit responsible for preparing this EAW and determining whether the project has the potential for significant environmental effects. The purpose of the environmental review process is to provide usable information to the project proposer, governmental decision-makers and the public concerning the primary environmental effects of a proposed project. The EAW should identify measures to protect the environment that can later be imposed as conditions of approval in future development applications. Wessel Residential Development (19-018) 2 January 23, 2020 If the EAW identifies significant environmental effects that cannot be mitigated or minimized, the City Council would order preparation of an EIS. An EIS does not necessarily disclose more information about potential impacts; but rather, its main purpose is to examine project alternatives and additional mitigative measures to lessen significant impacts identified in the EAW. Furthermore, an EIS is not a means to approve or deny a project but is an additional source of information to guide decisions. Very few projects move to the EIS stage, because in most cases the EAW does an adequate job of describing potential impacts and identifying mitigative measures. The statutory standard for requiring an EIS is whether the project has the potential for significant environmental effects—it is not whether the EAW has adequately disclosed information about potential impacts. Accordingly, if the City Council determines that the EAW does not disclose sufficient information about potential impacts, the City Council would request additional information before deciding on the need for an EIS. In deciding whether a project has the potential for significant environmental effects that would warrant the preparation of an EIS, the City Council must consider the following factors (Minnesota Environmental Review Rules Section 4410.1700, Subpart 7): 1. type, extent, and reversibility of environmental effects; 2. cumulative potential effects of related or anticipated future projects; 3. the extent to which the environmental effects are subject to mitigation by ongoing public regulatory authority; and 4. the extent to which environmental effects can be anticipated and controlled as a result of other available environmental studies undertaken by public agencies or the project proposer, including other EISs. The City Council has three courses of action when reviewing an EAW. These actions include: 1. require additional information to address possible environmental effects not adequately discussed in the EAW, 2. make a finding of “no need” for an EIS, or 3. order an EIS. 4. Public Comment Period Minnesota Environmental Quality Board advertises the availability of the document and the City transmits the EAW to a standard list of regional and state agencies for comment. The comment period for an EAW is 30 days. During this time period, the agencies and any member of the general public may comment on the EAW. Although not required by the EQB rule, the City also send notice of an open house on December 5, 2019 to provide information and answer questions about the EAW. The 30-day comment period ended on January 2, 2020. Comments submitted during the 30-day comment period should address the accuracy and completeness of the material contained in the EAW, potential impacts that may warrant further investigation before the project is commenced, and the need for an EIS on the proposed project. After the close of the comment period, staff and the applicant prepared responses to the comments for review and consideration by the City Council. The response is included Wessel Residential Development (19-018) 3 January 23, 2020 in the record of decision. The record of decision is intended to serve as the City’s findings of fact of a decision that an EIS does not need to be prepared for this project. The City received six comment letters from reviewing agencies, four comments at an open house and three letters after the comment period deadline. None of these letters stated that the EAW was inadequate or incomplete or identified the need for the preparation of an EIS. 5. Development Review Process If the City Council declares a finding of “no need” for an EIS, the developer could submit a formal development application that addresses any mitigation strategies identified in the EAW. A formal application has two steps: Step 1: Application for a Comprehensive Plan Amendment, Rezoning to PUD, Preliminary PUD Development Plan and Preliminary Plat. This requires a public hearing at the Planning Commission. Notice of the public hearing will be sent to landowners within 300 feet of the property, will be published in the newspaper and posted on the City website. The public hearing is an opportunity for comment. Step 2: Final Plat and Final PUD Development Plan for Phase 1 of the project. Future phases will require Final Plat and Final PUD approval and are expected to occur over the next 5-8 years. During this formal review process, the City would review and provide recommended changes to the plans submitted by the applicant. This would also start the City work to design any off-site infrastructure improvements that would be needed for this development, including streets, sanitary sewer and water. In addition to the City’s public process, the developer would be required to obtain the permits listed in the EAW. 6. Recommendation Staff recommends approval of the resolution declaring a finding of “no need” for Environmental Impact Statement (EIS), based on the review of the Environmental Assessment Worksheet (EAW) dated November 25, 2019. Approval of a finding of “no need” for Environmental Impact Statement (EIS) requires a simple majority vote of the City Council Attachments 1. Resolution 2020-10 declaring a finding of “no need” for an Environmental Impact Statement 2. Record of Decision (includes written comments submitted by the public and government agencies, as well as a response to those comments) 3. 1A Cultural Resource Literature Review for the City of Corcoran Development Project, Hennepin County, Minnesota by In Situ Archaeological Consulting City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-10 Page 1 of 2 Motion By: Seconded By: RESOLUTION DECLARING FINDING OF “NO NEED” FOR AN ENVIRONMENTAL IMPACT STATEMENT (EIS) BASED UPON THE REVIEW OF THE ENVIRONMENTAL ASSESSMENT WORKSHEET (EAW) DATED NOVEMBER 25, 2019 FOR THE “WESSEL RESIDENTIAL” PROJECT PROPOSED BY U.S. HOME CORPORATION DBA LENNAR AT 20020 HACKAMORE ROAD (PID 35-119-23-12-0002, 35-119-23-11-0001, 35-119-23-44-0001, 35- 119-23-43-0001) (CITY FILE 19-018) WHEREAS, the City Council reviewed the Environmental Assessment Worksheet (EAW) for residential development on January 23, 2020; and WHEREAS, pursuant to the Minnesota Environmental Review Program Rules 4410.4300, Subpart 36, the City of Corcoran, as the responsible government unit submitted an Environmental Assessment Worksheet (EAW) for the proposed project on November 25, 2019; and, WHEREAS, the EAW was published in the December 2, 2019 edition of the EQB Monitor, which started the required 30-day public comment period that commenced on December 2, 2020 and ended on January 2, 2020; and WHEREAS, the RGU received six comment letters, four comments at an open house and three letters after the comment period deadline that are incorporated by reference in the Record of Decision and all comments and recommendations received from reviewing agencies and other interested parties have been considered; and, WHEREAS, responses were prepared for comment letters received and these responses to comments are provided in the Record of Decision; and WHEREAS, it has been determined that the proposed project does not present a potential for environmental impacts of such significance that an Environmental Impact Statement would be required; WHEREAS, pursuant to Minnesota Rules, Section 4410.1700, the RGU shall base its decision regarding the need for an EIS on the information gathered during the EAW process, the comments received on the EAW, and the criteria established by the EQB to determine whether a project has the potential for significant environmental effects as provided in the Record of Decision; and; and City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-10 Page 2 of 2 NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF CORCORAN, MINNESOTA, that it should and hereby does make a Negative Declaration on the need for an Environmental Impact Statement (EIS) for the proposed residential development, based on the Record of Decision, which is hereby approved, adopted and incorporated herein. VOTING AYE VOTING NAY Thomas, Ron Thomas, Ron Bottema, Jon Bottema, Jon Dejewski, Brian Dejewski, Brian Schultz, Alan Schultz, Alan Whereupon, said Resolution is hereby declared adopted on this 23th day of January 2020. ________________________________ Ron Thomas - Mayor ATTEST: ____________________________________ City Seal Jessica Beise – Administrative Services Director Wessel Residential Development Environmental Assessment Worksheet (EAW) Record of Decision December 23, 2020 1 Record of Decision Based on the EAW, the Response to Comments and the Findings of Fact, the City of Corcoran City Council concludes the following: 1. All requirements for environmental review of the proposed project have been met. 2. The EAW and the development processes related to the Project have generated information which is adequate to determine whether the Project has the potential for significant environmental effects. 3. Areas where potential environmental effects have been identified have included proper mitigative responses to be included within the final design of the Project. Mitigation will be required to be provided where impacts are expected to result from Project construction, operation or maintenance. Mitigative measures will be required to be incorporated into project design, and have been or will be coordinated with state and federal agencies during the applicable permit process. 4. Based on the criteria in Minnesota Rules part 4410.1700, the Project does not have the potential for significant environmental effects. 5. An Environmental Impact Statement is not required for the proposed Wessel development project. Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 2 The Wessel Development Plan discretionary Environmental Assessment Worksheet (EAW) was approved for distribution to the Environmental Quality Board (EQB) and persons and agencies on the official EQB distribution list in accordance with EQB rules on November 25, 2019. The EQB published notice of availability in the EQB Monitor on December 2, 2019. The 30-day comment period ended on January 2, 2020. The City of Corcoran received six EAW comment letters or emails as well as three written comments at a formal open house hosted by the City of Corcoran. After the comment period ended two more letters were received. The letters are on file at the City of Corcoran. The following comment letters were sent to the City of Corcoran: Comment 1: Formal Open House – Comment dated December 5, 2019 from De Sicora, 6516 Valley View Road, Corcoran, MN Comment 2: Formal Open House – Comment dated December 5, 2019 from Bernard Jahn, 6516 Valley View Road, Corcoran, MN Comment 3: Formal Open House – Comment dated December 5, 2019 from Ellen Sanko, 6720 County Road Number 116 Comment 4: Formal Open House – Comment dated December 5, 2019 from Jayne Myhre, 6507 Elm Street Letter 1: Minnesota Department of Natural Resources - Email dated December 6, 2019 from Samantha Bump, NHIS Review Specialist | Ecological & Water Resources Minnesota Department of Natural Resources to Meaghan Watson, Wenck Engineering Letter 2: Minnesota Historical Society – State Historic Preservation Office - Letter dated December 10, 2019 from Sarah J. Beimers, Environmental Review Program Manager to Kendra Lindahl, City of Corcoran Letter 3: City of Medina - Letter dated December 19, 2019 from Dusty Finke, AICP, Planning Director to Kendra Lindahl, City of Corcoran Letter 4: Minnesota Pollution Control Agency - Letter dated December 30, 2019 from Karen Kromar, Project Manager, Environmental Review Unit to Kendra Lindahl, City of Corcoran Letter 5: Department of Administration State Archaeologist - Letter dated December 31, 2019 from Jennifer Tworzyanski, Assistant to the State Archaeologist to Kendra Lindahl, City of Corcoran Letter 6: Hennepin County – Letter dated January 2, 2020 from David Jaeger, Environmental Specialist to Kendra Lindahl, City of Corcoran Received After Comment Period Deadline Letter 7: Metropolitan Council – Letter dated January 2, 2020 received January 6, 2020 from Debra Detrick for Angela R. Torres, AICP, Manager, Local Planning Assistance to Kendra Lindahl, City of Corcoran. Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 3 Letter 8: Minnesota Department of Transportation – Letter dated January 6, 2020 from Jennifer Wiltgen, Principal Planner to Kendra Lindahl, City of Corcoran. Letter 9: Minnesota Department of Natural Resources – Letter dated January 7, 2020 from Rebecca Horton, Principal Planner, Division of Ecological and Water Resources to Kendra Lindahl, City of Corcoran. The following information and clarifications are provided in response to all substantive and timely EAW comments received during the 30-day comment period and those received after the comment period but prior to January 16, 2020 when the Council packet was prepared. Comments are provided in italicized text. Comment 1: Formal Open House Comment: Env Assessment (sic) Response: Comment noted. Comment 2: Formal Open House Comment: I live at 6516 Valley View Rd. I don’t want a road or even an indicator of a future road behind me. It would take some of my property and reduce the value of my land. I have paid taxes to Corcoran for 46 years. My vote is no road! Response: Comment noted. Comment 3: Formal Open House Comment: Safety concerns with increased number of access points on to 116 within a short distance. Also concerns with drainage if our ditch is further compromised with the addition of another turn lane at the Olde Sturbridge development. Response: Comment noted. Comment 4: Formal Open House Comment: It seems as if the information presented in this format just created more confusion and negative impact to current homesteads. There was nothing specific in Lennar’s proposal. Response: Comment noted. Letter 1: Minnesota Department of Natural Resources Comment 1: As noted in your assessment, Blanding’s turtles (Emydoidea blandingii), a state- listed threatened species, have been documented in the vicinity of the proposed project. This project has the potential to impact this rare turtle through direct fatalities and habitat disturbance/destruction due to excavation, fill, and other construction activities associated with the project. Minnesota’s Endangered Species Statute (Minnesota Statutes, section 84.0895) and associated Rules (Minnesota Rules, part 6212.1800 to 6212.2300 and 6134) prohibit the take of threatened or endangered species without a permit. Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 4 Response: Comment noted. Avoidance measures will be employed during construction to ensure the project does not impact the Blanding's Turtle. This information will be provided to the site developer by the City to ensure the developer and selected construction contractor follow the items outlined in the following comments listed by the DNR. Comment 2: The following avoidance measures are required: Avoid wetland impacts during hibernation season, between October 15th and April 15th, unless the area is unsuitable for hibernation (less than 14 inches deep); Response: Comment noted. These requirements will be provided to the site developer by the City. Comment 3: The following avoidance measures are required: Culverts need to be 36 inches or great in diameter, at least twice as wide as the normal width of open water, and have an elliptical or flat-bottom Response: Comment noted. These requirements will be provided to the site developer by the City. Comment 4: The following avoidance measures are required: Use of erosion control blanket shall be limited to ‘bio-netting’ or ‘natural netting’ types, and specifically not products containing plastic mesh netting or other plastic components. Also be aware that hydro-mulch products may contain small synthetic (plastic) fibers to aid in its matrix strength. These loose fibers could potentially re-suspend and make their way into Public Waters. As such, please review mulch products and not allow any materials with synthetic (plastic) fiber additives in areas that drain to Public Waters. Response: Comment noted. These requirements will be provided to the site developer by the City. Comment 5: The following avoidance measures are required: The Blanding’s turtle flyer should be given to all contractors working in the area. Response: Comment noted. These requirements will be provided to the site developer by the City. Comment 6: The following avoidance measures are required: If turtles are in imminent danger they must be moved by hand out of harm’s way, otherwise they are to be left undisturbed. Response: Comment noted. These requirements will be provided to the site developer by the City. Comment 6: The following avoidance measures are required: Monitor for turtles during construction and report any sightings to the DNR Nongame Specialist, Erica Hoaglund at 651-259-5772 or Erica.Hoaglund@state.mn.us. Minimize impacts to small, vegetated temporary wetlands (Types 2 & 3) as much as possible. For additional information, please see the Blanding’s turtle fact sheet, which describes the habitat use and life history of this species. The fact sheet also provides two lists of recommendations for avoiding and Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 5 minimizing impacts to this rare turtle. Please refer to the both lists of recommendations for your project. For further assistance regarding the Blanding’s turtle, please contact the DNR Regional Nongame Specialist. Response: Comment noted. These requirements will be provided to the site developer to the City. Letter 2: Minnesota Historical Society – State Historic Preservation Office Comment 1: As stated in our November 7, 2019 letter to the City of Corcoran, due to the nature and location of the proposed project, we recommend that a Phase I archaeological survey be completed prior to any ground disturbing activities. Response: Comment noted. In Situ Archaeological Consulting, LLC performed a Phase 1A Cultural Resource Literature Review to satisfy this request. Letter 3: City of Medina Comment 1: The City of Medina is concerned with traffic impacts to roadways within or partially within Medina. The EAW identifies a number of such impacts in the Traffic Analysis which is attached to the EAW, and Medina believes there are impacts beyond those referenced. Response: Comment noted. Letter 4: Minnesota Pollution Control Agency Comment 1: The EAW does not provide information on the design capacity, current flow, and capacity after the development for the downstream sewers. Response: The EAW does not detail all of the downstream sewers; rather, it refers to the wastewater flows from this development being in accordance with the MCES- approved 2040 Comprehensive Plan for Corcoran, and the EAW makes specific reference to that Plan. A review of the downstream sewer flows and sewer capacities as presented in the 2040 Plan indicates that the flows from the development will be accommodated by the currently-planned sewer system, with the downstream sewers showing at least 20% extra available capacity beyond all the currently-planned full development scenario (inclusive of the proposed new development under this EAW). Comment 2: The EAW does not discuss the capacity of the wastewater treatment plant or its ability to accept this increased flow. Response: With their review and approval of the 2040 Comprehensive Plan for Corcoran, the Metropolitan Council is aware of the planned development in Corcoran and the associated wastewater flows and have thus accounted for them in their wastewater system (i.e., as part of their ongoing metropolitan-wide planning process). Hence, the Metropolitan Council has already planned to accommodate this development's wastewater flow at their Metropolitan Plant in Saint Paul. Comment 3: The EAW indicates the construction will disturb more than 50 acres and Elm Creek has construction related impairments and is located within 1 mile of the site. Because of Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 6 this, the Stormwater Pollution Prevention Plan (SWPPP) for the Project will require review and approval by the MPCA prior to obtaining National Pollutant Discharge Elimination System/State Disposal System General Construction Stormwater Permit {CSW Permit) coverage, unless stormwater from the site will not drain to the creek. Response: Comment noted. This requirement will be provided to the site developer by the City to ensure the developer and selected construction contractor follow the items outlined in the comment. Comment 4: The CSW Permit requires preservation of at least 50 feet of existing buffer to the wetlands and other surface waters on the site during construction. If the existing buffer must be disturbed, then the SWPPP for the Project must specify that redundant down gradient sediment controls will be installed to protect these surface waters during construction. Response: Comment noted. These requirements will be provided to the site developer by the City. Comment 5: The CSW Permit requires that a volume reduction method (e .g. infiltration practices or water harvest and reuse) is first considered to treat stormwater unless prohibited for reasons specified in the CSW Permit. Note that the wetlands on the site may not be used for stormwater treatment unless they have undergone mitigation. Response: Comment noted. These requirements will be provided to the site developer by the City. Comment 6: The MPCA strongly encourages the proposers to incorporate Better Site Design and Green Infrastructure practices into the new development to reduce runoff and help build resilience to increased precipitation in Minnesota. Questions regarding CSW Permit requirements should be directed to Roberta Getman at 507-206-2629 or Roberta.Getman@state.mn.us. Response: Comment noted. Letter 5: Department of Administration State Archaeologist Comment 1: The land around lakes and wetlands are typically considered to have moderate to high potential for archaeological remains. Our office recommends a qualified archaeologist conduct a survey to determine if the proposed project could damage previously unrecorded archaeological sites or burials. Response: Comment noted. In Situ Archaeological Consulting, LLC performed a Phase 1A Cultural Resource Literature Review to satisfy this request Letter 6: Hennepin County Comment 1: As noted on pages 5-9 and 7-2 of Wenck's Report, Hackamore Rd will need to be upgraded to a collector, and right and left turn lanes need to be added to both east and west sides of CSAH 116/Hackamore in order to meet 2031 traffic volumes presented in the report. Implementation of these measures will require coordination between the city and county to be sure that these improvements are constructed before the need becomes critical. Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 7 Response: Comment noted. The City will work with Hennepin County to implement the recommended improvements. Comment 2: Throughout the report it is clear the project has three planned access points onto County Road 116. It is important to note that the project should not assume the county will permit three full access points as the EAW currently proposes. As the traffic study points out, some adjustments might be needed at the proposed southerly access due to its closer spacing proximity to Hackamore Road. Our current access spacing guidelines suggest¼ mile (1,320 ft) as being acceptable spacing is generally acceptable for this type of roadway (Rural arterial with traffic greater than 7,500 ADT). However, access points need to be reviewed on a case by case basis at the time of preliminary platting/ site plan review. Response: Comment noted. Comment 3: Please be aware county staff are currently reviewing DRAFT revisions to our spacing guidelines as part of our 2040 Comprehensive Plan updates. Preliminarily, staff have identified this segment of County Road 116 for an even higher priority of access management due to higher speeds, projected increases in traffic and increasing development pressures. Limiting access improves safety by concentrating traffic turning movements, reducing vehicular conflicts, and providing pedestrians and bicyclists with key crossing locations. Response: Comment noted. Comment 4: As referenced in the traffic study and given the characteristics of County Road 116 mentioned above, turn lanes in both north and south directions should be an expected requirement for any agreed upon access locations. Response: Comment noted. Comment 5: The county generally agrees with the EAW findings that "Based on available information and existing planning efforts completed by the City, there are no anticipated or known cumulative environmental impacts that cannot be effectively mitigated if proper permitting and development processes are followed" (Question 19.c.). Response: Comment noted. The City will work with Hennepin County to implement the recommended improvements. Comment 6: It is important to note that direct roadway impacts and necessary roadway mitigation steps by the developer will be examined in more detail during the county's plat review process. At that time, the county's right-of-way dedication request will be determined based partially on the needed mitigation by the development and any walkway / trail needs. Please make sure that the county development review staff are notified at the time any further site- specific plans are submitted to the city. Response: The City will continue to coordinate with Hennepin County and ensure they are included in future stages of the development review process for the proposed residential project. Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 8 Letter 7: Metropolitan Council Comment 1: Item 8 - Permits and Approvals Required (Jim Larsen, 651-602-1159) In accordance with Minnesota Statute Section 473.513, at the time the project proposer applies to the Minnesota Pollution Control Agency (MPCA) for a permit to construct each segment of sanitary sewer for the proposed project, a copy of the plans, design data, and a location map of the project will also need to be submitted to the Metropolitan Council. The Council's Environmental Service Engineering Programs staff will need to review, comment, and issue a non-objection decision relative to issuance of the construction permit by the MPCA before connection can be made to the City's wastewater disposal system. Response: Comment noted. Comment 2: Item 9 - Land Use (Freya Thamman/Todd Graham, 651-602-1750/x1322) As indicated in the EAW, the proposed project will require a comprehensive plan amendment (CPA). A portion of the site is guided Agricultural (in Agricultural Preserves with April 2020 expiration) and will need to be re-guided. In addition, the CPA will also need to include a change to the staging (see Item 11-Wastewater) and overall project density will need to be consistent with allowed density in the City's 2040 Plan (Plan). The eventual development will affect the households and population levels·in Traffic Analysis Zone (TAZ) #899. The City has prepared a TAZ forecast allocation anticipating growth of 520 households during 2020-40. Council staff recommend the forecast allocation be increased for TAZ #899 and offset with reduced allocations elsewhere. The TAZ table can be revised through correspondence with Council staff. Response: Comment noted. Comment 3: Items 11 - Water Resources - Wastewater (Roger Janzig, 651-602-1119) The project location contains 2030 and 2040 Municipal Urban Sewer-Service Area (MUSA). Prior to the installation of any sanitary sewer improvements for this project, the City will need submit a CPA to change the areas in the 2040 MUSA to current 2030 MUSA. Response: Comment noted. Comment 4: Items 11 - Water Resources - Water Supply (John Clark, x1452; Jim Larsen x1159) The EAW is complete and sufficient information is provided to address potential drinking water infrastructure and resource contamination issues. Corcoran's local water supply plan (LWSP) and the included feasibility study address future water demand and water supply infrastructure needs. Current municipal water demand in the City's LWSP and 2040 Plan is well-above the theoretical regional per capita demand goals. The reported demand values are not uncommon for new systems and the City projects that total demand will decrease by 10% per year. There are several potential causes of a high per capita demand numbers, including, but not limited to, unaccounted for water loss, inefficient irrigation practices, establishment of new lawns, and the types of customers being served by the system (i.e. commercial, industrial, institutional, residential). For instance, Corcoran reports a significant (~60%) unaccounted for water loss in their LWSP. The City also states that it will be investigating its own water supply source and treatment facilities in coming years. Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 9 Table 13 of the EAW should be revised to indicate that 450 gallons per capita per day (gpcd) represents the maximum day water demand. The City-wide average day water demand estimate would currently be approximately 157 gpcd based upon the City's 2017 Water Supply Plan estimate for 2019, or 121 gpcd using an alternative estimating method for water use of 110% of estimated wastewater generation for this specific development site (150,974 gpd x 110% = 166,071 and 166,071 gpd/ 551 units x 2.5 persons per unit= 120.6 gpcd) at full build out. The use of a 450 gallons per person per day (gpcd) value for maximum day demand is consistent with the City's 2040 Plan and LWSP, and the Water Distribution Modeling by Wenck, which estimates a 568 gpcd system capacity. Therefore, it is recommended that the City consider any current inefficiencies in the distribution system, the types of current water users, and compare that information with the residential homes that will be built as a part of this new development. As the site is developed, we ask that the City and developers continue to consider water use efficiency and water resource contamination in their site designs. This might include "smart" lawn irrigation systems, educating new residents and businesses on efficient irrigation practices, and potential stormwater capture and reuse ponds for lawn irrigation. Response: City concurs with MCES use of 450 gpcd for maximum day demand (MDD) in the EAW, but City’s position is the table does not need to be revised, since the text leading into the table already clearly states that 450 is MDD. Also, as suggested by MCES, the City will continue to consider system inefficiencies, water system users, etc., relative to the new development, and will also encourage developers to consider water use efficiency etc. Letter 8: Minnesota Department of Transportation Comment 1: The Intersection of TH 55 and Pinto Drive was not included in the analysis for the Traffic Impact Study prepared as part of this EAW. Considering the magnitude of the development and the likelihood that traffic generated will use TH 55, please revise the traffic study to incorporate this intersection. Response: The intersection of TH 55 and Pinto Drive was recently significantly upgraded to accommodate existing and future traffic volumes. Traffic generated by the proposed development will utilize the entire surrounding roadway system and will not be concentrated at any one intersection. Based on these parameters, the City determined the TH 55 and Pinto Drive intersection would not be included in the study Letter 9: Minnesota Department of Natural Resources Comment 1: A DNR Water Appropriation Permit is required for dewatering from ponds, streams, and the ground in volumes that exceed 10,000 gallons per day, or one million gallons per year. This includes temporary appropriation to allow the site to be graded, and the installation of utilities including storm sewers and the 12-inch diameter sanitary sewer main. Response: Comment noted. If temporary dewatering in excess of 10,000 gallons per day or one million gallons per year is needed to facilitate construction of the project, the developer and construction contractor will be required to obtain a DNR Water Appropriations Permit. Wessel Residential Development Environmental Assessment Worksheet (EAW) Response to Comments January 23, 2020 10 Comment 2: Please note that the use of storm water from constructed basins to irrigate landscaping is exempt from the need for a DNR Water Appropriation Permit. Use of the storm water for irrigation will conserve valuable ground water, and reduce storm water runoff from the site. Response: Comment noted. Comment 3: If there is a need to conduct dewatering in volumes that exceed 10,000 gallons per day, or one million gallons per year, during the construction of the trails and roads and their associated culverts, a DNR Water Appropriation Permit will be required for the work. Response: Comment noted. The developer and construction contractor will be required to obtain a DNR Water Appropriation Permit If temporary dewatering in excess of 10,000 gallons per day or one million gallons per year is needed to facilitate construction of the project. Comment 4: Some structures that are built in areas of high groundwater need to be permanently dewatered. If a structure in the Wessel Development needs to be permanently dewatered in volumes that exceed 10,000 gallons per day, or one million gallons per year, then a DNR Water Appropriation Permit is required for the dewatering. Response: Comment noted. If new structures associated with the development require permanent dewatering, the developer will be required to obtain a DNR Water Appropriation Permit for dewatering volumes in excess of 10,000 gallons per day or one million gallon per year. Comment 5: Please remember that a DNR Water Appropriation Permit will be required for dewatering that exceeds 10,000 gallons per day, or one million gallons per year, that is associated with improvements to the City of Corcoran Water System, including the construction of the new water tower. Response: Comment noted. The developer and construction contractor will be required to obtain a DNR Water Appropriation Permit If temporary dewatering in excess of 10,000 gallons per day or one million gallons per year is needed to facilitate construction of the project. Comment 6: It is common to discover previously unknown wells in rural areas. These previously unknown wells must be sealed in accordance with the regulations of the Minnesota Department of Health. Response: If unknown wells are encountered during construction of the project, they will be sealed in accordance with MDH regulations. 9717 Valley View Road Eden Prairie, MN 55344 Ph: 952-658-8891 Web: www.insitucrm.com January 14, 2020 Jeff Madejczyk, Principal Wenck Associates, Inc 1800 Pioneer Creek Center Maple Plain, MN 55359 (763) 479-4263 jmadejczyk@wenck.com Subject: Phase 1A Cultural Resource Literature Review for the City of Corcoran Development Project, Hennepin County, Minnesota Dear Mr. Madejczyk, This report presents the results of a Phase IA Cultural Resource Literature Review conducted by In Situ Archaeological Consulting, LLC (In Situ) for the proposed City of Corcoran Development Project in Hennepin County, Minnesota. The project area is located in Section 35, Township (T) 119 North (N), Range (R) 23West (W). This cultural resource literature review was performed on behalf of Wenck in preparation for the City of Corcoran Development Project. The project area is within the city limits of Corcoran, Minnesota. It is located west of County Roaid 116, south of Oak Ridge Road, northwest of the intersection of and Hackmore Road, and east of Old Settlers Road. The proposed project area is approximately 270.3 acres in size and located on privately-owned land. The literature review was conducted by Benjamin W Schweer and Rebecca S. Wallace on January 10, 2020, using files maintained by the Minnesota Office of the State Archaeologist (OSA) and Minnesota State Historic Preservation Office (SHPO). Attached to this letter are the cultural resource literature review maps of the project area (Figures 1-6). BACKGROUND RESEARCH A literature review consisted of identifying any prehistoric and historic cultural resources within a 1-Mile Study Area (Study Area). The task was completed using site data files and previous inventory files maintained by the OSA and at SHPO. In addition, background research was completed by reviewing NRHP data, historic maps, atlases, current aerial photographs, soil maps, topographic and geomorphic data, and other sources that might provide information for the locations of historic-era sites, areas of prior disturbance, etc. (Figures 1-6). The literature search at Minnesota OSA and SHPO revealed three previous cultural resource inventories, two previously recorded cultural resources, and three previously recorded architectural resources within the 1-Mile Study Area (Tables 1-3). The previous cultural resource inventories, previously recorded cultural resources, and previously recorded architectural resources do not overlap with the proposed project area. City of Corcoran Development Project January 14, 2020 Page 2 The literature search revealed three previous cultural resource inventories within the Study Area. The surveys were reported between 1994 and 2009 and were completed in support of farm development and natural gas projects. None of these inventories overlap with the proposed project area. Table 1: Previous Cultural Resource Inventories within the 1-Mile Study Area. Report Number Title Authors Year HE-94-31 A Phase I Archaeological Survey of the Proposed Second Phase Foxberry Farm Development Area, Medina Township Hennepin County, Minnesota. Douglas A. Birk 1994 MULT-08-07 Phase I Cultural Resources Survey for the Northern Natural Gas Company’s Proposed Northern Lights 2009-2010 Zone EF Expansion Project, Anoka, Carver, Dakota, Freeborn, Hennepin, Rice, Washing, and Wright Counties, Minnesota. Andrea C. Vormeer, Laurie S. H. Ollila, Andrew J. Schmidt, and Kent Bakken 2008 MULT-09-15 Phase I Cultural Resources Survey for the Northern Natural Gas Company’s Proposed Northern Lights 2009-2010 Zone EF Expansion Project, Anoka, Carver, Dakota, Freeborn, Hennepin, Rice, Washing, and Wright Counties, Minnesota. Addendum Report: EF Corcoran Branch Line and EF Rockford Branch Line Replacement Andrea C. Vormeer, Laurie S. H. Ollila, and Andrea R. Kampinen 2009 There are two archaeological sites within the Study Area. Both sites consist of pre-contact artifact scatter sites. Site 21HE0310 is a Paleoindian site and site 21HE360 is a multicomponent site. Both sites are unevaluated for the National Register of Historic Places (NRHP). Neither of these sites are within the proposed project area. Table 2: Previous Cultural Resources within the 1-Mile Study Area. Site Number Legal Location Cultural Affiliation Site Type NRHP Eligibility Distance from Project Area 21HE310 C-NE Section 2, T118N, R32W Pre-Contact- Paleoindian Lithic scatter Unevaluated 0.23 miles 21HE360 NW-SE Section 2, T118N, R32W Pre-Contact- Multi-component Artifact scatter Unevaluated 0.61 miles The literature search revealed three architectural sites with the Study Area. All three properties are unevaluated for the NRHP. None of the architectural sites are within the proposed project area. City of Corcoran Development Project January 14, 2020 Page 3 Table 3: Previous Recorded Architectural Resources within the 1-Mile Study Area. Site Number Site Name/Type Address/Location NRHP Eligibility Within Project Area HE-COC-017 Farmhouse 19835 Larkin Rd. Unevaluated No HE-COC-018 Farmhouse 6420 Old Settlers Rd. Unevaluated No HE-COC-019 Farmstead 6810 Old Settlers Rd. Unevaluated No BASIC ENVIRONMENT OF THE PROJECT AREA The project area is located within the Owatonna Moraine Area physiographic region (Wright 1972). This area is characterized by a series of moraine that formed along the eastern edge of the Des Moines lobe. The topography is rugged in the north area and becomes more gently sloped as it goes south. The northern portion of the project area drains into an unknown DNR minor watershed and the southern portion of the project area drains into Elm Creek, which feeds into the Mississippi River-Twin Cities, and is part of the Upper Mississippi watershed. The elevation within the project is approximately 960 ft to 1,000 ft (292.6 m to 304.8 m) above mean sea level. The project area is located within the Hayden-Cordova-Peaty muck soil association; these soils are described as “nearly level to rolling, medium-textured and moderately fine textured soils that develop in glacial till, and level organic soils (U.S. Department of Agriculture, SCS 1974 [2020]).” Table 4 summarizes the soil series within the project area. Table 4: Summary of Soil Series within the Project Area. Soil Series Parent Material Drainage Slope Landform Cordova loam (L23A) Till Poorly drained 0-2% Drainageways on moraines Angus loam (L37B) Fine-loamy till Well drained 2-6% Ground moraines, hillslopes Glencoe clay loam (L24A) Local alluvium over till Very poorly drained 0-1% Depressions Lester loam (L22C2) Fine-loamy till Well drained 6-10% Ground moraines, hillslopes Hamel, overwash- Hamel complex (L36A) Colluvium over till Somewhat poorly drained 0-3% Ground moraines Le Sueur loam (L25A) Fine-loamy till Somewhat poorly drained 1-3% Hillslopes, ground moraines Muskego and Houghton soils (L50A) Organic material over coprogenic material Very poorly drained 0-1% Depressions Lester loam (L22D2) Fine-loamy till Well drained 10-16% Ground moraines, hillslopes Nessel loam (L44A) Till Moderately well drained 1-3% Moraines City of Corcoran Development Project January 14, 2020 Page 4 Table 4: Summary of Soil Series within the Project Area. Soil Series Parent Material Drainage Slope Landform Klossner soils, depressional (L49A) Organic material over till Very poorly drained 0-1% Depressions on moraines Lester loam (L22F) Till Well drained 25-35% Encarpments on morains Source: Natural Resources Conservation Service (2020). REPORT SUMMARY AND RECOMMENDATIONS In Situ completed a Phase IA Cultural Resource Literature Review for the proposed City of Corcoran Development Project in Hennepin County, Minnesota. The results revealed three previous cultural resource inventories, two previously recorded cultural resources, and three previously recorded architectural resources within the 1-Mile Study Area. All of the previously recorded resources are unevaluated for the NRHP and none are located within the proposed project area. Please contact me at 952.658.8891 or aledezma@insitucrm.com should you have any further questions or concerns regarding the information assembled. Sincerely, Abraham Ledezma, M.S., RPA Principal Investigator Enclosures: Figure 1: Project location on the USGS 1981 Hamel, MN 7.5 minute series topographic map. Figure 2: Project location on an aerial map. Figure 3: Topographic map with previous cultural resources surveys and previously recorded sites. Figure 4: Aerial map with previous cultural resources surveys and previously recorded sites. Figure 5: Project location on the 1856 BLM GLO Plat map. Figure 6: Project location on the 1909 Rockford, MN 62,500 series topographic map. City of Corcoran Development Project January 14, 2020 Page 5 REFERENCES CITED Natural Resources Conservation Service 2019 Web Soil Survey – Hennepin County, MN. Available at: http://websoilsurvey.nrcs. usda.gov. Accessed January 13, 2020. U.S. Department of Agriculture, Soil Conservation Service 1974 [2020] Soil Survey of Hennepin County, Minnesota. In cooperation with Minnesota Agricultural Experiment Station. United States Government Printing Office. Washington. Wright, H. E. Jr. 1972 Physiology of Minnesota. In Geology of Minnesota: A Centennial Volume. pp. 561- 578. Minnesota Geological Society. Note: Imagery courtesy of ESRI Lake MedinaCounty Ditch Number SixteenCounty Ditch Number Twenty-sixCounty Ditch Number ThreeT. 118N R. 023WSec 2 T. 119N R. 023WSec 26 T. 119N R. 023WSec 35 T. 119N R. 023WSec 25 T. 119N R. 023WSec 36 T. 118N R. 023WSec 1 T. 119N R. 023WSec 27 T. 118N R. 023WSec 3 T. 119N R. 023WSec 34 TOPOGRAPHIC MAP City of Corcoran De velopment Pro ject Hennepin County, Minnesota Legend Proje ct Area Town ship Bound ary Town ship/Ran ge/Section NHD Wate rb ody NHD Stream/River 0 3,200 6,400 Approximate Scale in Feet1:24,000 1 inch equals 2,000 feet Figure 1. Project location on the USG S1981 Hamel, MN 7.5 minute series topographic map. µ Note: Imagery courtesy of ESRI L23A L37B L37B L24A L37B L36A L44A L23A L49A L50A L50AL36A L22D2 L49A L37B L37B L37B L24A L22C2L50A L24A L24A L22C2 L22D2 L37B L36A L37B L25A L25A L23A L24A L25A L22C2 L25A L25A L36A L22C2 L36A L23A L22D2 L37B L25A L24A L25A L25A L24A L25A L24A L37B L50A L37B L22D2 L25A L22C2 L50A L23A L50A L50A L24A L44A L23A L37B L22C2 L49A L44A L25A L24A L37B L50A L22C2 L44AL50A L25A L37B L25A L24A L22C2 L25A L22C2 L24A L23A L22F L37B L24A L22D2 L25A L22F L36A L22D2 L22C2 L24A L24A L23A L22F L22C2 L22D2 L25A L24A L22C2 L50A L22C2 L36A L25A L22C2 L23AL24A L49A L22C2 L22E L25A L37BL22C2 L22C2 L23A L22D2 L25A L23A L24A L24A L24A L49AL22E L25A L23A L50A L25A L24A L22C2 L22C2 L22C2 L24A L49A L49A L22D2 L37BL24A L23A L22C2 L25A L22C2L36A L25A T. 119N R. 023WSec 35 T. 119N R. 023WSec 36AERIAL MAP City of Corcoran De velopment Pro ject Hennepin County, Minnesota Legend Proje ct Area Soils Town ship/Ran ge/Section 0 1,100 2,200 Approximate Scale in Feet1:8,613 1 inch equals 718 feet Figure 2. Project location on an aerial map.µ Note: Imagery courtesy of ESRI ") ") ") 21HE0310 21HE0360 Lake Medina Cook Lake County Ditch Number SixteenCounty Ditch Number ThreeCounty Ditch Number Twenty-sixHE-94-31 MULT-08-07MULT-09-15 T. 119N R. 023WSec 25 T. 118N R. 023WSec 2 T. 119N R. 023WSec 26 T. 119N R. 023WSec 36T. 119N R. 023WSec 35 T. 118N R. 023WSec 1 T. 119N R. 023WSec 27 T. 118N R. 023WSec 3 T. 119N R. 023WSec 34 T. 118N R. 023WSec 11 T. 119N R. 023WSec 24T. 119N R. 023WSec 23 T. 118N R. 023WSec 12T. 118N R. 023WSec 10 T. 119N R. 023WSec 22 HE-CO C-019 HE-CO C-018 HE-CO C-017 LITERATURE REVIEW TOPOGRAPHIC MAP City of Cororan Development Project Hennepin County, MinnesotaDO NOT RELEASE Archaeological Site Location Not fo r Public Disclosure Legend Project Area 1-Mile Study Area ")Unevaluated Historic Structure Archaeological Site Previous Survey Township Boundary Township/Range/Section NHD Waterbody NHD Stream/River 0 3,500 7,000 Approximate Scale in Feet1:26,000 1 inch equals 2,167 feet Figure 3. Topographic map with previous cultural resources surveys and previously recorded sites. µ Note: Imagery courtesy of ESRI ") ") ") 21HE0310 21HE0360 Lake Medina Cook Lake County Ditch Number SixteenCounty Ditch Number ThreeCounty Ditch Number Twenty-sixHE-94-31 MULT-08-07MULT-09-15 T. 119N R. 023WSec 25 T. 118N R. 023WSec 2 T. 119N R. 023WSec 26 T. 119N R. 023WSec 36T. 119N R. 023WSec 35 T. 118N R. 023WSec 1 T. 119N R. 023WSec 27 T. 118N R. 023WSec 3 T. 119N R. 023WSec 34 T. 118N R. 023WSec 11 T. 119N R. 023WSec 24T. 119N R. 023WSec 23 T. 118N R. 023WSec 12T. 118N R. 023WSec 10 T. 119N R. 023WSec 22 HE-CO C-019 HE-CO C-018 HE-CO C-017 LITERATURE REVIEW AERIAL MAP City of Cororan Development Project Hennepin County, MinnesotaDO NOT RELEASE Archaeological Site Location Not fo r Public Disclosure Legend Project Area 1-Mile Study Area ")Unevaluated Historic Structure Archaeological Site Previous Survey Township Boundary Township/Range/Section NHD Waterbody NHD Stream/River 0 3,500 7,000 Approximate Scale in Feet1:26,000 1 inch equals 2,167 feet Figure 4. Aerial map with previous cultural resources surveys and previously recorded sites. µ Note: Imagery courtesy of the U.S. Department of the Interior Bureau of Land Management. T. 118N R. 023WSec 2 T. 119N R. 023WSec 26 T. 119N R. 023WSec 35 T. 119N R. 023WSec 25 T. 119N R. 023WSec 36 T. 118N R. 023WSec 1 T. 119N R. 023WSec 27 T. 118N R. 023WSec 3 T. 119N R. 023WSec 34 HISTORICAL BLM GLO PLAT MAP City of Corcoran De velopment Pro ject Hennepin County, Minnesota Legend Proje ct Area Town ship Bound ary Town ship/Ran ge/Section 0 3,200 6,400 Approximate Scale in Feet1:24,000 1 inch equals 2,000 feet Figure 5. Project location on the 1856 BLM GLO Plat m ap.µ Note: Imagery courtesy of the USGS. T. 118N R. 023WSec 2 T. 119N R. 023WSec 26 T. 119N R. 023WSec 35 T. 119N R. 023WSec 25 T. 119N R. 023WSec 36 T. 118N R. 023WSec 1 T. 119N R. 023WSec 27 T. 118N R. 023WSec 3 T. 119N R. 023WSec 34 HISTORICAL TOPOGRAPHIC MAP City of Corcoran De velopment Pro ject Hennepin County, Minnesota Legend Proje ct Area Town ship Bound ary Town ship/Ran ge/Section 0 3,200 6,400 Approximate Scale in Feet1:24,000 1 inch equals 2,000 feet Figure 6. Project location on the 1909Rockford, M N 62,500 series topographic map. µ 105 South Fifth Avenue Suite 513 Minneapolis, MN 55401 Tel: 612-252-9070 www.landform.net Landform® and Site to Finish® are registered service marks of Landform Professional Services, LLC. Agenda Item: 8c. TO: Corcoran City Council FROM: T.J. Hofer through Kendra Lindahl, Landform DATE: January 15, 2019 for the January 23, 2020 City Council Meeting RE: Sketch Plan for “Nelson International” at 10409 County Road 101 (city file 19-023) REVIEW DEADLINE: February 16, 2020 1.Description of Request The applicants are requesting an opportunity to appear before the City Council to solicit informal comments on a sketch plan for an approximately 33,000-sq. ft. industrial development. The development would be located at 10409 County Road 101. 2. Background The site has several existing structures on the east portion of the site near County Road 101, which would be removed as part of the development. 3. Context Zoning and Land Use The site is zoned I-1 (Light Industrial) and the Comprehensive Plan guides the property as Light Industrial. The lot was created as part of Bellwether 2nd Addition. Surrounding Properties The property to the north is guided Light Industrial and is zoned I-1 (Light Industrial). The properties to the west and south west are guided Low Density Residential and are currently zoned PUD (Planned Unit Development). Both areas are future development areas for the Bellwether development. The property to the southeast is an outlot of the Bellwether development and is guided Light Industrial and is zoned I- 1 (Light Industrial). The property to the east is located outside of the City of Corcoran in the City of Maple Grove. Sketch Plan for “Nelson International” at 10409 County Road 101 (city file 19-023) 2 January 23, 2020 Natural Characteristics of the Site The property is largely wetlands with the majority of the western part of the lot indicated as “Shallow Open Water” and “Seasonally Flooded Basin or Flat” in the 2040 Comprehensive Plan. The southeast section of the parcel is also indicated as a “Seasonally Flooded Basin or Flat”. The property has trees located along the edge of the large wetland on the west side of the property. The western part of the property has also been identified as a Cattail Marsh and Maple-basswood Forest on the 2040 Ecologically Significant Natural Areas. The west side of the property has been identified on the Parks and Trails Plan as a Greenway Corridor. 4. Analysis Use The proposed use includes both motor vehicle and equipment sales as well as vehicle and equipment repair. Both are allowed within the I-1 district as a conditional use. Lot Analysis Lot standards for the I-1 district are as follows: Minimum Standard Minimum Lot Area 1 acre Minimum Lot Width 100 ft. Minimum Lot Depth 200 ft. Minimum Principal Structure Setbacks Front, From Major Roadways* 100 ft. Front, From all other streets 50 ft. Side 20 ft. Rear 20 ft. Adjacent to Residential 50 ft. Maximum Principal Building Height 45 ft. Maximum Impervious Surface Coverage 70% The proposed development would appear to meet all lot standards for the I-1 District. Outside Storage Outside Storage is requested for storage of vehicles for sale and vehicles on site for repair. The use proposed by the applicant does not required any additional screening, but it should be noted that damaged vehicles, vehicle parts, and accessory equipment must be stored inside of a principal or accessory building. Sketch Plan for “Nelson International” at 10409 County Road 101 (city file 19-023) 3 January 23, 2020 Off-Street Loading The applicant has indicated an off-street loading location located on the south end of the proposed building. The loading area proposed is more than 300 ft. away from a residential use, so it does not require an intervening building. Loading areas not requiring screening by an intervening building shall be screened from adjacent residentially zoned or guided property by the use of berms, fences, or walls to provide 100 percent opacity to a height of at least 10 feet. The height of the screening shall be measured from the grade of the loading areas. It appears that the plan would comply. Signage The ordinance limits signage to one 64-sq. ft. freestanding sign per property and wall signage up to 10% of the wall area of the elevation with the primary building entrance. The applicant’s plan shows one sign on the east elevation but does not give dimensions for the sign. They would be required to comply with ordinance standards. Parking Parking setback standards for the I-1 district are 100 ft. from County Road 101, 25 ft. from the new public street and 10 ft. from the side and rear lot lines. The proposed development does not meet the parking setback from the front of the lot. The applicant has indicated on their sketch plan that they desire parking setback flexibility through additional landscaping as allowed by Section 1060.070 Subd. 2(L) of the Zoning Ordinance. This requires the applicant to provide landscaping beyond the minimum requirements or preserve significant landscaping in the area. The required setback may be reduced to the required front setback from other streets in that district if the applicant provides a minimum of one overstory deciduous tree, one overstory coniferous tree, 2 ornamental trees and 10 understory shrubs per 100 feet of the length of the property line where the flexibility is requested or preserves the equivalent number of existing trees and shrubs. These materials must be provided in addition to the minimum landscape requirements. This would allow the applicant a reduced parking setback of up to 50 ft. The applicant is showing a setback of 60 ft. The applicant should provide a turning radius exhibit. Landscaping The applicant’s landscape plan is generally consistent with ordinance requirements by providing landscaping around the buildings and parking lots. Limited information was provided at this stage to ensure compliance, but the applicant would be required to provide 59 overstory trees and 161 understory shrubs or the equivalent to meet basic requirements. The applicant is looking for reduced setbacks and has shown additional overstory, ornamental and understory trees in order to attempt to meet this requirement. A final analysis would be done as part of a formal application, but the applicant is showing a number of plantings that would meet this requirement. Sketch Plan for “Nelson International” at 10409 County Road 101 (city file 19-023) 4 January 23, 2020 Streets The proposed development would gain access off County Highway 101 on the north side of the parcel and would establish a shared access road for adjacent properties to use in the future. This new public street is planned to serve this site as part of a larger public street network. A feasibility study would be completed as the project moves forward through the City process and this would help determine design details. Hennepin County has provided comments on this and support the location of the access but will require a full northbound left and southbound right-turn lane. A right-of- way easement is required along the road to the north for the turn lane along County Road 101. Additional right-of-way easements will be required for turn lane on the proposed shared road. The applicant should provide a turning radius exhibit. Access The applicant is proposing access to the project site off of a new shared road on the north side of the project location. The City Engineer has indicated that access to the site may need to shift to the west side of the parcel to accommodate the required turn lanes on County Road 101. Utilities Sanitary sewer services are available to the site, but water has been extended from the City of Maple Grove to reach the adjacent Bellwether residential development. The agreement between the City of Corcoran and the City of Maple Grove for this water extension included limits on which parcels would be served. This site is not included in the current water agreement with Maple Grove. Two water options would be potentially available to the proposed project: 1. Request City negotiate amendment to the Maple Grove agreement and allow an interim supply from Maple Grove via the Corcoran system. • It can be assumed Maple Grove connection fees would be charged and • Corcoran water connection and TLAC fees would be charged when Corcoran system is available, currently planned to be available in 2022/2023. 2. A less viable option is to construct a private well with rural fire protection that requires a storage tank for fire suppression for an interim use. Figure 1 - Northeast Area Plan Sketch Plan for “Nelson International” at 10409 County Road 101 (city file 19-023) 5 January 23, 2020 • All water TLAC and connection fees would be paid when Corcoran system is available, currently planned to be available in 2022/2023. The applicant’s proposed layout appears to have parking lot and other improvements within the drainage and utility easement areas that were established as part of the plat, including the large easement for the trunk sewer. The applicant should show the easements on the site plan to show any potential encroachments as permanent structures are not allowed over drainage and utility easements. An encroachment agreement would be needed to construct any improvements over the drainage and utility easement. A feasibility study for sewer and water would be completed as the project moves forward through the City process. Parks and Trails The Comprehensive Plan show a future on- and off-road trail running north to south on the east and west sides of the parcel, respectively. Park dedication would be required when development occurs and will be 3% of land or equivalent market value in cash. Wetlands and Environment There are significant wetlands on site. The applicant does not appear to be impacting the large wetland on the west portion of the site, but does show significant impact to the wetland in the southeast portion of the site. Securing approval for wetland fill and mitigation could be challenging. The applicant will be able to proceed with a mitigation plan after the wetland delineation is approved. The wetlands on the site have been identified as a medium quality wetland and requires a 25 ft. average buffer and a 15 ft. structure setback from the buffer (40 ft. total). The 2040 Comprehensive Plan Natural Resource Inventory Area map shows the wetlands on the site as an Emergent natural plant community and an upland Savanna/Pasture plant community along the south side of the property. The Natural Resource Inventory Area map also identifies the southwest corner of the parcel as a High Quality Natural Community that extends into the adjacent parcels. There are significant trees on the east side of the parcel that are shown removed on the sketch plan. Stormwater Management The proposed sketch plan identifies ponding in the southwest portion of the site. The ponding must provide treatment and rate control. The City Engineer has indicated that the stormwater management on the site appears to be manageable but may require more treatment and management areas because of the large amount of impervious surface. A stormwater feasibility study would be completed as the project moves forward through the City process. Sketch Plan for “Nelson International” at 10409 County Road 101 (city file 19-023) 6 January 23, 2020 Building Standards The applicant is proposing to finish the building with TextureClad metal panels. These panels are finished with a textured material that looks similar to stucco, but at a lower cost. The applicant has provided information about the product and photos of example buildings with the material. This material is a not an approved exterior finish in Section 1060.050 Subd. 1(C) of the Zoning Ordinance, which requires: a. face brick; b. natural stone or cultured stone; c. decorative concrete block or integral colored block; d. cast in place concrete or pre-cast concrete panels; e. wood, provided the surfaces are finished for exterior use and wood of proven exterior durability is used, such as cedar, redwood, cypress; f. curtain wall panels of steel, fiberglass and aluminum (nonstructural, non-load bearing), provided such panels are factory fabricated and finished with a durable non-fade surface and their fasteners are of a corrosion resistant design. Up to 20% of any wall surface may consist of the materials outlined herein (excludes overhead doors); g. glass curtain wall panels; h. stucco or EIFS; i. fiber cement siding and j. other materials deemed appropriate and subject to approval by the Zoning Administrator. The material has been used elsewhere on accessory buildings in the City of Corcoran but has not been allowed as a principal structure material. • The Council should review the proposed materials and provide feedback about whether or not this material would provide the same level of quality as the permitted exterior finishes and would be acceptable in this location. Summary The applicant is asking for feedback on the concept plan. The concept plan is consistent with planned land uses in this area, however, there are significant infrastructure improvements that are required to make this project possible. In addition to any general development comments, staff recommends that the Council provide specific feedback on the following: a. Water. How should water be provided to the site. Staff suggested that there are two options: 1) direct staff to approach Maple Grove to amend the water supply agreement or 2) allow the developer to develop with a private well. In either scenario, the developer would be responsible for City of Corcoran TLAC and connection fees in addition to any other costs. b. Streets. The project requires construction of a new east-west street. This street would provide access to this property, the property to the north and would be part of a larger street system. Sketch Plan for “Nelson International” at 10409 County Road 101 (city file 19-023) 7 January 23, 2020 Additionally, we expect Hennepin County to require turn lanes to be constructed on CR 101. The Council should discuss whether or not they would consider completing these projects as public projects that would be assessed back to benefitting property owners or whether the costs are the responsibility of the developer. c. Architecture. The Council should discuss the appropriateness of the proposed textured metal panels. d. Natural Resources. As noted in the staff report, the proposal does require impact to nearly an acre of wetland and removal of a significant number of trees. The Council may wish to provide feedback to the applicant. Next Steps If the applicant chooses to proceed with the application, they would need to submit applications for: • Site Plan • Conditional Use Permit While this is not the formal application, the Council should provide direction to the applicant so that they can decide whether to proceed with formal application. 5. Recommendation Staff recommends that the City Council review and discuss the sketch plan and provide the applicant with informal comments. Any comments given by the City Council are advisory in nature and non-binding. While the comments are non-binding, the applicant will consider the comments from the City Council when they prepare their formal submittal. Attachments 1. Site Location Map 2. Natural Resource Inventory Areas Map 3. Ecologically Significant Areas Map 4. City Engineer’s Memo dated January 15, 2020 5. Applicant Narrative 6. Site Graphics and Material Examples He nn e pin Co u n ty Na tur al Resources Map Da te : 1/1 6/2020 Co mm ents: Th is data (i) is furnished 'AS IS' with no representation as to co mp le te ness or accu r acy; (ii) is furnished with no wa rra nty of a ny kin d; an d (iii) is n otsuitable for leg al, eng ine erin g or surveying p urposes. Hennepin County shall n ot be liable for a ny d amage, injury or loss re sulting from this data. CO PYRIGHT © HENNEP IN COUNTY 2020 1 inch = 4 00 feet Le ge nd DNR P ub lic W aters We tlands Poten tial Wetland - HCW I Pr obab le We tland - HCW I Pr obab le We tland - NW I PID: 0 111 923 4 100 0 2 Add re s s: 5 2 AD D RESS PENDING, C OR C ORAN O wne r N am e: Acr es: 21 .79 ¯ City of GreenfieldCityofMapleGroveCity of Medina City of Rogers Bechtold RdPioneer Trl TrailHavenRdCounty Road 116County Road 30 S c hu t t e R d Oakdale Dr County Road 10 Horseshoe Trl C o u n t y R o a d 5 0 Larsen Rd Willow DrHunterRdCounty Road 19Homestead Trl Cain RdRolling Hills RdCountry Rd Mohawk DrLarkin RdFoxline DrStrehler Rd Dassel Ln OldSettlersR d Stieg Rd Kalk RdMeister Rd Maple Hill Rd93rd Ave N Tessmer Rd Blue Bonnet DrJubertLn456710 456750 456719 456730 4567116 4567101 4567117 Brockton Ln N109th Ave N 4567101 ")55 Hackamore Rd Morin Lake Scott Lake Jubert Lake Goose Lake Cook Lake R u s h C reekRushCreek South F o r k Ru sh Creek SouthForkR u sh C r eek2040 COMPREHENSIVE PLAN 3,000 0 3,0001,500 Feet ± Path: L:\2294\100\2040CompPlan\Natural Resource Inventory Areas.mxd Date: 1/7/2019 Time: 1:10:39 PM User: ShuJC0243 ^_Natural Community !(Rare Species OccurenceHigh Quality Natural Community Natural Plant Communities WetlandsWet PrairieEmergentShrubFloodplain ForestOpen WaterFlood Plain (Reed Canary Dominant) UplandsSavanna/PastureMaple/BasswoodOak ForestDisturbed WoodlandOld FieldMunicipal BoundaryParcel BoundariesStreamsLake/Open Water Map 1-7Natural Resource Inventory Areas Note: Due to limitations of map scale, distribution and proportion of NaturalCommunity types within each colored area are approximate.Source:Natural Plant Communities, Rare Species Occurence (Natural Resource Inventory andManagement Plan, Nov. 2001, Bonestroo Rosene Anderlik & Associates) City of GreenfieldCityofMapleGroveCity of Medina City of Rogers Bechtold RdPioneer Trl TrailHavenRdCounty Road 116County Road 30 S c hu t t e R d Oakdale Dr County Road 10 Horseshoe Trl C o u n t y R o a d 5 0 Larsen Rd Willow DrHunterRdCounty Road 19Homestead Trl Cain RdRolling Hills RdCountry Rd Mohawk DrLarkin RdFoxline DrStrehler Rd Dassel Ln OldSettlersR d Stieg Rd Kalk RdMeister Rd Maple Hill Rd93rd Ave N Tessmer Rd Blue Bonnet DrJubertLn456710 456750 456719 456730 4567116 4567101 4567117 Brockton Ln N109th Ave N 4567101 ")55 Hackamore Rd Morin Lake Scott Lake Jubert Lake Goose Lake Cook Lake R u s h C reekRushCreek South F o r k Ru sh Creek SouthForkR u sh C r eek2040 COMPREHENSIVE PLAN 3,000 0 3,0001,500 Feet ± Path: L:\2294\100\2040C ompPlan\Ecologically Significant Natural Areas.mxd Date: 1/7/2019 Time: 3:17:35 PM User: ShuJC0243 Aspen ForestCattail MarshLowland hardwood forestMaple-basswood forestMesic PrairieMixed emergenct marshMixed hardwood swampOak ForestOak woodland-brushlandTamarack swampWet meadowWillow SwampMunicipal BoundaryParcel BoundariesStreamsLake/Open Water Map 1-12Ecologically Signficant Natural Areas Source:Ecologically Significant Natural Areas (MN DNR MLCCS-2015, Natural Resource Inventoryand Management Plan, Nov. 2001, Bonestroo Rosene Anderlik & Associates) Engineer’s Memo Wenck Associates, Inc. | 1800 Pioneer Creek Center | P.O. Box 249 | Maple Plain, MN 55359-0249 Toll Free 800-472-2232 Main 763-479-4200 Email wenckmp@wenck.com Web wenck.com - To: Kendra Lindahl, City Planner From: Kent Torve, P.E. Date: January 15, 2020 Subject: Nelson International Sketch Plan Infrastructure Review 0.0 Infrastructure Setting Nelson International is proposing to construct a commercial development along CSAH 101 north of the Bellwether development. • A feasibility study (transportation, stormwater and water supply) would be completed as the project moves forward through the City process. 1.0 Transportation County Road 101 Hennepin County controls the location and design of access to CSAH 101 through a permit process. Sketch plan comments include: • Hennepin County has provided preliminary comments (email dated October 11, 2019) and will require the construction of a southbound right turn lane and a northbound left turn lane similar to Bellwether development to the south o Project would be designed and managed by the City through an escrow process. o Project likely includes private utility relocations. City Street / North Entrance • The north site entrance will access future City street (timeline to be defined in feasibility study) o Access to the facility should be relocated to the western most edge of parking lot due to Future City Street turn lanes which typically require 500 /-feet o Requirements will be more defined during a feasibility study which will address road design, alignment, turn lanes, etc. o Maximum driveway width is 32 feet. 2.0 Sewer The parcel can be serviced by the trunk system installed in 2019 for Bellwether. • Coordinate with City on potential impacts to existing easements that are on site. • Trunk and connection fees would apply. • Connection to structure at the trunk system will be reviewed as part of the construction plan approvals. 2 3.0 Water The parcel does not currently have municipal supply for water due to contract limitations with Maple Grove. From an infrastructure standpoint, the trunk water line is currently located north edge of Stieg Road ROW and would be brought to the site by the developer. Supply The site currently has two options for supply: • Request City negotiate amendment to the Maple Grove agreement and allow an interim supply from Maple Grove via the Corcoran system. o It can be assumed Maple Grove connection fees would be charged, and o Corcoran water connection and TLAC fees would be charged when Corcoran system is available, currently planned to be available in 2022/2023. • A less viable option is to construct a private well with rural fire protection that requires a storage tank for fire suppression for an interim use. o All water TLAC and connection fees would be paid when Corcoran system is available, currently planned to be available in 2022/2023. Water Main Water main is dependent on the interim options discussed above. • For municipal supply, Corcoran water system plans require a 12-inch trunk water main north-south through the subject parcel such that connection to the trunk water system is facilitated (this would be via a 12-inch stub at edge of Stieg Road ROW). Requirements include: o On site utility easements o Offsite utility easements o Looping to Elm Lane cul de sac is a required lateral connection (Bellwether 3rd) • For a well/temporary system o On site utility easement o Future looping of the lateral is developer responsibility, terms to be negotiated during the plan approval and developer agreement process. o Terms will be outlined in development agreement. 4.0 Stormwater Stormwater management is manageable for the site, although the large amount of impervious on the concept plan suggests the treatment and management areas would be significant (and not shown on concept plan). • Wetland high water level was identified with prior analysis of Bellwether 3rd as 932.9. • Site drainage is to the northwest and can be estimated from typical stormwater management for developments in the west metro (heavy soils) that 5% to 7% of the buildable parcel area would be utilized for stormwater management (outside wetland boundaries). 3 o Plan shows a single pond, more stormwater facilities may be needed. o City stormwater guidelines will be provided. Currently being updated. o Watershed stormwater permit will be required. 5.0 Wetlands Significant wetlands exist and the formal process would need to be followed. It can be noted that Corcoran is the LGU for the Wetland Conservation Act and obtained this authority in 2019. • Concept plan shows significant wetland fill and impacts which will be reviewed through the LGU process. • DNR wetland exists on the property and may have additional requirements. STAFF REPORT Agenda Item 10a. Council Meeting: January 23, 2020 Prepared By: Brad Martens Topic: 2020 Legislative Priorities Action Required: Approval Summary: The 2020 legislative session is scheduled to begin on February 11, 2020 and must end by May 18, 2020. As in previous years, staff will work with legislators to promote the priorities of the City of Corcoran and to attempt to eliminate legislation hurtful to the City. Additionally, the League of Minnesota Cities and Metro Cities will advocate on behalf of their member cities which includes Corcoran. In order to communicate effectively with the legislators, it is requested that the City Council review proposed legislative priorities and provide staff with direction for those conversations. Attached to this report is a draft document showing draft legislative priorities. Financial/Budget: N/A Options: 1.Approve 2020 legislative priorities as presented. 2.Approve 2020 legislative priorities with amendments. Recommendation Approve 2020 legislative priorities as presented. Council Action: Consider a motion to approve 2020 legislative priorities. Attachments: 1.Draft 2020 legislative priorities for the City of Corcoran A Hidden Gem Waiting To Be Discovered www.ci.corcoran.mn.us 8200 County Road 116 Corcoran, MN 55340 Phone: 763-420-2288 Administrative Offices Public Works Offices 9100 County Road 19 Corcoran, MN 55357 Phone: 763-420-2652 Phone: 763-420-8966 Police Department Offices 8200 County Road 116 Corcoran, MN 55340 2020 Legislative Priorities Thank you for taking the time to review the legislative issues affecting the City of Corcoran. The City appreciates your help in furthering our mission to provide high quality public services in a cost effective, responsible, and professional manner in order to create a preferred environment to live, work, play, and conduct business. Topic #1: General Government •Local Decision-Making Authority: The City opposes legislation that erodes local decision making and control. We believe that decision making happens best at the local level. •Unfunded Mandates: Many bills passed by the legislature and adopted into law have direct effects on cities. Bills should include language stating that additional costs from State requirements must be paid for with State allocated funds. Additionally, there are often bills introduced which require additional reporting from cities. This affects smaller communities the hardest which have the fewest staff. Existing unfunded mandates should be modified or repealed where possible; no additional statewide mandates should be enacted unless full funding for the mandate is provided; cities should not be forced to comply with unfunded mandates. •Levy Limits: The City of Corcoran strongly opposes levy limits and other forms of levy restrictions imposed upon local governments. Topic #2: Transportation •Street Improvement District: Current law does not allow for the collection of transportation fees as cities develop other than the existing 429 process which is overly burdensome on existing property owners. The City supports the option to create a street improvement district to dedicate funds towards transportation improvements as development takes place similar to the existing authority to impose fees on new development of other infrastructure such as water, sanitary and storm sewer, and park purposes. •Motor Vehicle Lease Sales Tax Allocation to Hennepin County: The City of Corcoran advocates for eliminating the exemption that prevents Hennepin and Ramsey counties from receiving their portion of the sales tax on leased vehicles through the county state aid formula. This change would provide an estimated $10.7 million in annual funding to Hennepin County to be used for improvements to roads and bridges. •State Aid Funds: The City of Corcoran roads deteriorate on a more aggressive pace due to the amount of pass through traffic. Although the City receives some state aid funds, the amount is nowhere near the level needed to offset the additional maintenance costs. Additional funding should be provided. •610 Extension: In 2017 a major project extending Highway 610 in Maple Grove was completed extending the road to Interstate I-94 in Maple Grove. The final phase of this project is to connect County Road 30 through additional transportation improvements. Additional funding should be provided for this important transportation corridor Topic #3: Housing and Land Use •City Role in Planning: Cities facilitate the development of housing via land use planning, zoning ordinances, subdivision regulations, and rental licensing. Cities should have sufficient authority and flexibility to promote housing types best suited to meet local needs, public purposes and goals. Corcoran strongly opposes any effort to reduce, alter, or interfere with city authority to carry these functions in a locally determined manner. Topic #4: Fiscal Reform •Local Government Aid: The City of Corcoran receives no local government aid despite ever increasing costs to maintain infrastructure for those who do not live in the City. Formula adjustments should be made to consider costs attributed to non-residents travelling through and utilizing infrastructure. Topic #6: School Funding •Inadequate school funding leads to discrepancies based upon which district has the highest tax capacity. Corcoran sends students to five school districts, more rural districts such as Rockford and Buffalo do not have access to resources equal to high tax capacity districts such as Wayzata and Osseo. This places an undue burden on property owners and reduces the ability to provide a high-quality education without cutting important after school programs important for student development. Topic #6: Public Safety •The City of Corcoran supports legislation to provide cities with resources for first responder wellness including mental health screenings and support. Sincerely, Brad Martens, City Administrator bmartens@ci.corcoran.mn.us 763-400-7030 Corcoran City Council Mayor Ron Thomas Councilmember Jonathan Bottema Councilmember Brian Dejewski Councilmember Alan Schultz STAFF REPORT Agenda Item 10b. Council Meeting: January 23, 2020 Prepared By: Lieutenant Ryan Burns Topic: 2020 CIP Squad Car Purchase Action Required: Approval Summary: The 2020 / 2021 Capital Improvement Plan provides for the replacement of two squad cars in 2020. After contacting the dealer, it was learned Ford’s current lead build time is five to six months for a squad car order. Staff is requesting to order the vehicles in advance of the formal CIP approval which is expected to take place in March. Currently, squad 563 is planned to be saved and used for the future CSO and Police Reserve use. Squad 564 would be transferred to City Staff or Public Works to replace aging vehicles. To reduce delivery delay staff is requesting authorization to order two, 2020 Ford Police Explorers. Financial/Budget: The 2020-2021 CIP has an anticipated $49,000 budgeted for each squad replacement in 2020. Payment would not take place until after the squads were received later in 2020. Options: 1. Approve the order of two Ford Police Explorers prior to the approval the 2020- 2021 CIP. 2. Provide Staff direction. Recommendation: Approve the order of two Ford Police Explorers prior to the approval the 2020- 2021 CIP. Council Action: Consider a motion to Approve the order of two Ford Police Explorers prior to the approval the 2020- 2021 CIP. Attachments: 1. VCI for Squad 563 2. VCI for Squad 564 3. Draft 2020-2021 CIP Factor Score Notes Age 4 Purchased Febuary 2016 in service in July 2016 Miles/Hours 7 70,000 Type of Service (1-5)5 Reliability (1-5)2 Average down time for regualr reapirs. M&R Costs (1-5)3 Several costly repairs but they were covered under warranty, trasmisson repair 11-18-16 Condition (1-5)3 Vehicle is in average shape, minor dings and scrathes, interior / exterior several mounting holes in floor,dash and roof. Cost Per Mile (1-3)2 Average Total Points 26 Meets replacement criteria Point Ranges Under 19 points Condition 1 Excellent 20 to 23 points Condition 2 Good 24 to 27 points Condition 3 Meets replacement criteria 28 points and aboveCondition 4 Needs immediate consideration Notes: Downtime refers to any time the vehicle is not available to be used for its intended purpose. Frequency of use refers to the average use the vehicle has received over the last three years Maintenance and Repair (M & R) refers to all maintenance and repairs less insurance claims. PW time is included as a cost. Cost per mile is the total M & R divided by the miles/hours on the vehicle. Repurposed to CSO vehicle Vehicle Condition Index 2016 Ford Interceptor Utility 563 Points One point for each year of chronological age, based upon in- service date. One point for each 10,000 miles of use/500 hrs. of use. 1, 3, or 5 points are assigned based on the type of service that vehicle receives. For instance, a police patrol car would be given a 5 because it is in severe duty service. In contrast, an administrative sedan would be given a 1. Points are assigned as 1, 2, 3, 4 or 5 depending on the frequency of repair/downtime. A 5 would be assigned to a vehicle that has 4.0 to 5.0% downtime or more; 4 for 3.0 to 4.0% downtime; 3 for 2.0 to 3.0% downtime, 2 for 1.0 to 2.0% downtime; and 1 point would be assigned for vehicles with less than 1% downtime. 1 to 5 points are assigned based on total life M & R costs equal to or greater than the vehicle’s original purchase price, while a 1 is given to a vehicle with life M & R costs equal to 20% or less of its original purchase cost. This category takes into consideration body condition, rust, interior condition, accident history, anticipated repairs, etc. A scale of 1 to 5 points is used with 5 being poor condition. Points are assigned as 1,2, or 3 depending on the cost per mile relative to class. A 3 would be assigned to a vehicle with costs per mile higher than average for the class; 2 assigned to a vehicle with costs per mile average for the class; 1 assigned to a vehicle with costs per mile lower than average for the class. Factor Score Notes Age 4 Purchased Febuary 2016 in service in July 2016 Miles/Hours 10 100,000 Type of Service (1-5)5 Reliability (1-5)2 Average down time for regular repairs and maintence M&R Costs (1-5)2 Pending no major repairs or downtime Condition (1-5)4 Vehicle is in average shape, minor dings and scrathes, interior / exterior several mounting holes in floor,dash and roof. Cost Per Mile (1-3)2 Average Total Points 29 Needs immediate consideration Point Ranges Under 19 points Condition 1 Excellent 20 to 23 points Condition 2 Good 24 to 27 points Condition 3 Meets replacement criteria 28 points and aboveCondition 4 Needs immediate consideration Notes: Downtime refers to any time the vehicle is not available to be used for its intended purpose. Frequency of use refers to the average use the vehicle has received over the last three years Maintenance and Repair (M & R) refers to all maintenance and repairs less insurance claims. PW time is included as a cost. Cost per mile is the total M & R divided by the miles/hours on the vehicle. Replace 2008 City Durango Vehicle Condition Index 2016 Ford Interceptor Utility 564 Points One point for each year of chronological age, based upon in- service date. One point for each 10,000 miles of use/500 hrs. of use. 1, 3, or 5 points are assigned based on the type of service that vehicle receives. For instance, a police patrol car would be given a 5 because it is in severe duty service. In contrast, an administrative sedan would be given a 1. Points are assigned as 1, 2, 3, 4 or 5 depending on the frequency of repair/downtime. A 5 would be assigned to a vehicle that has 4.0 to 5.0% downtime or more; 4 for 3.0 to 4.0% downtime; 3 for 2.0 to 3.0% downtime, 2 for 1.0 to 2.0% downtime; and 1 point would be assigned for vehicles with less than 1% downtime. 1 to 5 points are assigned based on total life M & R costs equal to or greater than the vehicle’s original purchase price, while a 1 is given to a vehicle with life M & R costs equal to 20% or less of its original purchase cost. This category takes into consideration body condition, rust, interior condition, accident history, anticipated repairs, etc. A scale of 1 to 5 points is used with 5 being poor condition. Points are assigned as 1,2, or 3 depending on the cost per mile relative to class. A 3 would be assigned to a vehicle with costs per mile higher than average for the class; 2 assigned to a vehicle with costs per mile average for the class; 1 assigned to a vehicle with costs per mile lower than average for the class. Department Item Cost Re-sale Total Proposed Notes Administration Administration Software $50,000 $0 $50,000 Accounting/Utility billing/ Permits (e-permits) Police Livescan $33,000 $0 $33,000 Obtained used from Medina in 2017; now unsupported and failing MDC's (squad computers)$48,000 $0 $48,000 End of life, failing; required to connect to HC Dispatch Ford SUV Explorer (563)$49,000 $0 $49,000 Repurposed for Reserves/Public Works Ford SUV Explorer (564)$49,000 $0 $49,000 Repurposed for CSO City camera system $7,000 $0 $7,000 Replace camera system switch and base Squad cameras/body cam $99,500 $0 $99,500 Replace failing sqaud cameras; add body cameras Support/protection equipment $12,000 $0 $12,000 Public Works Cashman Trailer - low boy $42,000 $8,000 $34,000 Replace 2005 trailer Toro 7500 Mower $37,000 $10,000 $27,000 New equipment (Grant $10,000) Mack Tandem Axle Dump Truck $265,000 $0 $265,000 Keep 2010 model (emergency spare) Water truck - 4,000 GAL $168,000 $0 $168,000 New equipment (currently borrowing 1,500 GAL 1984 model from Rockford) Brush mower $34,000 $0 $34,000 New equipment Trail Maintenance Equipment $10,000 $0 $10,000 New equipment Sub-total $885,500 Department Item Cost Re-sale Total Notes Police Ford SUV Explorer (562)$49,000 $0 $49,000 Re-purpose (TBD) EZ Go Express 4x4 $15,000 $0 $15,000 Replace EZ-Go Golf Cart Support/protection equipment $12,000 $0 $12,000 Radios Public Works GMC 1.5 Ton Pickup with plow $120,000 $15,000 $105,000 Replace 2011 model Daewoo Track Excavator $170,000 $55,000 $115,000 Replace 2006 model GMC 3/4 ton Pickup with plow $60,000 $10,000 $50,000 Replace 2011 model Sub-total $346,000 Total $1,231,500 Fund Balance $20,000 Cash $150,000 Bond Revenue $715,500 Subtotal $885,500 Fund Balance $0 Cash $175,000 Bond Revenue $171,000 Subtotal $346,000 Total $1,231,500 Total Bond Rev.$886,500 2020 2021 2020 2021 Draft 2020 - 2021 Capital Improvement Plan Expenditures 2020 - 2021 Capital Improvement Plan Revenue STAFF REPORT Agenda Item 10c. Council Meeting: January 23, 2020 Prepared By: Jessica Beise Topic: Special Election Options Action Required: Direction and Approval Summary: On December 31, 2019 Councilmember Keefe resigned from the City Council effective immediately and a vacancy on the City Council was declared on January 9, 2020. As the vacancy occurred prior to first date of candidate filing in the next election cycle, Minn. Stat. 412.02 requires a special election to fill the remainder of the term. A special election can take place at the next City election or at one of the uniform election dates outlined in Minn. Stat. 205.10. In 2020, May 12, August 11 (state wide primary election day) or November 3 (general election day) would be possible dates for a special election. The next City election is slated for November 3, 2020. In order to hold a special election before the next regular city election, the council must adopt an ordinance that specifies under what circumstances it will hold a special election to fill a vacancy before the next regular city election. The City of Corcoran does not have currently have an ordinance related to special elections. If the Council would like to adopt an ordinance, the League of Minnesota Cities has a model ordinance for special elections, see attached. Staff would seek feedback from Council on the ordinance contents and would bring back the ordinance at the February 13, 2020 meeting allowing for the required posting of a proposed ordinance on the City’s website. The candidate filing period for either the May or August special elections would be 70 to 56 days prior to the election. The candidate filing period for the November election is July 28 to August 11. When filing for the 2020 election, candidates will have to indicate if they would like to file for the special election seat with the shorter two-year term or if they would like to file for the general four-year term. There are several considerations for moving forward with a special election. Voter turnout typically is lower for special elections and primary election dates. In 2018 the primary election voter turnout was 819 persons and in 2018 the general election voter turnout was 3039 persons. Mobilizing staff on a date where an election is not currently being held can be expensive and would not be budgeted for. Council would need to call a special Council meeting to canvass the election results if the election is held on either the May 12 or August 11th dates. Until the special election, the Council would appoint someone to fill the vacancy temporarily, which is being considered under agenda item 10d. The candidate who wins the special election, would then be sworn in at the next meeting after the certificate of election is provided to the candidate. Election certificates are provided after canvassing which is happens between the third and tenth day following an election. Financial/Budget: The statewide primary and general elections costs are in the 2020 budget. If the May 12 election date was selected, the cost would be approximately $5,000 and was not budgeted in 2020. The ordinance creation and posting costs for the adoption of a special elections ordinance would be absorbed in the 2020 attorney and general government sections of the 2020 budget. Options: 1. Select a date for the special election and if need direct staff to draft a special elections ordinance for adoption at the February 13, 2020 meeting. 2. Defer the selection of a special election date to a future meeting. Recommendation Staff would recommend hosting the election at one of the already scheduled elections, either August 11 or November 3. If selecting the August 11, 2020 date, staff recommending adopting a special elections ordinance at the February 13, 2020 Council meeting. Council Action: Consider a motion to set the date for the special election and authorize staff to draft and ordinance if needed. Attachments: 1. Special Elections Model Ordinance League of Minnesota Cities Model Ordinance: 7/2/2019 Providing for Special Elections to Fill Council Vacancies Page 1 Providing for Special Elections to Fill Council Vacancies, LMC Model Ordinance League models are thoughtfully developed by our staff for a city’s consideration. Models should be customized as appropriate for an individual city’s circumstances in consultation with the city’s attorney. Helpful background information on this model may be found in “City Special Elections.” This icon marks places where the city must customize the model. They offer additional provisions, optional language, or comments for your consideration. The icon, and language you do not wish to include, should be deleted from this model before use. Make other changes, as needed, to customize the model for your city. ORDINANCE NO. _____ This is an optional ordinance that calls for special elections to be held at a time other than a general election. If a city must hold a special election to fill a long-term vacancy there are two options. First, the city can hold the special election to fill a vacancy on council at the same time as the next regular city election. This seems to be the most common scenario. Second, the city may hold a special election before the next general election. To do so, the city council must adopt an ordinance that specifies under what circumstances this will be done. There are two options for this type of ordinance. One way is to pass an ordinance that will apply to all future special elections. This model ordinance is intended to address this situation. The other way is to pass an ordinance that applies only to one particular special election. This model ordinance may be modified to fit this purpose. AN ORDINANCE PROVIDING FOR SPECIAL ELECTIONS TO FILL CERTAIN VACANCIES IN ELECTED OFFICES AT TIMES OTHER THAN THE REGULAR CITY GENERAL ELECTION The City Council of _____, Minnesota ordains: SECTION 1. DEFINITIONS For the purposes of this ordinance, the following terms shall have the following meanings: City. The City of __________, County of __________, State of Minnesota. General Election. A “general election” is an election held at regular intervals on a day determined by law or charter at which the voters of the state or any of its subdivisions choose by ballot public officials or presidential electors. Special Election. A “special election” is an election held at any time to fill vacancies in public offices. League of Minnesota Cities Model Ordinance: 7/2/2019 Providing for Special Elections to Fill Council Vacancies Page 2 Vacancy. A vacancy occurs for the reasons stated in Minnesota Statute Section 351.02 or other state law. SECTION 2. APPOINTMENT TO VACANCY Pursuant to Minnesota Statute § 412.02, subd. 2a, a person shall be appointed to fill the vacancy until the special election is held and the winner of the special election is qualified to take office. SECTION 3. SPECIAL ELECTION TIMING If a vacancy occurs and a special election to fill the unexpired term is required pursuant to Minnesota Statute Section 412.02, subd. 2a, and there are more than ____ days until the next general election, then the special election to fill the vacancy shall be held prior to the general election, but no later than ____ days after the date of the vacancy. SECTION 4. REPEAL Ordinance Number (number of ordinance), (title of ordinance), adopted on __________, ______is repealed. This section is only necessary if a prior ordinance needs to be repealed. If there is no prior ordinance, delete this section. SECTION 5. SEVERABILITY If any provision of this ordinance is found to be invalid for any reason by a court of competent jurisdiction, the validity of the remaining provisions shall not be affected. SECTION 6. EFFECTIVE DATE This ordinance becomes effective upon passage and publication. Passed by the City Council of _______, Minnesota this _____ day of Month, Year. ___________________ Mayor Attested: ____________________ City Clerk STAFF REPORT Agenda Item 10d. Council Meeting: January 23, 2020 Prepared By: Brad Martens Topic: City Council Appointment Action Required: Approval Summary: At the January 9, 2020 meeting the City Council declared a vacancy following the resignation of Councilmember Mike Keefe. At the direction of Council, the City accepted applications until noon on Wednesday, January 22nd to fill the vacancy. The City Council scheduled a work session for 6:30 pm prior to the January 23rd meeting to review applications. Council should consider those applicants and approve a resolution appointing an individual to fill the vacancy until the results of a special election. Financial/Budget: N/A Options: 1. Approve resolution 2020-11 appointing an individual to the Corcoran City Council. 2. Defer the appointment until a future date. Recommendation Approve resolution 2020-11 appointing an individual to the Corcoran City Council. Council Action: Consider a motion to approve resolution 2020-11 appointing an individual to the Corcoran City Council. Attachments: 1. Resolution 2020-11 City of Corcoran January 23, 2020 County of Hennepin State of Minnesota RESOLUTION NO. 2020-xx Page 1 of 1 Motion By: Seconded By: A RESOLUTION APPOINTING __________ TO THE CORCORAN CITY COUNCIL WHEREAS, the City of Corcoran received a resignation notice from Councilmember Mike Keefe effective December 31, 2019; and WHEREAS, the City Council declared a vacancy at its January 9, 2020 meeting, and WHEREAS, Minnesota Statute 412.02 dictates a special election shall be held at or before the next city election to fill the unexpired term, and WHEREAS, the City Council may appoint an individual to serve on the City Council until a qualified successor is elected at the special election; and WHEREAS, the City Council accepted applications for appointment until 12:00 pm on Wednesday, January 22, 2020; and WHEREAS, the City Council has found ________________ to meet the requirements for appointment to serve on the City Council; and NOW, THEREFORE BE IT RESOLVED, by the City of Corcoran, that the City Council hereby appoints ______________________ to the City Council until a qualified successor is elected at a special election. VOTING AYE VOTING NAY Thomas, Ron Thomas, Ron Bottema, Jonathan Bottema, Jonathan Dejewski, Brian Dejewski, Brian Schultz, Alan Schultz, Alan Whereupon, said Resolution is hereby declared adopted on this 23rd day of January, 2020. ________________________________ Ron Thomas - Mayor ATTEST: City Seal ____________________________________ Jessica Beise – Administrative Services Director STAFF REPORT Agenda Item 10e. Council Meeting: January 23, 2020 Prepared By: Kevin Mattson & Pat Meister Topic: 2020 CIP Truck Purchase Action Required: Approval Summary: The draft 2020-2021 Capital Improvement Plan provides for the purchase of a Tandem Axle Dump Truck and 4,000-GAL Water Truck in 2020. Both items would be considered new equipment with existing equipment either repurposed or returned to the owner. Tandem Axle Dump Truck With the growing transportation demand and need to facilitate timely public safety services, staff has identified a lack of redundancy in the city’s operational planning. Staff is recommending repurposing the existing 2010 tandem axle dump truck as a spare for an emergency backup. The current plowing operation is significantly impacted when fleet is out of service since equipment is unavailable to rent and not easily borrowed on short notice. Additionally, the existing spare dump truck will be used for other winter maintenance functions including hauling of materials for other projects thus minimizing the time and effort to swap plow equipment. The lead time to receive the equipment is approximately 14 months. 4,000-GAL Water Truck The 4,000-GAL water truck would replace a 1984 model 1,500-GAL water truck that is currently being equipment shared from the City of Rockford. The increase in tank volume capacity has a significant impact to the work flow operationally and reduces the labor required by half. This frees up staff and provides flexibility to respond to other department responsibilities including utility locates and other unexpected requests. Functionally water trucks play an important role and are routinely used on a weekly basis for 9 months out of the year. The equipment supports maintenance operations including grading roads, dust control, establishing erosion control and site restoration, flushing sewers, preparing hockey rink, shouldering roads, street s weeping (anticipated future increased need), and emergency response services related to rural fire fighting. The lead time to receive the equipment is approximately 10 months. Staff is requesting to order the equipment in advance of the formal CIP approval which is expected to take place in March. Financial/Budget: The draft 2020-2021 CIP has budgeted $265,000 for the Tandem Axle Dump Truck and $168,000 for the 4,000-GAL Water Truck in 2020. Payment would not take place until after the equipment was received. Options: 1. Approve the order of the Tandem Axle Dump Truck and 4,000-GAL Water Truck prior to the approval the draft 2020-2021 CIP. 2. Provide staff direction. Recommendation: Approve the order of the Tandem Axle Dump Truck and 4,000-GAL Water Truck prior to the approval the draft 2020-2021 CIP. Council Action: Consider a motion to approve the order of the Tandem Axle Dump Truck and 4,000- GAL Water Truck prior to the approval the draft 2020-2021 CIP. Attachments: 1. VCI for 2010 Mack Tandem Axle Dump Truck 2. Draft 2020-2021 CIP Factor Score Notes Age 10 Purchased in 2009 Miles/Hours 4 33,000 miles (3.25); 2,360 hours (4.75) as of 01/17/2020 Type of Service (1-5)5 Integral equipment to maintain safe road conditions. There are currently no spare trucks and replacement takes on average 12-14 months. Reliability (1-5)2 From 2009-2019 this vehicle has been out of service for maintenance and repairs an average of 7 days per year. (7 / 365 = .019 or 1.9%) M&R Costs (1-5)1 Vehicle repairs are estimated at $22,000 (~$2,000 per year) making M&R costs less than 20%. Condition (1-5)3 Truck has average wear and tear (frame rust, interior decay, etc.). Cost Per Mile (1-3)2 This vehicle has received average repairs as compared to the history of repairs on previous and existing dump trucks. Total Points 27 Meets replacement criteria Point Ranges Under 19 points Condition 1 Excellent 20 to 23 points Condition 2 Good 24 to 27 points Condition 3 Meets replacement criteria 28 points and above Condition 4 Needs immediate consideration Notes: Downtime refers to any time the vehicle is not available to be used for its intended purpose. Frequency of use refers to the average use the vehicle has received over the last three years Maintenance and Repair (M & R) refers to all maintenance and repairs less insurance claims. PW time is included as a cost. Cost per mile is the total M & R divided by the miles/hours on the vehicle. Vehicle Condition Index 2010 Mack Tandem Axle Dump Truck Points One point for each year of chronological age, based upon in-service date. One point for each 10,000 miles of use/500 hrs. of use. 1, 3, or 5 points are assigned based on the type of service that vehicle receives. For instance, a police patrol car would be given a 5 because it is in severe duty service. In contrast, an administrative sedan would be given a 1. Points are assigned as 1, 2, 3, 4 or 5 depending on the frequency of repair/downtime. A 5 would be assigned to a vehicle that has 4.0 to 5.0% downtime or more; 4 for 3.0 to 4.0% downtime; 3 for 2.0 to 3.0% downtime, 2 for 1.0 to 2.0% downtime; and 1 point would be assigned for vehicles with less than 1% downtime. 1 to 5 points are assigned based on total life M & R costs equal to or greater than the vehicle’s original purchase price, while a 1 is given to a vehicle with life M & R costs equal to 20% or less of its original purchase cost. This category takes into consideration body condition, rust, interior condition, accident history, anticipated repairs, etc. A scale of 1 to 5 points is used with 5 being poor condition. Points are assigned as 1,2, or 3 depending on the cost per mile relative to class. A 3 would be assigned to a vehicle with costs per mile higher than average for the class; 2 assigned to a vehicle with costs per mile average for the class; 1 assigned to a vehicle with costs per mile lower than average for the class Department Item Cost Re-sale Total Proposed Notes Administration Administration Software $50,000 $0 $50,000 Accounting/Utility billing/ Permits (e-permits) Police Livescan $33,000 $0 $33,000 Obtained used from Medina in 2017; now unsupported and failing MDC's (squad computers)$48,000 $0 $48,000 End of life, failing; required to connect to HC Dispatch Ford SUV Explorer (563)$49,000 $0 $49,000 Repurposed for Reserves/Public Works Ford SUV Explorer (564)$49,000 $0 $49,000 Repurposed for CSO City camera system $7,000 $0 $7,000 Replace camera system switch and base Squad cameras/body cam $99,500 $0 $99,500 Replace failing sqaud cameras; add body cameras Support/protection equipment $12,000 $0 $12,000 Public Works Cashman Trailer - low boy $42,000 $8,000 $34,000 Replace 2005 trailer Toro 7500 Mower $37,000 $10,000 $27,000 New equipment (Grant $10,000) Mack Tandem Axle Dump Truck $265,000 $0 $265,000 Keep 2010 model (emergency spare) Water truck - 4,000 GAL $168,000 $0 $168,000 New equipment (currently borrowing 1,500 GAL 1984 model from Rockford) Brush mower $34,000 $0 $34,000 New equipment Trail Maintenance Equipment $10,000 $0 $10,000 New equipment Sub-total $885,500 Department Item Cost Re-sale Total Notes Police Ford SUV Explorer (562)$49,000 $0 $49,000 Re-purpose (TBD) EZ Go Express 4x4 $15,000 $0 $15,000 Replace EZ-Go Golf Cart Support/protection equipment $12,000 $0 $12,000 Radios Public Works GMC 1.5 Ton Pickup with plow $120,000 $15,000 $105,000 Replace 2011 model Daewoo Track Excavator $170,000 $55,000 $115,000 Replace 2006 model GMC 3/4 ton Pickup with plow $60,000 $10,000 $50,000 Replace 2011 model Sub-total $346,000 Total $1,231,500 Fund Balance $20,000 Cash $150,000 Bond Revenue $715,500 Subtotal $885,500 Fund Balance $0 Cash $175,000 Bond Revenue $171,000 Subtotal $346,000 Total $1,231,500 Total Bond Rev.$886,500 2020 2021 2020 2021 Draft 2020 - 2021 Capital Improvement Plan Expenditures 2020 - 2021 Capital Improvement Plan Revenue Landform®, SensiblyGreen® and Site to Finish® are registered service marks of Landform Professional Services, LLC. 1 MEMORANDUM 105 South Fifth Street, Suite 513 Minneapolis, MN 55401 Tel: 612-252-9070 Fax: 612-252-9077 www.landform.net DATE January 16, 2020 TO Brad Martens CC City Council, Planning Commission, Parks & Trails Commission FROM Kendra Lindahl, City Planner RE Active Corcoran Planning Applications Projects/Comments in blue italics are new Project marked with an * have moved from active to approved The following is a summary of project status for current, active projects: 1.Wessel Property EAW for 22020 Hackamore Road (PID 35-119-23-43-0001, 35-119-23-44-0001, 35-119-23-11-0001 and 35-119-23-12-0002) (City File 19-018). The EAW was published in the December 2nd EQB Monitor, which started the 30-day public comment period. Although not required by EQB environmental rules, the City hosted an EAW open house on December 5th. The Council is expected to take action on the EAW at the January 23rd Council meeting. 2.Ravinia 14th Final Plat and Final PUD (City file 19-022). Lennar submitted a request for approval of a final plat and final PUD development plan for “Ravinia 14th Addition” to allow 33 single-family detached home lots and four outlots. The item was postponed from the December 5th Planning Commission review to January 2nd due to lack of quorum. The Planning Commission recommended approval on January 2nd and Council action is expected on January 23rd. 3.Sketch Plan for “Nelson International” at 10409 County Road 101 (city file 19-023). The applicant submitted a sketch plan for an approximately 33,000-sq. ft. truck sales/repair operation. The item is scheduled for Council review on January 23rd. Also, there are several projects that have been approved, but are still not filed and closed out: 1.Corcoran Business Park (City file 06-005). The City Council granted a one-year extension to the final plat approval, which expired on April 12, 2011. Staff has spoken to the applicant and is still working to close out this project. Staff has spoken to the applicant and will schedule a meeting when more information is available on the Loretto sewer project. 2.Hope Ministries Conditional Use Permit for Cemetery and Vacation of Drainage & Utility Easement at 19951 Oswald Farm Road (City file 12-002). Hope Ministries submitted a request for a conditional use permit to allow a cemetery west of the existing church. The application was approved by the City Council on March 22nd and site work had begun. The letter of credit for site improvements has been released, but we are holding the escrow pending completion of the approved landscaping. The applicant has indicated that they are considering a site plan amendment application to modify the approved plans. Staff met again with Pastor Brian Lother in July 2017 to discuss the outstanding issues and future expansion plans on the property. 3.Sawgrass Preliminary Plat, Preliminary PUD Development Plan and Rezoning for Schendel property at 20400 County Road 10 (City file 14-027). The City Council approved the request on December 11, 2014 and granted the applicant 2 years to apply for the final plat and final PUD development plan. Peachtree Partners did not buy the property, but a different developer could still Agenda Item 11a. MEMORANDUM 2 proceed with the approved plan. On December 9, 2016, the applicant submitted a written request to extend the approvals for an additional year. Staff recommended that this request be reviewed by the City Council, but adequate time was not provided to place this on a Council agenda prior to expiration. Staff administratively approved an extension until February 28, 2017 so that this request for extension could be considered at the February 23, 2017 Council meeting. At that meeting, the City Council approved a one year extension. The City Council approved another one year extension at the January 25, 2018 meeting. The applicant was granted another extension at the February 28, 2019 Council meeting. Staff met with the landowner and a potential developer. We expect them to submit another request for extension and a concept plan for review in February 2020. 4. Commercial Door Addition at 7670 Commerce Street (City file 15-010) The City received an application for approval of a building addition, which required a conditional use permit, interim use permit, variance and site plan approval. The project was reviewed at a public hearing at the June 4th Planning Commission meeting and was approved by the City Council on June 25th. The required landscaping will be finalized and constructed after the downtown infrastructure project is completed. The City will release the remaining escrow when the planting is completed. Staff is working with the landowner to complete the outstanding items. 5. 2040 Corcoran Comprehensive Plan (City file 17-001). This year-long process was kicked off with a joint City Council/Commission work session on March 16th followed by three community open houses/events and several commission meetings and Council work sessions. The Parks and Trails Commission reviewed at their March 20th meeting, the Planning Commission held a public hearing on April 5th and on April 26th the City Council approved the 2040 Comprehensive Plan for distribution to adjacent jurisdictions for comment. The adjacent jurisdictions have six months to review and comment and then Corcoran will send to the Metropolitan Council to review for compliance with regional systems. The final draft was approved at the March 14th meeting and submitted to the Metropolitan Council. Staff received an incomplete letter from the Metropolitan Council and met with staff and representatives to resolve the outstanding issues. The Metropolitan Council reviewed and found the plan to be consistent with regional systems on November 13th. The City Council adopted the 2040 Comprehensive Plan on November 25th. 6. Comlink Midwest Site Plan, CUP, Variance and Rezoning at 23405 CR 10 (City file 19-011). The request is to allow construction of a contractor’s yard in the Rural Commercial (CR) district over 3-5 years. Phase 1 is for the 20,000 square foot Utility Construction building. This item was reviewed at a public hearing at the July 9th Planning Commission and Council approved on July 25th meeting. The approval included changes to the building architecture were approved by the Council at the August 22nd meeting. 7. Bellwether 3rd Addition Final Plat and Easement Vacation (City File 19-017). This final plat is for 29 lots north of the new Stieg Road. The PUD final plat for this area we approved as part of city file 19-002, but this plat approval was deferred until the Stieg Road alignment is completed. The application was approved by the City Council September 26th. 8. Wessel Property Transportation Plan for 22020 Hackamore Road (PID 35-119-23-43-0001, 35- 119-23-44-0001, 35-119-23-11-0001 and 35-119-23-12-0002) (City File 19-018). The applicant has requested Council review of the transportation plan for this site as the 2040 Comprehensive Plan shows a collector street through the site. This item was reviewed by Council at the August 22nd meeting. 9. Wessel Property PUD Sketch Plan and EAW for 22020 Hackamore Road (PID 35-119-23-43-0001, 35-119-23-44-0001, 35-119-23-11-0001 and 35-119-23-12-0002) (City File 19-018). The sketch plan was reviewed by the Council on September 26th and staff was directed to begin the Environmental Assessment Worksheet. The EAW is expected to be available for Council action in January 2020. 10. Rolling Hills Acres Final Plat at 6730 Rolling Hills Road (City file 19-020). This four-lot subdivision was approved at the October 24th City Council meeting. 11. Savoie Minor Subdivision at21801 Homestead Trail (City file 19-021). This two-lot subdivision is was approved by the Council on October 24th. The council had previously approved this subdivision, but the applicant let it expire and is again requesting approval under the current ordinance standards. City of Corcoran 2020 City Council Schedule Agenda Item 12. February 10, 2020 – Strategic Planning Works Session – 4:00 pm February 13, 2020 Work Session – 5:00 pm • Financial Management Plan February 13, 2020 • City Council Oath of Office • Watershed Update – Kirsten Barta • Stieg Road Turn Lanes – Award Bid • Squad Camera and Body Camera Project • Water Treatment/Well Property Acquisition • Special Elections Ordinance • Cropland Rental Bid Process February 27, 2020 • Active Corcoran Planning Applications • Parks and Trails Commission Appointments • Planning Commission Appointments • Preliminary Plat Extension Request • Preliminary Design Quotes – Hackamore Road Improvement Project • COPS grant March 12, 2020 Work Session – 5:30 pm • Police Department update March 12, 2020 • 2020-2021 Capital Improvement Plan • 2020 Fee Schedule Amendments o Water/sewer TLAC • Planning Commission annual report and 2020 priorities • Parks and Trails Commission annual report and 2020 priorities March 26, 2020 • Active Corcoran Planning Applications April 6, 2020 • Employee Recognition – Pat Meister, 30 Years • Fire Subcommittee Report Work Plan