Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
2021-06-10 Council Agenda Packet
Corcoran City Council Agenda June 10, 2021 - 7:00pm g.Resolution 2021-56 Accepting NW Area Jaycees Donation 1.Call to Order / Roll Call 2.Pledge of Allegiance 3.Agenda Approval 4.Commission Representatives* 5.Open Forum – Public Comment Opportunity 6.Presentations/Recognitions a.Hennepin County Sheriff Hutchinson b.2020 Audit – Andy Berg, Abdo Eick & Meyers* 7.Consent Agenda a.Draft Minutes of May 13, 2021 Council Meeting* b.Draft Minutes of May 27, 2021 Council Meeting* c.Financial Claims* d.Police Donation – Car Seats* e.Charitable Gambling License – St. Thomas Church* f.Charitable Gambling License -- Pheasant Acres* 8.Planning Business a.Building Rights Appeal for Outlot A of Outcalt 2nd Addition* b.Interim Ordinance Establishing a Development Moratorium* 9.Unfinished Business – Public Comment Opportunity a.Finance Software Request for Proposal Review* b.Water Supply Workplan – Supplemental Information* 10.New Business – Public Comment Opportunity a.Public Hearing – 2021 Dust Control Program* b.Improvement Hearing – Corcoran Trail East/West Improvements Project* c.Mandatory Connection Extension Requests* d.Liquor License Renewal Fees* e.2022 Budget Priorities* f.Code Enforcement Discussion* g.Future Work Session Schedule* 11.Staff Reports a.Pandemic Response Update 12.2021 City Council Schedule* 13.Adjournment *Includes Materials - Materials relating to these agenda items can be found in the House Agenda Packet book located by the entrance. The complete Council Agenda Packet is available electronically on the City website at www.corcoranmn.gov. Due to the COVID-19 health pandemic, the City Council’s regular meeting place is not available and is not open to the public. Pursuant to Minnesota Statute 13D.021 the one or more members of the City Council may participate by telephone or other electronic means. Meeting Held Via Telephone/Other Electronic Means Call-in Instructions Call: +1 312 626 6799 US Enter Meeting ID: 845 8382 0455 Press *9 to speak during the Public Comment Sections in the meeting. Video Link and Instructions: https://us02web.zoom.us/j/84583820455 visit http://www.zoom.us and enter Meeting ID: 845 8382 0455 Participants can utilize the Raise Hand function to be recognized to speak during the Public Comment sections in the meeting. Participant video feeds will be muted. For more information on options to provide public comment visit: www.corcoranmn.gov The City of Corcoran will provide high-quality public services in a cost-effective, responsible, and professional manner in order to create a preferred environment to live, work, play, and conduct business. The City of Corcoran will become a vibrant, connected community while preserving its natural character and agricultural roots. The following values are fundamental to the City of Corcoran ’s success and the fulfillment of our mission: Honesty, Ethics, Integrity We believe that honesty, ethics, and integrity are the foundation blocks of public trust and confidence. Community Pride and Partnership We believe in creating a strong sense of community through partnerships with civic organizations, school districts, and local businesses. Efficient and Effective Service Delivery We believe providing services to residents and businesses in an efficient and effective manner makes government easier to work with and creates a business friendly environment. Community Safety We will protect the community by maintaining or improving safety through police and fire protection and by investing and maintaining the infrastructure of the City. Fiscal Responsibility We believe that the prudent stewardship and opportunistic investment of public funds is essential for confidence in government and to position the City for future success. Transparency We believe that open, honest, and proactive communication is essential for an informed and involved citizenry. Processes and decision making should include opportunities to educate citizens and receive feedback. Responsible Decision Making We believe it is the responsibility of the City to address difficult issues now in order to avoid larger more difficult issues in the future. VISION VALUES CORE STRATEGIES MISSION • Enhance Corcoran’s sense of place and identity. • Provide diverse community amenities and recreational opportunities. • Maintain excellence in safety and security for our community. • Ensure high-quality, market-driven growth. • Provide high-quality, innovative municipal services. A DOPTED M ARCH 11, 2021 STAFF REPORT Agenda Item 4. Council Meeting: June 10, 2021 Prepared By: Brad Martens Topic: Commission Representatives Action Required: None – Informational Summary: The advisory commission representatives for the June 10th Council meeting are as follows: • Planning Commission: Dean Jacobs • Parks and Trails Commission: Phil Christenson Financial/Budget: N/A Council Action: N/A Attachments: N/A STAFF REPORT Agenda Item 6b. Council Meeting: June 10, 2021 Prepared By: Jessica Beise Topic: Audit Action Required: Approval Summary: Due to the length of the documents related to the audit, copies of the Annual Financial Report are available on the City’s website at www.corcoranmn.gov under Our Government > Council > Agenda Packets 2021 > 2021-06-10 Council Agenda Packet. A hard copy of the materials is available for review at City Hall during normal business hours. Agenda Packets 2021: https://www.corcoranmn.gov/cms/One.aspx?portalId=15543764&pageId=15557281 CITY OF CORCORAN City Council Meeting Minutes May 13, 2021 - 7:00 pm The Corcoran City Council met on May 13, 2021, in Corcoran, Minnesota. Pursuant to Minnesota Statute Section 13D.021 and due to the COVID-19 pandemic, the City Council meeting was held remotely through electronic means using the audio and video conferencing platform Zoom. Mayor McKee was present at City Hall. Councilor Bottema, Councilor Nichols, Councilor Schultz, and Councilor Thomas were present via telephonic or other electronic means. City Administrator Martens and Administrative Services Director Beise were present at City Hall. Public Works Director Mattson, Director of Public Safety Gottschalk, and City Planner Lindahl were present via telephonic or other electronic means. 1.Call to Order/Roll Call Mayor McKee called the meeting to order at 7:00 pm. 2.Pledge of Allegiance Mayor McKee invited all in attendance to rise and join in the Pledge of Allegiance. 3.Agenda Approval City Administrator Martens reviewed the Open Forum comment opportunity for items not on the agenda and noted the other public comment opportunities throughout the agenda. City Administrator Martens noted moving the Public Hearing first for item 10a. under New Business, with public comment opportunity for New Business immediately following the Public Hearing. City Administrator noted the addition of a claim for $630, payable to the MN Bureau of Criminal Apprehension under item 7a., for background checks for baseball. City Administrator Martens noted removal of item 11a. Closed Session from Easement Agreement for 66th Avenue/Gleason Parkway Corridor Improvements. MOTION: made by Nichols, seconded by Thomas to approve the agenda as modified. Voting Aye by Roll Call Vote: McKee, Nichols, Schultz, and Thomas Abstain: Bottema (Motion carried 4:0:1) 4.Commission Representatives Mayor McKee noted Planning Commissioner Vehrenkamp and Parks and Trails Commissioner Dugan were present via telephonic or other electronic means. Mayor McKee invited Commissioner Vehrenkamp and Commissioner Dugan to speak on relevant agenda items. 5.Open Forum (Public Comment Opportunity) Mayor McKee invited residents to communicate telephonically during the Open Forum discussion for items not included on the agenda. Administrative Services Director Beise explained the instructions to participate in the meeting via the Zoom video format and reviewed instructions for participation in the meeting. No residents participated in the Open Forum. 6.Presentations/Recognitions No presentations or recognitions were heard. 7.Consent Agenda a.Financial Claims b.Waiver Request for Amplified Sound – Corcoran Lions Summer Events c.Waiver Request for Amplified Sound – Hamel Rodeo d.Temporary Liquor License – Hamel Rodeo e.Temporary Liquor License – Corcoran Lions f.Cropland Rental Agreement, Amendment to Land Purchase Agreement – 8200 County Road 116 g.Rear Setback Variance at 6433 Bluestem Circle Agenda Item 7a. 2 h. CSAH 101 and Stieg Road Turn Lanes – Pay Request 3 and Final i. Job Description Update – Administrative Services Director j. City Hall Remodel – Pay Request #6, Change Order #5 Council requested items 7g., be pulled further discussion. MOTION: made by Schultz, seconded by Thomas to approve the consent agendas 7a-f and 7h-j. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) Council reviewed item 7g. Rear Setback Variance at 6433 Bluestem Circle and previous Council discussions pertaining to variance requirements and standards, practical difficulties in compliance, unique factors of the parcel, essential character, general purpose and intent, and consistency with the 2040 Comprehensive Plan. Council reviewed staff verbiage on Resolution 2021-31, the purpose of the revised verbiage, and noted Council vote was completed at the April 22, 2021 meeting. Council and staff discussed changing or altering resolution findings from that language proposed in the packet. Council discussed further review of altered resolution findings and schedule the Resolution 2021-31 discussion to a later Council meeting. Council discussed the alteration of Resolution 2021-31 was to clarify the reasons Council voted in favor of applicant’s response to meeting variance crit eria as reflected in the new verbiage supplied by Council. Council noted current discussion on the consent agenda item Resolution 2021-31 will approve the amended findings of fact language, and not alter previous Council motion or vote regarding the variance included at the April 22 meeting. Council discussed setting precedence of explaining Council vote, and noted additional verbiage adds to future confusion of what a variance encompasses. MOTION: made by Schultz, seconded by Bottema to approve Resolution 2021-31 Approving a Variance for the Property Located at 6433 Bluestem Circle (PID 36-119-23-42-0032) (City File 21- 010). Voting Aye by Roll Call Vote: McKee, Bottema Nay: Schultz, Thomas Abstain: Nichols (Motion failed 2:2:1) MOTION: made by Thomas, seconded by Nichols to approve Resolution 2021-31 Approving a Variance for the Property Located at 6433 Bluestem Circle (PID 36-119-23-42-0032) (City File 21-010) with the following language for section 2: The City Council finds that the variance standards have been met, based on the following findings: a. There are practical difficulties in complying with the Zoning Ordinance due to the shape of the lot and the location of the home on the lot leaving an unreasonable small 2’ of clearance to the building setback line, too small to permit a deck to be built at the elevated door on the rear of the home . b. That the plight of the requestor is based on factors unique to the parcel of land for which the variance is sought due to the wedge shape of the lot and the placement of the home on the lot. c. That the granting of the variation will not alter the essential character of the locality because of the particular location of the lot adjacent to a stormwater pond behind the proposed structure. This pond area provides additional buffer space between homes that reduces the impact of the structure on sightlines. It also maintains a low effective density of structures in the ar ea, commensurate with the zoning requirements and conditions of the local area. d. The proposed variance would be in harmony with the general purposes and intent of the Ordinance, which allows residential uses. e. The variance is consistent with the Comprehensive Plan, which anticipates residential uses on this parcel. Voting Aye by Roll Call Vote: McKee, Nichols, Thomas Nay: Bottema, Schultz (Motion carried 3:2) 8. Planning Business (Public Comment Opportunity) Mayor McKee invited residents to communicate telephonically during the public comment opportunity for Planning Business items included on the agenda. Administrative Services Director Beise explained the instructions to participate in the meeting via the Zoom video format and reviewed instructions for participation in the meeting. 3 Greg Hoglund, 19220 Hackamore Road, opined on Conditional Use Permits (CUPs) and the history of the proposed location for Eagle Brook Church, noted churches in general and places of assembly regarding the CUP use in zoning districts, and opined on the approval of future homes on the south side of Corcoran. Mr. Hoglund noted the need for churches and schools as community grows, and the legality of church locations. Mr. Hoglund addressed concerns on development processes, purchase agreements, and the disregard of neighboring properties of the Ravinia neighborhood. Mr. Hoglund noted concerns on item 8a., and opined on time limits regarding public comments. Katherine Drivas, 6747 Old Sturbridge Drive, commented on potential difficulties for two of the five school districts that may build a school in Corcoran. Ms. Drivas discussed history of limited infrastructure at the time the Rockford elementary school was going to be built, opined regarding the recent surge of homes being built within the school district boundaries and the need for infrastructure. Mr. Drivas noted concern that a CUP change would impact school districts, forcing schools to build in industrial areas. Council noted the 5-minute public comment limit adopted procedure and remarked other cities also have time limits for public comment periods. Council noted time can always be extended to residents participating in public comment opportunities at the Council’s discretion. a. Conditional Uses in Zoning Districts City Administrator Martens outlined Council request to discuss conditional uses in zoning districts, with any changes requiring a public hearing. City Administrator Martens noted implications to proposed conditional uses in zoning district changes would require research costs, noting the City is at 60 percent of its projected planning budget for the year. City Administrator Martens noted research completion and staff report would be contracted out to Landform for the Planning Commission and Council review. Council reviewed the current ordinance of conditional use permits allowed in low- density, residentially zoned districts. Council reviewed the current ordinance in place allows schools and places of worship to be placed within residentially zoned districts, noted the recent Council work sessions prioritized zoning review as a high priority and outlined the current zoning review projects. Council discussed two zoning ordinance changes, removing schools and places of worship from lower density residential areas RSF-1, RSF-2, RSF-3, and RMF-1; and only allowing schools and places of worship in higher density residential areas RMF-2 and RMF-3, industrially zoned areas, and the C-2 commercially zoned area. Council noted the proposed zoning changes remove a significant portion of the MUSA area, noted a proposal could allow industrial land used for schools, and places of worship. Council discussed changes to zoning could include limiting scope of facilities from lower-density residential areas and debated the legality of zoning changes. Council discussed the proposed changes eliminate larger facilities from low-density residential areas and eliminate concerns within City regarding larger facilities in low-density residential areas. Council discussed a previous proposal for an assembly facility. Council discussed if the proposed ordinance had been in place, many churches in Corcoran today would not exist. Council noted industrial zoned districts are zoned specifically for businesses that create jobs with tax revenue to relieve citizens of burden of residential tax impacts. Council and staff discussed how much land would be left available if an ordinance restriction from residentially low-density zoned areas existed versus current residentially zoned land and industrial zoned locations. Council discussed performance changes versus restrictions from the City Council. Council noted resident public comment and personal motivations regarding zoning changes. Council discussed needing additional conversation on this topic before proceeding. Council discussed the ideas of CUPs and determining if application presented for a proposed area can sustain, does the business have a right to be there, and could include places of worship or schools. Council discussed having the right to approve or reject an application and not be constrained by CUPs in determining what is best for the area in the City. Council reviewed aspects of proposed CUPs and rejection of an entity from a location and noted the fears that arise from potential impacts from proposed projects within the City. Council noted there were specific criteria referenced to reject a previous application, none of which included rezoning aspects, and noting the CUP process worked as specific reasons were identified to support the Council denial. Council discussed rights of the landowner in selling the land in limiting uses. Council discussed rezoning and the legal implications of places of worship. 4 Council discussed where an appropriate location would be within the City for schools and places of worship. Council discussed the difficulty of proposing ordinance changes and having time for the Council to review proposals as councilmembers cannot discuss business outside an open meeting. Council requested moving discussion to the next Council meeting to allow Council time to review the changes in proposed zoning districts. Council discussed the last two schools built by Wayzata Public Schools were built near, and at about the same time as single-family homes were being constructed in the area, noting the schools were approved for construction prior to the housing development construction. Council noted involving public comment through a public hearing regarding future zoning districts for schools and places of worship. City Administrator Martens reviewed the process of scheduling a public hearing, implications to staff workload over the next week by moving the zoning district ordinance for immediate review. Dean Vehrenkamp, Planning Commissioner, commented on his history on the Maple Grove Planning Commission, and now with the City of Corcoran, noting in Maple Grove planning, an area was pre-designated as school zoning, so potential buyers would know the development was near a planned school facility. Commissioner Vehrenkamp briefly reviewed the Eagle Brook Church application history. Commissioner Vehrenkamp opined on the restraining impacts of the proposed zoning and CUP changes ultimately causing more confusion and issues in the future. Commissioner Vehrenkamp commented on zoning location requirements limiting creativity and development within the City. MOTION: made by Nichols, seconded by Thomas approving the Public Hearing for Zoning Districts and Conditional Use Permits at the June 3, 2021, Planning Commission meeting. Council deliberated the information presented at the meeting and discussed further review of the proposed changes as necessary at a future Council meeting. Council questioned the necessity in moving to a public hearing immediately, prior to full Council discussion, noting the requirement to have the city attorney complete a legal review, and allowing staff time to compose verbiage for the new ordinance. Council discussed moving forward with ordinance changes. City Administrator Martens noted staff has not been directed by Council to complete any zoning ordinance related changes. Council discussed further review relating to the proposed zoning changes, the public hearing, and allowing time for further Council discussion. Voting Aye by Roll Call Vote: Thomas Nay: McKee, Bottema, Nichols, and Schultz (Motion fails 1:4) Council directed staff to continue Council zoning discussion to a future meeting with the City Attorney Thames in attendance. Council noted mask mandates and distancing requirements end on May 28. City Administrator Martens noted the Council Chambers may be available for the June 10 Council meeting. Council consensus indicated continuation of the discussion to the May 27 Council meeting. 9. Unfinished Business (Public Comment Opportunity) Mayor McKee invited residents to communicate telephonically during the public comment opportunity for Unfinished Business items included on the agenda. Administrative Services Director Beise explained the instructions to participate in the meeting via the Zoom video format and reviewed instructions for participation in the meeting. No residents participated in the public comment opportunity. a. Corcoran Trail East/West Feasibility Study Public Works Director Mattson presented Corcoran Trail Street Improvements project, the history of the feasibility study and small stormwater evaluation and noted the virtual neighborhood meeting held with comments received on April 21. Public Works Director Mattson reviewed the existing gravel roads areas and paved roads sections from the 1980’s, with recommendation of a full-depth reclamation with new gravel pavement on top. Public Works Director Mattson explained yearly budgeting includes one free overlay for neighborhoods per the assessment policy when applicable, and noted where a free overlay does not apply. Public Works Director Mattson reviewed Alternate 1 and Alternate 2. Public Works Director Mattson noted the assessed free overlay value benefit, as requested by Council direction, is 90 percent of the mid-range appraised value and equates to an $1,800 credit. Public Works Director Mattson reviewed the Alternate 2 amended report corrects the error of benefit credit applied to the gravel property and applies the benefit credit correctly to the paved properties. Public 5 Works Director Mattson explained the two alternate street improvement estimated costs and assessments for discussion, noting local and special assessments with a total project cost of $534,528.80. Public Works Director Mattson reviewed the stormwater improvement alternatives and estimated costs noting existing issues over the history of Corcoran Trail East and West. Public Works Director Mattson reviewed the project schedule. Public Works Director Mattson reviewed funding for the stormwater improvements could include a combination of special assessments and local participation. Council confirmed the $1,800 overlay in Alternate 2 Assessment Roll reflects a credit to paved roads. Public Works Director Mattson noted the credit is reflected in the Special Assessments cost of $176,400.00. Council clarified the overlay credit for the project was written into assessment code policy for older neighborhoods in Corcoran, and benefit credit is not subject to future overlays within the neighborhood or other paved or future paved roads in Corcoran. MOTION: made by Schultz, seconded by Thomas to accept the Corcoran Trail Street Improvement Feasibility Study and order the Improvement Hearing by Resolution 2021-41 Receiving the Feasibility Report and Calling a Public Hearing on Improvement for the Corcoran Trail East/West Improvements Project. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) 10. New Business (Public Comment Opportunity) a. Improvement Hearing – Appaloosa Woods Street Improvement Project City Administrator Martens outlined the Appaloosa Woods Street Improvement Project noting the Corcoran section of the project. City Administrator Martens reviewed the history of the project with Maple Grove dating back to 2019 through current action of Maple Grove opening bids in early May. City Administrator Martens noted letters were mailed to residents on April 30. City Administrator Martens reviewed the scope of the project includes reconditioning existing pavement and improving the remainder from gravel to bituminous, the proposed assessment cost for properties accessing existing gravel to new pavement of $13,500, and properties accessing existing pavement to new pavement cost of $7,200. City Administrator Martens noted a term of 10 years with 1 percent over the borrowing interest cost for the project, or bond issue interest, which is currently 1.83 percent. City Administrator Martens reviewed anticipated projects costs of $185,798 estimated in the feasibility study, with an updated estimate at $157,623, indicating the project cost may res ult in lower assessments to properties. Mayor McKee opened the Public Hearing for item 10a. Administrative Services Director Beise explained the instructions to participate in the Public Hearing via the Zoom video format and reviewed instructions for participation through telephone or computer. Paige Peterson, 19140 84th Place North, asked if the benefit credit on the Corcoran Trail East/West Project and asked if the credit would apply with reconstruction of Appaloosa paving reconstruction. City Administrator Martens confirmed the benefit credit would not apply to this repaving project. MOTION: made by Nichols, seconded by McKee to close Public Hearing. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) Council and staff discussed possible estimate of cost savings of $30,000 in assessments. City Administrator Martens noted a report would be brought back to Council once savings are realized and prior to assessment hearing. Council noted the combined project savings for the two cities as an opportune time to improve the road. Council noted priority of realizing road improvement costs relating to specific properties and roads, and the continued gravel road and paving challenges in Corcoran. Dave McStott, 8040 Ridge Court, commented on assessment amount and if assessment will include new asphalt in front of his driveway to end of cul de sac where it is public road. City Administrator Martens indicated that portion is not included in the project and only the public portion that extends to the right of the way is included, as it benefits the properties accessing the street . Mr. McStott opined a private easement exists and believes it is a public right of way in the cul de sac area and questioned why asphalt is not being laid in front of his property. Mayor McKee noted this situation could be brought forth at the assessment hearing. Mr. McStott asked when the hearing would be. City 6 Administrator Martens clarified the property questioned is not city-owned property or land where the private drive is located. City Administrator Martens noted the improvement hearing allows the project to move forward, and the assessment hearing would provide an opportunity for property owners to appeal the assessment. Mr. McStott asked again when the hearing would be. Mayor McKee indicated the meeting has not been established yet but will be publicly noticed in the paper and the City will keep residents informed as the assessment hearing is scheduled. City Administrator Martens and Mayor McKee encouraged property owners to contact City Administrator Martens and Council regarding additional discussion pertaining to the project. Shelby Burgess, 19360 81st Place North, inquired about the benefit of a paved road to property owners and how the amount is determined. Mayor McKee encouraged the participant to contact City Administrator Martens for specific information regarding methodology in benefit determinations. MOTION: made by Schultz, seconded by Thomas to approve Resolution 2021-42 Ordering Improvement of the Appaloosa Woods Street Improvement Project, and authorizing the mayor and city administrator to execute joint powers agreement. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) Mayor McKee opened the public comment opportunity for items 10b-h. Administrative Services Director Beise explained the instructions to participate in the public comment opportunity via the Zoom video format and reviewed instructions for participation through telephone or computer. No residents participated in the public comment opportunity. b. 2020 Budget Transfers City Administrator Martens noted the 2020 audit is near completion and outlined the 2020 budget transfer opportunities. City Administrator Martens reviewed the items relating to the expenses included Federal CARES funding for COVID, an asphalt project expense not completed, absence of a planner position and maintenance work position for 6 months and an entire year respectively, and vacancies in police officer positions for several months. City Administrator Martens reviewed allocation recommendations. Additionally, City Administrator Martens reviewed the 2016 Downtown Utility and Street Improvement Fund balance of $491,922, noting Wenck and Public Works Director Mattson’s efficient management of the project allowing for the fund balance, and recommended transferring the fund balance to the Asphalt Fund for future street projects. Council noted the difference in tax revenue exceeding expenses and the thoroughness by City Administrator Martens explaining the reason for the differences and anomalies in expenses in 2020, specifically noting overall tax revenue growth in the City. MOTION: made by Nichols, seconded by McKee to approve Resolution 2021-43 Authorizing 2020 Interfund Budget Transfers as presented. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) c. Bridge Replacements – Accept Feasibility Study and Authorize Plans and Specifications Public Works Director Mattson reviewed the Council authorization for a bridge replacement feasibility study noting the bridge crossings were considered critical infrastructure to the city’s transportation and stormwater drainage systems. Public Works Director Mattson noted Hennepin County monitors the bridges annually for rating considerations. Public Works Director Mattson reviewed the bridge replacement amounts for Trail Haven Road and Schutte road are $35,000 and $30,000 respectively , and noted bridge replacement locations. Public Works Director Mattson reviewed existing and proposed culverts, future maintenance, flow rates, flood elevation, and estimated replacement costs. Council asked for clarification of flow rates. City Engineer Torve explained engineering analysis of the flood model. Public Works Director Mattson further explained the analysis of equalizing conveyanc e of the water through the various cross section locations. City Engineer Torve noted priority of FEMA and watershed regulations, noting is not specific to just engineering review. Council and staff discussed further analysis to be completed regarding existing water flow and future water flow within the bridges. Public Works Director Mattson noted project funding avenues of state bonding programs, municipal state aid system, and fronting initial cost through local participation. Public Works Director Mattson 7 noted tracking expenses from Asphalt Fund initially and prior to setup of a Bridge Replacement Improvement Project Fund. Public Works Director Mattson noted Trail Haven Road and Schutte Road were selected for repairs as both bridges are currently in need of replacement, and both are within, and qualify for funding in the state aid system. Council asked for clarification of fronted costs of the bridges. Public Works Director Mattson reviewed the grant system process , noting qualification for the grant includes action by the City to be shovel-ready and includes upfront costs for a feasibility study and engineering design prior to selection and allocation of eligible grants. Public Works Director Mattson outlined upon award of project, upfront costs would be reimbursed and allocated to City accordingly. MOTION: made by Schultz, seconded by Thomas to accept the Bridge Replacements Feasibility Study, approve Resolution 2021-44 Authorizing Plans and Specifications for Trail Haven Road and Schutte Road Bridge Replacements in the amount of $65,000. Council discussed Trail Haven Bridge and the collapse of bridge and the impacts to commuters on the road. Councilmember Bottema noted he lives on Trail Haven Road and will abstain from voting. Council noted the bridge replacement is due to safety. Voting Aye by Roll Call Vote: McKee, Nichols, Schultz, and Thomas Abstain: Bottema (Motion carried 4:0:1) d. Recreational Vehicle Ordinance Update Director of Public Safety Gottschalk outlined the existing code chapters 72 and 73 pertaining to recreational vehicle use and includes snowmobile and off-road vehicle regulations would be deleted and replaced with Chapter 72 Recreational Vehicles. Director of Public Works Gottschalk reviewed past history of the ordinance noting recent Council direction in 2020 to review ordinance for consistency with current statutes and to update the ordinance with feedback from councilmembers. Director of Public Gottschalk reviewed the changes between the ordinances including the new recreational vehicle definitions, new state language, and classifications for vehicles. Director of Public Safety Gottschalk noted the draft ordinance provides guidance on the operation of golf carts within the City, and further defines semi-public property as private property generally open for use by the public but not owned or maintained by the City. Director of Public Safety Gottschalk addressed the existence of Established Riding Areas for all recreational vehicles. Director of Public Safety Gottschalk reviewed prohibiting operation on sidewalks and trails that stipulate recreational vehicles may not operate with a greater number of passengers than the vehicle is designed to carry and use of recreational vehicles on any single property shall not exceed four hours in any 24-hour period, with an exemption for vehicles engaged in property maintenance or agricultural purposes. Director of Public Safety Gottschalk noted maintaining a balance for residents wishing to use ATV’s and for residents not wanting the extra noise ATV’s create. Director of Public Safety Gottschalk reviewed a change within parcels less than two acres in size requires written consent from the property owners in all occupied residences within 250’ radius of all property lines. Director of Public Safety Gottschalk noted exceptions to the ordinance were added for restricted areas to allow loading and unloading of snowmobiles in parking lots, operation clarification on designated trails, operation hours of recreational vehicles inside and outside of the MUSA areas, and where recreational vehicles are allowed including written permission on private property and public roadways. Director of Public Works Gottschalk reviewed recreational vehicle permit requirements for on-road use on City roads, length of permit, waiver and approvals, revocation and the appeals process. Council and staff discussed the appeal process to Council as it is a permit and not applicable to the courts. Director of Public Safety Gottschalk reviewed the proposed violation penalties. Council discussed updates to the recreational vehicle ordinance i n Corcoran and noted confirmation of specific snowmobile dates. Council and staff discussed enforcement issue regarding the 4-hour usage update, noise issues such as altered mufflers on recreational vehicles, and goals set forth by implementing the update ordinance regarding recreational vehicles. Council noted resident ability to cross over County Roads and Highways to get to a City roadway, and semi-private roads such as trails accessing a public parking area of a business. Council and staff discussed fee str ucture for recreational vehicles at the City level and how fees are established, noted fees are intended to cover costs only and not intended to produce revenue for the City. Council provided staff direction in 8 implementing updates to ordinance and requested aligning dates to mirror state guidelines in property access permission from April 1 to November 30, and December 1 to March 31. e. Employee Handbook Update Administrative Services Director Beise presented changes to the Employee Handbook noting the last update in 2017. Administrative Services Director Beise reviewed the changes align with current practices regarding the pandemic, language for the health and safety plan pertaining to the pandemic, extended leave check-ins during the pandemic, and reflect organizational changes implemented. Council noted removal of Wings Credit Union. Staff noted an additional change to allow Director of Public Safety Gottschalk authority to post media releases. MOTION: made by Nichols, seconded by Schultz to adopt the revised Corcoran Employee Handbook effective May 14, 2021, as amended. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) f. Charter Commission Application City Administrator Martens noted an additional Charter Commission application and requested direction from Council on process for Charter Commission applications. Council and staff discussed commissioners and allowing the current process to proceed with the appointed 7 members, and retaining future Charter Commission applications for future commission openings within the City. Council encouraged residents to apply for commissions. Council noted a request from staff for a brief update monthly for commission applications received. g. Recycling Contract RFP Administrative Services Director Beise reviewed the recycling service contract expiration in December 2021, reviewed the options to renew with Randy’s or go out for RFP, and reviewed Hennepin County’s Organic Recycling requirement within residential recycling services. Administrative Services Director Beise noted organics is usually picked up with garbage pickup schedules and noted the City could see some savings by utilizing a single hauler with organics, recycling, and garbage hauling. Council discussed review of utilizing a single hauler option. Council reviewed not limiting resident choices on garbage hauling. Administrative Services Director Beise clarified requirements could be specific to hauling on specific days, and licensed within the City, and not limiting resident choice in garbage hauling. City Administrator Martens noted with complaints from residents, the licensing could require a representative for residents to contact in the case of service issues. Council discussed going out for an RFP and licensing. Council noted impacts to companies with restrictions on garbage or recycling pick-up dates. Council noted surveying smaller haulers and not just national haulers. Council discussed RFP and if it is manageable for staff to proceed with an RFP for organics, recycling, and garbage hauler licensing. MOTION: made by Thomas, seconded by Schultz to seek an RFP for organics, recycling, garbage hauling, and options for garbage hauler licensing. Council asked if items could be separated. Councilmember Thomas and Schultz retracted first and second Motion respectively. MOTION: made by Thomas, seconded by Schultz to seek an RFP for garbage hauling, organic recycling, and paper recycling services. Council noted impact to staff resources and time in managing an RFP. Administrative Services Director Beise indicated the last RFP for garbage hauling was in 2015 and will be a starting point in managing an RFP review in 2021. Voting Aye by Roll Call Vote: McKee, Schultz, and Thomas Nay: Bottema, Nichols (Motion carried 3:2) MOTION: made by Thomas, seconded by Schultz to review licensing options for garbage hauling services. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) h. Embedded Social Worker 9 Director of Public Safety Gottschalk reviewed the embedded social services component within police departments, and services provided through Hennepin County, and the potential for a combined embedded social worker position. Director of Public Safety Director Gottschalk noted the position would be shared with seven surrounding cities along with Hennepin County and noted quality of life improvement for community receiving help needed and reduced reliance on police response. Director of Public Safety Gottschalk noted the position would be a Hennepin County employee but would be serving the seven communities. Within the proposal, Director of Public Safety Gottschalk noted Hennepin County’s program would pay for 40 percent of position and technology associated with the position, and the participating communities would split the remaining costs. Director of Public Safety Gottschalk noted a commitment of two years for the program. Council inquired on program. Director of Public Safety Gottschalk responded with an explanation of the types of programs and includ e co- responder or embedded social worker models. Director of Public Safety Gottschalk noted co- responder goes on calls for services in community, and embedded social worker receives the information after incident and follows up with the person needing to receive services within the community. Director of Public Safety Gottschalk reviewed cost differences of the two positions, an d noted the co-responder model is more complex, difficult to manage and carries more expense than the social worker embedded model, and added the co-responder model is not practical to split between agencies. Director of Public Safety Gottschalk outlined the scope of the embedded social worker position, indicating the position would office out of Corcoran one day a week to ensure the connection with officers, meet with residents from a referral from an officer, and follow up with community members as necessary for services. Council and staff discussed mental health training with officers and responses to mental health situations. Council noted the recent police department second safest city award, and the embedded social worker position as benefit to residents through tax dollars. Council discussed partnering with seven cities and Hennepin County and pursuing the position independently as a City, and noting this is a first step for the City in setting up the groundwork for future opportunities and services for residents. MOTION: made by Thomas, seconded by Nichols to approve and direct staff to enter into a contract on the embedded social worker position with a cost of $8,600 to $12,100 per year, dependent upon on agency participation, with a 2-year participation commitment to the Hennepin County supported program. Council clarified if the cost exceeds $12,100, staff will bring back to Council for additional review. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) 11. Closed Session a. Easement Agreement for 66th Avenue/Gleason Parkway Corridor Improvements; removed from agenda. 12. Staff Reports a. Financial Performance Update; council received report. b. Pandemic Response Update Director of Public Safety Gottschalk noted the State continues to move forward with vaccinations , noting the recent announcement by Governor Walz to remove some restrictions for individuals who are fully vaccinated, and excitement overall but still approaching the pandemic with caution. 13. 2021 City Council Schedule City Administrator Martens noted item the closed session item will be scheduled for a future meeting. Councilmember Bottema noted his absence at the June 10 Council meeting. Counc il noted the authorization during the pandemic, and with restrictions tapering off, will staff and Council need to review what may be needed for staff to continue with operations. City Administrator Martens noted the City’s emergency order is parallel to the Governor’s order, and the existing emergency order expires with the Governor’s order. Council and staff discussed implementing a sunset policy on emergency orders that differs from the State mandate. Director of Public Safety Gottschalk noted the City’s ability to react and flexibility regarding emergency orders to make sure our City has the flexibility to respond appropriately. 10 14. Adjournment MOTION: made by Schultz, seconded by Thomas to adjourn. Voting Aye by Roll Call Vote: McKee, Bottema, Nichols, Schultz, and Thomas (Motion carried 5:0) Meeting adjourned at 11:03 pm. ________________________________ Michelle Friedrich – Deputy Clerk CITY OF CORCORAN City Council Meeting Minutes May 27, 2021 - 7:00 pm The Corcoran City Council met on May 27, 2021, in Corcoran, Minnesota. Pursuant to Minnesota Statute Section 13D.021 and due to the COVID-19 pandemic, the City Council meeting was held remotely through electronic means using the audio and video conferencing platform Zoom. Mayor McKee was present at City Hall. Councilor Bottema, Councilor Schultz, and Councilor Thomas were present via telephonic or other electronic means. Councilor Nichols was excused. City Administrator Martens was present at City Hall. Administrative Services Director Beise, Public Works Director Mattson, Director of Public Safety Gottschalk, and City Planner Lindahl were present via telephonic or other electronic means. 1.Call to Order/Roll Call Mayor McKee called the meeting to order at 7:00 pm. 2.Pledge of Allegiance Mayor McKee invited all in attendance to rise and join in the Pledge of Allegiance. 3.Agenda Approval City Administrator Martens reviewed the Open Forum comment opportunity for items not on the agenda and noted the other public comment opportunities throughout the agenda with a five-minute limit per speaker with Council discretion in allowing speakers a longer public comment. City Administrator Martens noted removal of 7d. Draft Minutes May 13, 2021 Council Meeting; and noted 7e. Claims were sent to Council for review after packet delivery. Council commented on processes and times for public comment. MOTION: made by Bottema, seconded by Schultz to approve the agenda as modified. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) 4.Commission Representatives Mayor McKee noted Planning Commissioner Wu and Parks and Trails Commissioner Hoffmann were present via telephonic or other electronic means. Mayor McKee invited Commissioner Wu and Commissioner Hoffmann to speak on relevant agenda items. 5.Open Forum (Public Comment Opportunity) Mayor McKee invited residents to communicate telephonically during the Open Forum discussion for items not included on the agenda. Administrative Services Director Beise explained the instructions to participate in the meeting via the Zoom video format and reviewed instructions for participation in the meeting. No residents participated in the Open Forum. 6.Presentations/Recognitions No presentations or recognitions were heard. 7.Consent Agenda a.Draft Minutes of April 22, 2021 Work Session Council Meeting b.Draft Minutes of April 22, 2021 Council Meeting c.Draft Minutes of May 13, 2021 Work Session Council Meeting d.Draft Minutes of May 13, 2021 Council Meeting e.Financial Claims f.City Hall Remodel – Changer Order #6; Furniture Purchase g.Hennepin County Corridor Planning Application h.Agricultural Preserve Application i.D&D Service Site Plan, Conditional Use Permit and Variance at 23405 County Road 10 Agenda Item 7b. 2 j. Site Plan and Conditional Use Permit for Scherber Demolition and Excavating at 23240 County Road 30 k. Liquor License Renewal l. Easement Agreement m. Employee Resignation; Recruitment Process MOTION: made by Bottema, second by Schultz to approve the consent agenda items 7a-c, 7e-h, and 7j-m. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) Council reviewed item 7i. D&D Service Site Plan, Conditional Use Permit and Variance and requested clarification of the difference between D&D’s site plan approval is different from ComLink’s site plan. City Planner Lindahl noted the most important difference was ComLink’s proposal omitting an office facility, and D&D’s proposal including an office building with attached storage space along with plans for future buildings to be presented to Council in a later phase. City Planner Lindahl explained initial construction of D&D’s site plan includes outside storage on the west side of the proposed office building, and when ComLink’s site plan was presented, the outside storage was submitted for construction first, with the office build ing proposed as a later construction phase. MOTION: made by Schultz, seconded by Thomas to approve item 7i. D&D Service Site Plan, Conditional Use Permit and Variance at 23405 County Road 10. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) 8. Planning Business (Public Comment Opportunity) Mayor McKee invited residents to communicate telephonically during the public comment opportunity for Planning Business items included on the agenda. Administrative Services Director Beise explained the instructions to participate in the meeting via the Zoom video format and reviewed instructions for participation in the meeting. No residents participated in the public comment opportunity. a. NAPA Site Plan, Conditional Use Permit and Variance at 19905 75th Avenue North City Planner Lindahl reviewed the request for a new building by NAPA located at 19905 75 th Avenue North, the CUP is requested for automobile retail sales, and variance is necessary for a parking setback. City Planner Lindahl noted the new NAPA building would also include two retail bays . City Planner Lindahl reviewed the Planning Commission 4-0 vote to recommend approval to Council of the site plan and CUP, but denial of the 16-foot front yard parking setback variance, as the 25-foot parking setback was not met. City Planner Lindahl reviewed the applicant’s revised plans include increasing the building depth from 60 to 80 feet, increasing the building from 15,200 to 16,000 square feet, eliminating the loading dock, and changing to a two-phase plan with only NAPA in phase one, with parking construction completed in phase one. City Planner Lindahl noted applicant made no changes to the 16-foot front parking setback variance request. City Planner Lindahl noted the existing building on the parcel would be demolished. City Planner Lindahl noted the City is excited to see NAPA’s growth and relocation within the City. City Planner Lindahl noted the original submittal request included changes to accommodate the 10-foot drainage and utility easement. City Planner Lindahl outlined the revised plan includes a deeper building with the same 16-foot parking setback. MOTION: made by Bottema, seconded by Thomas to approve item as presented. Voting Aye by Roll Call Vote: Bottema and Thomas Nay: McKee and Schultz Council requested presentation on NAPA site plan be completed by City Planner Lindahl. (Motion Failed 2:2) City Planner Lindahl reviewed aspects of tenant space removal from building, the additional landscaping along County Road 116, and additional landscaping required for reduced building setback flexibility. City Planner Lindahl reviewed changes in eastern access from County Road 116 to alleviate turning movement concerns. City Planner Lindahl noted reducing the building size by 9 feet in depth from 80 feet to 71 feet, would eliminate the variance requirement. Council asked for clarification of parking lot setback, and if setback is from road right-of-way, and located outside of utility easement. 3 City Planner Lindahl clarified the setback is measured from the road right -of-way, and behind road right-of-way is the 10-foot utility easement, noting parking is outside of easement. Council asked for clarification in how variance request differs from parking lot to north where Farmer’s Bank , Corcoran Pet Care, and Corcoran Crossroads are located. City Planner Lindahl noted the compared properties are closer to right-of-way with one located in the right-of-way. MOTION: made by Bottema, seconded by Thomas approving Resolution 2021-53 Approving NAPA Site Plan, Conditional Use Permit, and Variance Request. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) b. Grading Expansion Request – Rush Creek Reserve City Planner Lindahl reviewed Council approval of the final plat and final PUD development plan on November 23, 2020 which included approval to grade only the final plat area. City Planner Lindahl reviewed the request by applicant for Council approval to allow grading of the entire site, noting no utility or street work would be allowed until the final plat is recorded for the affected phase. City Planner Lindahl noted the expanded grading request is not unique and is like other projects located in Corcoran and noted compliance with the tree preservation plan would be required. MOTION: made by Thomas, seconded by Bottema approving Resolution 2021-54 Approving Grading Expansion in Rush Creek Reserve. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) c. Request to Reconsider Application – Cook Lake Highlands City Administrator Martens outlined the request to reconsider application for Cook Lake Highlands, and explained the request is to reconsider substantially similar, but previously denied application due to the 6-month delay if not approved by Council. City Administrator Martens reviewed changes implemented by applicant after considering comments by community and Council at previous meeting. Council inquired if any part of the approval requires a four -fifths vote. City Planner Lindahl noted a zoning comprehensive plan amendment would require a four-fifths vote. Council discussed tabling item to June 10, if it works with applicant’s schedule, in case a zoning change is necessary. Council noted the many meetings applicant has had with residents, and other associated parties, and would reconsider application with the changes. City Planner Lindahl noted more information is needed from the assisted living facility units regarding the comprehensive plan zoning. Beth Hustad, applicant, indicated facility care developer altering rooms to units, and the developer is willing to meet the requirement and place a kitchenette in each of the units to be counted as 32 units versus one unit with 32 rooms and one kitchen, and is the most recent conversation with developer. Ms. Hustad also noted communication with the MET Council as well regarding the 32 units, to avoid a comprehensive plan amendment. MOTION: made by Bottema, seconded by Schultz, approving reconsideration of denied application, staying the six-month application delay. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) City Administrator Martens requested clarification if changes made by applicant are sufficient to allow applicant some direction in potentially moving forward with additional changes for the development. Council shared changes made, responses from neighbors, and expectations from Council, MET Council and the watershed and allowing future discussion with the changes and new factors within the development. d. Conditional Uses in Zoning Districts Council reviewed moving the discussion to the June 10 or June 24 Council meeting. City Administrator Martens clarified the meeting discussion dates of Conditional Uses in Zoning Districts, included consideration of Councilmember Nichols’ absence at tonight’s meeting, noting when the city attorney would be available to discuss legal aspects of zoning changes, and noted June 24 was the first 4 meeting date the city attorney was available. City Administrator Martens noted a scheduled time with the city attorney with each councilmember could also be scheduled for the June 10 Council meeting. MOTION: made by Bottema, seconded by Thomas to move the Conditional Uses in Zoning Districts discussion to June 24. Council discussed June 24 discussion topic options and keeping the discussion on Conditional Uses in Zoning Districts as a separate topic. Council noted having legal comment available at a public meeting versus individually speaking with each Council member due to the gravity of the topic. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carries 4:0) 9. Unfinished Business (Public Comment Opportunity) Mayor McKee invited residents to communicate telephonically during the Public Comment opportunity for Unfinished Business items included on the agenda. Administrative Services Director Beise explained the instructions to participate in the meeting via the Zoom video format and reviewed instructions for participation in the meeting. No residents participated in the public comment opportunity. a. Hackamore Road Improvement Plan Update Jim Stremel, Project Manager, reviewed the Hackamore Road Improvement Project noting discussion of authorization of 75 percent design. Mr. Stremel reviewed project location on Hackamore Road, joint project background with City of Medina, existing conditions of Hackamore Road, explained the differences between 30 percent design and 75 percent design, meetings to date with public comment. Council asked if approval of funds for 75 percent design or approving the 75 percent design is what is necessary for the Hackamore Road Improvement Plan Update. Mr. Stremel clarified Council approval is needed for 75 percent design phase. Council noted design at 30 percent phase included a recommendation of including a bike lane in the design. Mr. Stremel reviewed the proposed improvements, noting the trail extensions and connections on the north side, and paved shoulders for alternative bike lanes. Mr. Stremel outlined the corridors, stormwater management, future development access, wetland impacts regarding the stormwater management, and trail locations . Council asked if elimination of elevation of road has been factored into 75 percent design. Mr. Stremel referenced the profile view, sight distances, and noted lengthening the curves on each side, lowering the top of the curve by at least a foot creating a much smoother, and not eliminating but reducing the curve. Council inquired about sight lines and approach curves to meet sight safety distances. Mr. Stremel reviewed project itemization costs with project total of $6,702,000. Mr. Stremel reviewed potential funding sources for the project through development contributions, grant funding, local funding, and potential State Aid funding source. Mr. Stremel reviewed next steps, noting Council approval for design does not constitute authorization for the project. MOTION: made by Bottema, seconded by Schultz to approve Hackamore Road Improvement Plan 75 percent design. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) City Administrator Martens noted the efforts of City Engineer Torve and Public Works Director Mattson in conjunction with Mr. Stremel’s work. 10. New Business (Public Comment Opportunity) Mayor McKee invited residents to communicate telephonically during the Public Comment opportunity for New Business items included on the agenda. Administrative Services Director Beise explained the instructions to participate in the meeting via the Zoom video format and reviewed instructions for participation in the meeting. Greg Hoglund, 19220 Hackamore Road, commented on Council Motion to approve presentations prior to presentation being completed and would like to hear presentation completely from a public view. Mr. Hoglund noted dirt in the Ravinia neighborhood was being moved at 10:00 pm at night and on weekends, violating the periods of work in both cases during Ravinia development construction. Mr. Hoglund opined on construction procedures being violated and to define penalties clearly. Council 5 responded regarding Motions in the two cases at the meeting tonight, noting the documents included in the packet were very complete and information provided was enough to support the Motion. a. Public Works Building Improvement – 9525 Cain Road City Administrator Martens outlined the storm damage from 2020 to the building, noting with the hail damage insurance claim covered the roof, however, the sides of the structure were not covered. City Administrator Martens noted a quote received of $34,500 to replace the sides of the building and utilizing funds from Long-Range Planning Fund as a source for funding. City Administrator Martens also noted General Funds could also be utilized. Council noted the age of the building, and reviewed use of building. City Administrator Martens indicated the building is cold storage with one heated bay and specifically used for equipment storage. Council reviewed additional improvements necessary in the next 10 years. Council noted pole building structures can last for many years if the timber is preserved and commented re-tinning a pole building structure has value over building a new product. Council discussed the funding options. Council discussed overhead doors on the building. Public Works Director Mattson noted two of the three overhead doors have been replaced and the re-tinning estimate does not include the cost for a third door and noted third door. Public Works Director Mattson noted the door replacement is included in the Public Works maintenance and repair schedule. MOTION: made by Schultz, seconded by Bottema to approve the quote from Ebert Construction for $34,500 for re-tinning the Public Works pole barn structure on 9525 Cain Road. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) Council and staff discussed funding source determination and confirmed the expenditure will either come from the 416 Capital Improvement Fund or General Fund. b. Construction Hours Discussion Planner Davis reviewed the current construction hours of neighborin g cities and regular construction times ranged from 5:00 am to 11:00 pm, with an average of 7:00 am to 10:00 pm. Planner Davis noted most cities allow construction seven days a week, with limitations on weekends and holidays; Dayton has one of the most restrictive construction hours schedule and allows construction between the hours of 7:00 am to 7:00pm during the work week, and 8:00 am to 4:00 pm on weekends and holidays, with an additional restrictions in conjunction with land use permits. Planner Davis noted other restrictions cities impose and included examples of weekend restrictions including good cause; construction in industrial, business, and commercial zone exemptions; and splitting building permits into two classes and allowing weekend and holiday work according to class type. Planner Davis reviewed considerations for construction hours discussion noting several examples of possible construction scenarios. Council commented on heavy equipment construction within developments, and the noise burden to surrounding neighbors, and supports limited construction hours on the weekend geared towards large scale development projects. Council noted individual residences would be exempt from the construction hour schedule, with a caveat included for storm damage properties allowing construction until 8:00 or 9:00 pm. Staff discussed different classes of permits as a measure to separate individual homeowner construction and developer construction, and the implications to staff workload with permit classes. City Administrator Martens recalled a citation that was issued in Ravinia within the first two phases regarding construction noise noting construction noise was factored into future Council approvals within the Ravinia development. Council addressed enforcement mechanics being key to substantiating future action regarding construction noise. Council reviewed regular construction hours of 7:00 am to 7:00 pm Monday through Friday, and construction hours of 8:00 am to 4:00 pm on Saturday and Sunday, or no development construction on Sundays, and including a caveat for homeowners to work on their homes and noting the difference between a homeowner working on their home or crew of workers completing work during the weekends. Director of Public Safety Gottschalk reviewed the legalities of repeated violations and shutting down a project due to continued infractions, noting citations for criminal laws broken, but guidelines for civil and criminal are necessary for enforcement. City Administrator Martens noted there are different crews working on each house as subcontractors within a development and communicating construction hours through the contractor is essential noting signs throughout the neighborhood. City Administrator Martens 6 summarized the construction hour discussion to mirror the City of Dayton construction hour schedule of 7:00 am to 4:00 pm Monday through Friday, with construction hour schedule of 8:00 am to 4:00 pm on weekends and holidays, including an exemption for homeowners and post-storm events and enhanced enforcement process. c. Sergeant and K9 Handler Appointment Process Director of Public Safety Gottschalk reviewed past sergeant hiring, recent police officer hiring, and vacancy of police officer and sergeant positions for 2021. Director of Public Safety Gottschalk noted the two police officer positions where staff were employed, but unable to work, plac ed the department behind in staffing. Director of Public Safety Gottschalk reviewed request to begin a recruitment process for the second sergeant position, in tandem with the current patrol officer process to fill the remaining vacant police officer position, and authorization to include the K9 handler recruitment process, and authorizing the Director of Public Safety to appoint the preferred candidate. MOTION: made by Thomas, seconded by Schultz to authorize the Police Department to begin the recruitment and hiring process for the Police Sergeant position; authorize the Director of Public Safety to hold a K9 Handler selection process and appoint the preferred candidate to the K9 Handler position. Voting Aye by Roll Call Vote: McKee, Bottema, Schultz, and Thomas (Motion carried 4:0) d. City Meeting Format City Administrator Martens noted the Governor’s Order on mask expiration and removal of the distancing requirement. City Administrator Martens outlined the discussion opportunity regarding options for city meetings, noting an option for in-person for council and public format, mandatory in- person Council attendance to vote, and retaining a virtual option for residents once Council returns to in-person at the Council Chambers. City Administrator Martens noted moving to in-person in Council Chambers is setup and ready, and better than it has ever been with lobby seating for residents. City Administrator Martens noted upon expiration of the order, Council must be in-person to vote and no longer virtual. Council discussed retaining virtual option as a long-term option for residents. Council reviewed utilizing hybrid sessions as transition to in-person occurs and including time for in-person public comment opportunity, along with online public comment opportunities. Council agreed allowing virtual access to Council meetings for community is important going forward, noting the importance of Council Chambers attendance and the disadvantage of Council in virtual option. Council agreed virtual attendance option by residents should continue, noting diligence for in-person Council attendance and adhering to common sense if ill and utilizing the virtual option, but noting Councilmembers will need to be in-person to vote. City Administrator Martens reviewed opening City Hall for Council meetings and public attendance at meetings, and applies to commissions as well. Council and staff discussed options for next meeting, the coordination for the work session and regular Council meeting, both virtually and in-person. Council and staff discussed virtual and in-person resident public comment and processes for both options and the importance of streamlining options for future meetings. Council discussed including topics and public comment opportunities in City newsletter, website, and social media along with Council packet posting to website. Council noted residents can sign up for notifications for Council packet alerts through the website and requested a post on how to sign up for Council packets on social media. Staff noted instructions on signing up for Council packet have been included in the City newsletter and included on social media. e. City Council Terms, Roles, etc. City Administrator Martens briefly summarized term limits cannot be established for Councilmembers by Council; Council can establish terms and roles for Parks and Trails Commission and Planning Commission; anything related to Charter Commission requires an amendment to the Charter. Council discussed terms for Parks and Trails Commission and Planning Commission is currently three years, and review applicants at time of term expiration. Council discussed long terms over three years with a group of individuals promotes institutionalism and limits the ability of commission and if term limits are in place for elected officials, the same process should be place for commissions as well. Council discussed term limits creating fresh ideas and new people and removes the Council decision from the equation of expiring term limits. Council noted commission volunteers need to reapply every three 7 years to the commission and allows for new representation on each commission. Per consensus, Council directed staff to review Charter Commission and recommendation on term limits for the city commissions. 11. Staff Reports a. Active Corcoran Planning Applications. Council received reports. b. Pandemic Response Update Director of Public Safety Gottschalk updated Council on vaccinations and returning to normal working schedules. City Administrator Martens noted staff is beginning to have normal in-person meetings as restrictions have lifted. 12. 2021 City Council Schedule 13. Adjournment MOTION: made by McKee, seconded by Thomas to adjourn. Voting Aye by Roll Call Vote: McKee and Thomas Nay: Bottema Abstain: Schultz (Motion carried 2:1:1) Meeting adjourned at 9:43 pm. ________________________________ Michelle Friedrich – Deputy Clerk STAFF REPORT Agenda Items 7c. Council Meeting: June 10, 2021 Prepared By: Jessica Beise Topic: Claims Action Required: Informational Summary: Escrow Claims (Fund #500) and All Other Financial Claims will be provided separately to Councilmembers via email and will be placed in the City Hall Agenda Packet and on the website when available. Agenda Item 7c. Council Meeting Date: 6/10/2021 NANCIAL CLAIMS Prepared By:jbeise HECK RANGE enda Item: 7a.FUND #500 ESCROW CLAIMS Paid to Amount Project name 500-20390 $976.76 Ravinia Street Lights 500-20420 $256.88 Bass Lake Crossing Street Lights 500-20436 $133.29 Bellwether Street Lights 500-20204 $308.75 Appaloosa Woods 500-20219 $142.50 Krominga Variance 500-20332 $427.51 Tavera 500-20482 $1,140.02 Nelson International 500-20497 $47.50 Kariniemi Plat 500-20488 $83.13 Rush Creek Reserve Total $3,516.34 Total Fund #500 =3,516.34$ (See attached Payments Detail) enda Item:7a.ALL OTHER FINANCIAL CLAIMS 135,772.26$ 139,288.60$ Total Checks (See attached Check Detail Register) Total of Auto Deductions 99,563.99$ TOTAL EXPENDITURES FOR APPROVAL 238,852.59$ te Paid to Amount 6/1/2021 Health Partners 19,834.91$ Health Insurance 6/1/2021 ACH Return 16.00$ ACH Return 6/1/2021 ACH Return 26.55$ ACH Return 6/1/2021 ACH Return 52.20$ ACH Return 6/1/2021 ACH Return 65.09$ ACH Return 6/1/2021 ACH Return 76.12$ ACH Return 6/3/2021 ADP Tax, ADP Tax 21,926.74$ Payroll taxes 6/3/2021 ADP Wage Pay, Wage Pay 56,872.93$ Net Payroll PP09 6/4/2021 Return Item 270.00$ Health savings account 6/4/2021 ACH Fee 15.00$ ACH Fee 5/10/2021 Zoom.us 16.11$ Zoom License for Meetings 5/11/2021 Fleetio.com 30.00$ Fleet Management Software 5/24/2021 Humanity.com 80.00$ Scheduling Software 5/24/2021 Post Board Service Fee 2.24$POST Board License 5/24/2021 State of Minnesota Post Board 90.00$ POST Board License 5/26/2021 Planetizen PL Courses 24.95$ Training 6/1/2021 MN DVS 0.65$Vehicle Registration 6/1/2021 MN DVS 26.00$ Vehicle Registration 6/1/2021 Detectachem Inc.138.50$ Police Supplies al 99,563.99$ Auto Deductions / Electronic Fund Transfer / Other Disbursements H:\City Hall Information\CITY GOVERNMENT\Council, Commissions & Committees\Council Information\Council Claims\2021 Claims Workbook.xls Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 1 Current Period: June 2021 User Dollar Amt $139,288.60 $139,288.60Computer Dollar Amt $0.00 Batch Name 06/03/21 PAY Payments In Balance HANOVER YOUTH BALLRefer 37018 Cash Payment $600.00Baseball Tourney FeeE 100-45200-210 Operating Supplies (GEN Invoice $600.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 WRIGHT HENNEPIN COOP ELECTRefer37020 Cash Payment $14.81Bridle/Gleason: 150-1690-5131G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.08Bridle/Paddock: 150-1690-5135G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81Paddock Ln 150-1690-5137G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.08Bridle Path: 150-1690-5146G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.08Paddock/Bridle: 150-1690-5158G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.086471 Carriage: 150-1691-0155G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.08Bridle/Steeple: 150-1691-0158G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.08Bridle/Bluestem: 150-1691-0168G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.08Prairie/Bridle: 150-1691-0174G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.08Bridle Path: 150-1691-0177G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $15.08Elderberry Ct: 150-1691-0178G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119301 Annabelle: 150-1691-8063G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.816675 Carriage: 150-1691-8064G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.816681 Bridle: 150-1691-8066G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.816657 Bridle: 150-1691-8079G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119130 Galloway: 150-1691-8080G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119065 Galloway: 150-1691-8082G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $29.896485 Larkspur: 150-1692-0907G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.816398 Larkspur: 150-1692-0908G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8166TH/CEDAR: 150-1692-8373G 500-20390 Ravinia Street Lights Invoice 35028786849 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 2 Current Period: June 2021 Cash Payment $14.81Bridle/66th Ave: 150-1692-8374G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119437 Lupine LN: 150-1693-0197G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119389 Lupine LN: 150-1693-0199G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119345 Golden TR: 150-1693-0200G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.816310 Steeple LN: 150-1693-0201G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.816370 Steeple LN: 150-1693-0202G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119367 Annabelle: 150-1693-5724G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119343 Annabelle: 150-1693-5726G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119315 Primrose: 150-1693-5731G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.8119399 Primrose: 150-1693-5732G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81Primrose/Wildfl: 150-1693-5733G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81Wildflo/Gleason: 150-1693-5734G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81Gleason/Wildflo: 150-1693-5986G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81FIR LN/75TH AVE: 150-1693-7072G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81FIR LN N: 150-1693-7074G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81FIR LN/74TH AVE: 150-1693-7075G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $23.25FIR LN N/CR 10: 150-1693-7076G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.8174TH AVE N: 150-1693-7077G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $23.25FIR LN N/CR 10: 150-1694-0076G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81FIR LN N: 150-1694-0078G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81FIR LN N/LOT #8: 150-1694-0079G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81FIR LN N/72ND N: 150-1694-0080G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.8172ND AVE N: 150-1694-0081G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81FIR LN N/LOT #5: 150-1694-0082G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81ANNABELLE LN #5 150-1694-0821G 500-20390 Ravinia Street Lights Invoice 35028786849 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 3 Current Period: June 2021 Cash Payment $14.81PRIMROSE COURT 150-1694-4502G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81SUNFLOWER COURT 150-1694-4503G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81WILDFLOWER TRL 150-1694-4505G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81WILDFLOWER TRL 150-1694-4506G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $17.8574TH PL & MAPLE 150-1694-6889G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81JACK PINE LN N 150-1694-6891G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.8174TH AVE N 150-1694-6892G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.8175TH AVE N 150-1694-6893G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81HICKORY LN N 150-1694-6894G 500-20420 Bass Lake Cross MI Home 17 Invoice 35028786849 Cash Payment $14.81MEADOW RUE CT 150-1694-7911G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81STEEPLE CHASE LN 150-1694-7917G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81SNOWBERRY CT 150-1694-7918G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81MEADOW RUE CT 150-1694-7919G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81STEEPLE CHASE LN 150-1694-7920G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $0.00LARKSPUR LN/63RD 150-1694-9986G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $0.0063RD AVE N 150-1694-9987G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $0.00CTY RD10/116 000-0100-1469E 100-43100-381 Street/Signal Lights Invoice 35028786849 Cash Payment $0.00Ballpark: 120-1246-7200E 100-45200-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.00CIVIL DEFENSE: 120-1246-8000E 100-42100-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.00Maple Hill Est: 120-1246-8100E 100-42100-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.00School Property: 120-1247-9600E 100-41941-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.008200 Cty Rd 116: 120-1255-6300E 100-41941-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.0019090 Bass Lk Rd:150-1687-7510E 601-49400-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.009525 Cain Rd: 150-1689-5230E 100-43100-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.00Brockton Ln: 150-1689-6871E 602-49450-380 Utility & Services (GENE Invoice 35028786849 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 4 Current Period: June 2021 Cash Payment $0.0020120 CTY 10 LIF:150-1691-6661E 602-49450-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.008200 CR116/SIGN: 150-1693-6612E 100-41941-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.00BASEBALL FIELD: 150-1693-6855E 100-45200-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.00WILDFLOWER: 150-1694-4774G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $0.00Cty 10/Maple Hi: 120-1246-7300E 100-43100-381 Street/Signal Lights Invoice 35028786849 Cash Payment $0.00CTY 10/Treptaus: 120-1246-7400E 100-43100-381 Street/Signal Lights Invoice 35028786849 Cash Payment $0.00CTY 10/St Thomas:120-1246-7500E 100-43100-381 Street/Signal Lights Invoice 35028786849 Cash Payment $0.00Cty 10/Stanchion:120-1246-7600E 100-43100-381 Street/Signal Lights Invoice 35028786849 Cash Payment $0.00Co Rd 10 & 50: 120-1246-7700E 100-43100-381 Street/Signal Lights Invoice 35028786849 Cash Payment $0.008200 Cty Rd 116: 120-1246-7800E 100-45200-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.0075th Ave/Hwy 116:120-1246-7900E 100-45200-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.008200 Cty Rd 116: 150-1684-2033E 100-41941-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.009100 Cty Rd 19: 150-1688-8463E 100-43100-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.006510 Cty Rd 116: 150-1680-4662E 100-42100-380 Utility & Services (GENE Invoice 35028786849 Cash Payment $0.006629 CTY 101: 150-1691-8062G 500-20390 Ravinia Street Lights Invoice 35028786849 Cash Payment $14.81GLEASON PKWY 150-1695-9396G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81GLEASON PKWY 150-1695-9398G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81102ND PL/103RD AVE 150-1694-7926G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Cash Payment $14.81STIEG ROAD: 150-1694-8543G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Cash Payment $14.81STIEG ROAD: 150-1694-8544G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Cash Payment $14.81LARKSPUR/63: 150-1694-9986G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.8163RD AVE: 150-1694-9987G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81IRONWOOD LN: 150-1695-5954G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Cash Payment $14.81IRONWOOD/102 PL: 150-1695 5954G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Cash Payment $14.81JACKPINE LN/IRONWOOD: 150-1695-5967G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 5 Current Period: June 2021 Cash Payment $14.81102ND AVE: 150-1695-5961G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Cash Payment $14.81102ND AVE/JACKPIN LN: 150-1695-5963G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Cash Payment $14.81102ND AVE/JACKPIN LN: 1501695-5964G 500-20436 Pulte Encore - PUD Skch 17- Invoice 35028786849 5/10/2021 Cash Payment $14.81COACHHOUSE LN: 150-1695-6350G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81COACHHOUSE LN/ANNABELLE: 150-1695- 6351 G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81ANNABELLE LN/BLACK OAK LN: 150-1695- 6352 G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81ANNABELLE LN:: 150-1695-6359G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81COACHHOUSE LN LOT1: 150-1695-6365G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81BLACK OAK CT: 1501695-6367G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81BLAKC OAK LN/BLACK OAK CT: 150-1695- 6371 G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81BLACK OAK LN: 150-1695-7149G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81GLEASON PKWY/BRIDLE PA: 150-1695-8428G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81BRIDLE BATH: 150-1695-8431G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81PRAIRIE SAGE LN: 150-1695-8432G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81PRIAIRIE SAGE LN: 150-1695-8435G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81PAIRIRIE SAGE LN: 150-1695-8436G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81PRAIRIE SAGE LN/BRIDLE: 1501695-8483G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 Cash Payment $14.81GLEASON PWKY: 150-1695-9395G 500-20390 Ravinia Street Lights Invoice 35028786849 5/10/2021 $1,325.90TotalTransaction Date 6/3/2021 Farmers State Bank 10100 TEAMSTER LOCAL 320 Refer 37023 Cash Payment $286.20Legal Defense DuesG 100-21707 Union Dues Invoice June 2021 5/25/2021 $286.20TotalTransaction Date 6/3/2021 Farmers State Bank 10100 COMCAST- 902943336 Refer 37024 Cash Payment $113.27LAND LINEE 100-41941-321 Telephone Invoice 122639833 5/15/2021 Cash Payment $113.27LAND LINEE 100-42100-321 Telephone Invoice 122639833 5/15/2021 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 6 Current Period: June 2021 Cash Payment $113.28LAND LINEE 100-43100-321 Telephone Invoice 122639833 5/15/2021 $339.82TotalTransaction Date 6/3/2021 Farmers State Bank 10100 ZUTHER, SHAWNA Refer 37027 Cash Payment $20.163/16-4/7 MileageE 100-41400-210 Operating Supplies (GEN Invoice Mileage 5/7/2021 $20.16TotalTransaction Date 6/3/2021 Farmers State Bank 10100 US BANKCORP EQUIPMENT FINAN Refer 37028 Cash Payment $317.00COPIER LEASEE 100-41951-210 Operating Supplies (GEN Invoice 44364-1691 5/18/2021 $317.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 ZEP SALES & SERVICE Refer 37029 Cash Payment $257.40trash bagsE 100-41941-210 Operating Supplies (GEN Invoice 9006275127 5/18/2021 $257.40TotalTransaction Date 6/3/2021 Farmers State Bank 10100 ECM PUBLISHERS INC Refer 37030 Cash Payment $39.57advertisingE 100-41910-210 Operating Supplies (GEN Invoice 835873 5/20/2021 $39.57TotalTransaction Date 6/3/2021 Farmers State Bank 10100 ECM PUBLISHERS INC Refer 37031 Cash Payment $31.66June Westside TireE 100-41910-210 Operating Supplies (GEN Invoice 835874 5/20/2021 $31.66TotalTransaction Date 6/3/2021 Farmers State Bank 10100 ECM PUBLISHERS INC Refer 37032 Cash Payment $31.66June 3 Dornsbach CupE 100-41910-210 Operating Supplies (GEN Invoice 835875 5/20/2021 $31.66TotalTransaction Date 6/3/2021 Farmers State Bank 10100 INTEGRATED PROTECTION SYSTE Refer 37033 Cash Payment $1,275.00program printerE 100-41941-300 Professional Srvs (GENE Invoice 75393 5/19/2021 $1,275.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 MARTENS, BRAD Refer 37034 Cash Payment $12.74Display Port CableE 100-41300-210 Operating Supplies (GEN Invoice Reimb 05/20 5/20/2021 Cash Payment $320.00May Dependent CareG 100-21709 Dependent Care FSA Withhol Invoice Reimb 05/20 5/20/2021 $332.74TotalTransaction Date 6/3/2021 Farmers State Bank 10100 WOLD ARCHITECTS AND ENGINEE Refer 37035 Cash Payment $490.38Reimburse on Project Police City Hall remodelE 100-41941-300 Professional Srvs (GENE Invoice 72644 5/31/2021 $490.38TotalTransaction Date 6/3/2021 Farmers State Bank 10100 ADAMS PEST CONTROL, INC. Refer 37037 Cash Payment $92.70PEST CONTROLE 100-41941-210 Operating Supplies (GEN Invoice 3292255 5/27/2021 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 7 Current Period: June 2021 Cash Payment $0.00PEST CONTROLE 100-43100-210 Operating Supplies (GEN Invoice 3292255 5/27/2021 $92.70TotalTransaction Date 6/3/2021 Farmers State Bank 10100 COMPUTER INTEGRATION TECH Refer 37038 Cash Payment $2,310.00HP Aruba plus switchE 100-41951-207 Computer Supplies Invoice 121431 5/24/2021 $2,310.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 AMAZON CAPITAL SERVICES Refer 37039 Cash Payment $62.39SUPPLIESE 100-41941-210 Operating Supplies (GEN Invoice 1HWQMH9DD4R 5/13/2021 $62.39TotalTransaction Date 6/3/2021 Farmers State Bank 10100 TEGRETE Refer 37040 Cash Payment $86.16MONTHLY CITY HALL CLEANINGE 100-41941-400 Repairs & Maint Cont (G Invoice 96121 5/26/2021 $86.16TotalTransaction Date 6/3/2021 Farmers State Bank 10100 COMPUTER INTEGRATION TECH Refer 37041 Cash Payment $69.00JUNE SERVICESE 100-41951-300 Professional Srvs (GENE Invoice 310070 5/28/2021 $69.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 CARSON, CLELLAND & SCHREDER Refer 37042 Cash Payment $7,386.32Legal servicesE 100-41600-300 Professional Srvs (GENE Invoice 052821 5/28/2021 Cash Payment $551.68Easement AcquisitionE 427-43100-530 Improvements Other Tha Invoice 052821 5/28/2021 Cash Payment $308.75APPALOOSA WOODSG 500-20204 Appaloosa Woods Feasibility Invoice 052821 5/28/2021 Cash Payment $71.25CORCORAN TRL E -WE 100-41600-300 Professional Srvs (GENE Invoice 052821 5/28/2021 Cash Payment $47.50KARINIEMI PLATG 500-20497 Kariniemi PP 20-016 Invoice 052821 5/28/2021 Cash Payment $142.50KROMINGA VARIANCEG 500-20219 Krominga Variance 21-010 Invoice 052821 5/28/2021 Cash Payment $1,140.02NELSON INTERNATIONALG 500-20482 Nelson Sketch Plan 19-023 Invoice 052821 5/28/2021 Cash Payment $427.51TAVERAG 500-20332 Lennar Tavera Development Invoice 052821 5/28/2021 Cash Payment $83.13RUSH CREEK RESERVEG 500-20488 Rush Creek Reserve Invoice 052821 5/28/2021 Cash Payment $47.50WELL SITEE 100-41600-300 Professional Srvs (GENE Invoice 052821 5/28/2021 Cash Payment $1,496.65CRIMINALE 100-42100-304 Legal Fees Invoice 052821 5/28/2021 Cash Payment $25.0066THE 427-43100-530 Improvements Other Tha Invoice 052821 5/28/2021 $11,727.81TotalTransaction Date 6/3/2021 Farmers State Bank 10100 STREICHER S POLICE EQUIPMENT Refer 37044 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 8 Current Period: June 2021 Cash Payment $1,074.00VestsE 202-42100-580 Other Equipment Invoice 1504529 5/21/2021 Cash Payment $1,056.00VestsE 202-42100-580 Other Equipment Invoice 1504483 5/21/2021 $2,130.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 INTEGRATED PROTECTION SYSTE Refer 37045 Cash Payment $2,000.00Progress Pymt 2 Job 28744E 416-42100-207 Computer Supplies Invoice 75394 5/25/2021 $2,000.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 AMAZON CAPITAL SERVICES Refer 37046 Cash Payment $111.99Converter telephone cableE 100-42100-223 Building Repair Supplies Invoice 1WMHHTYYY4X 5/25/2021 $111.99TotalTransaction Date 6/3/2021 Farmers State Bank 10100 INTEGRATED PROTECTION SYSTE Refer 37047 Cash Payment $10,000.00Progress Pymt 3 Job 28615E 416-42100-207 Computer Supplies Invoice 75395 5/25/2021 $10,000.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 AMAZON CAPITAL SERVICES Refer 37048 Cash Payment $917.29FLOOR MATS & SUPPLIESE 100-42100-200 Office Supplies (GENER Invoice 1GJMNT43CMX 5/16/2021 $917.29TotalTransaction Date 6/3/2021 Farmers State Bank 10100 NAPA AUTO PARTS - CORCORAN Refer 37049 Cash Payment $8.29POLISHE 100-42100-220 Repair/Maint Supply (GE Invoice 348631 5/3/2021 Cash Payment $6.69SUPPLIESE 100-42100-220 Repair/Maint Supply (GE Invoice 352380 5/25/2021 Cash Payment $12.98MICROFIBERE 100-42100-220 Repair/Maint Supply (GE Invoice 348640 5/3/2021 $27.96TotalTransaction Date 6/3/2021 Farmers State Bank 10100 STREICHER S POLICE EQUIPMENT Refer 37050 Cash Payment $887.78UNIFORMSE 100-42100-417 Uniforms Invoice 504647 5/21/2021 Cash Payment $45.99TASERE 100-42100-417 Uniforms Invoice 504647 5/21/2021 $933.77TotalTransaction Date 6/3/2021 Farmers State Bank 10100 MENARDS MAPLE GROVE Refer 37051 Cash Payment $34.87SUPPLIESE 100-41941-210 Operating Supplies (GEN Invoice 82882 5/20/2021 Cash Payment $316.74STEEL BEAMSE 100-41941-210 Operating Supplies (GEN Invoice 82450 5/11/2021 Cash Payment $41.98TOOL LINERE 100-41941-210 Operating Supplies (GEN Invoice 82391 5/10/2021 $393.59TotalTransaction Date 6/3/2021 Farmers State Bank 10100 BEAUDRY OIL COMPANY Refer 37052 Cash Payment $999.74SQUAD FUELE 100-42100-212 Motor Fuels Invoice 1832888 5/26/2021 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 9 Current Period: June 2021 Cash Payment $0.00GASOLINEE 100-43100-212 Motor Fuels Invoice 1832888 5/26/2021 Cash Payment $0.00GASOLINEE 100-41920-210 Operating Supplies (GEN Invoice 1832888 5/26/2021 Cash Payment $0.00DIESELE 100-43100-212 Motor Fuels Invoice 1832888 5/26/2021 $999.74TotalTransaction Date 6/3/2021 Farmers State Bank 10100 ZEP SALES & SERVICE Refer 37053 Cash Payment $185.99Ecosoft - City HallE 100-41941-210 Operating Supplies (GEN Invoice 9006293950 5/24/2021 $185.99TotalTransaction Date 6/3/2021 Farmers State Bank 10100 CENTURY LINK Refer 37054 Cash Payment $0.00LAND LINE 763-420-4061E 100-45200-321 Telephone Invoice 314225024 5/21/2021 Cash Payment $66.19LAND LINE/FIRE MONITORING-9100E 100-43100-321 Telephone Invoice 314225024 5/21/2021 $66.19TotalTransaction Date 6/3/2021 Farmers State Bank 10100 BEAUDRY OIL COMPANY Refer 37055 Cash Payment $0.00SQUAD FUELE 100-42100-212 Motor Fuels Invoice 1832887 5/26/2021 Cash Payment $0.00GASOLINEE 100-43100-212 Motor Fuels Invoice 1832887 5/26/2021 Cash Payment $0.00GASOLINEE 100-41920-210 Operating Supplies (GEN Invoice 1832887 5/26/2021 Cash Payment $2,082.06DIESELE 100-43100-212 Motor Fuels Invoice 1832887 5/26/2021 $2,082.06TotalTransaction Date 6/3/2021 Farmers State Bank 10100 VONCO II, LLC Refer 37056 Cash Payment $85.05Waste FeeE 100-45200-221 Maintenance Projects Invoice V20000061934 5/23/2021 $85.05TotalTransaction Date 6/3/2021 Farmers State Bank 10100 SITE ONE LANDSCAPE SUPPLY Refer 37057 Cash Payment $352.97SuppliesE 100-43100-223 Building Repair Supplies Invoice 109404662-001 5/21/2021 $352.97TotalTransaction Date 6/3/2021 Farmers State Bank 10100 ACME TOOLS Refer 37058 Cash Payment $340.00Drain pipeE 100-43100-210 Operating Supplies (GEN Invoice 8764109 5/24/2021 Cash Payment $71.96shovelE 100-43100-210 Operating Supplies (GEN Invoice 8772460 5/26/2021 Cash Payment $71.98x lineE 100-43100-210 Operating Supplies (GEN Invoice 87725402 5/26/2021 $483.94TotalTransaction Date 6/3/2021 Farmers State Bank 10100 MINNESOTA EQUIPMENT Refer 37059 Cash Payment $152.11suppliesE 100-45200-210 Operating Supplies (GEN Invoice P48327 5/25/2021 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 10 Current Period: June 2021 $152.11TotalTransaction Date 6/3/2021 Farmers State Bank 10100 NAPA AUTO PARTS - CORCORAN Refer 37060 Cash Payment $102.82hoseE 100-43100-220 Repair/Maint Supply (GE Invoice 352863 5/27/2021 Cash Payment $27.07chain linkE 100-43100-220 Repair/Maint Supply (GE Invoice 353013 5/27/2021 Cash Payment $9.10adaptersE 100-43100-220 Repair/Maint Supply (GE Invoice 348577 5/3/2021 Cash Payment $2.59plugE 100-43100-220 Repair/Maint Supply (GE Invoice 351830 5/21/2021 Cash Payment $73.57batteryE 100-43100-220 Repair/Maint Supply (GE Invoice 351857 5/21/2021 Cash Payment $93.37batteryE 100-43100-220 Repair/Maint Supply (GE Invoice 352960 5/27/2021 $308.52TotalTransaction Date 6/3/2021 Farmers State Bank 10100 XCEL ENERGY Refer 37061 Cash Payment $810.07STREET LIGHTINGE 100-43100-380 Utility & Services (GENE Invoice 732926461 5/21/2021 $810.07TotalTransaction Date 6/3/2021 Farmers State Bank 10100 TRUE NORTH STEEL Refer 37064 Cash Payment $2,737.50polesE 100-45200-221 Maintenance Projects Invoice BL0013140 5/20/2021 $2,737.50TotalTransaction Date 6/3/2021 Farmers State Bank 10100 CUMMINS NPOWER LLC Refer 37065 Cash Payment $138.29suppliesE 100-45200-210 Operating Supplies (GEN Invoice E4-40513 5/18/2021 Cash Payment $9.24gasketE 100-45200-210 Operating Supplies (GEN Invoice E4-40432 5/18/2021 Cash Payment $0.00E 100-45200-210 Operating Supplies (GEN Invoice E4-40513 5/18/2021 $147.53TotalTransaction Date 6/3/2021 Farmers State Bank 10100 NUTRIEN AG SOLUTIONS, INC. Refer 37066 Cash Payment $528.00SignsE 100-45200-210 Operating Supplies (GEN Invoice 45378879 5/21/2021 $528.00TotalTransaction Date 6/3/2021 Farmers State Bank 10100 RANDYS ENVIRONMENTAL SERVI Refer 37068 Cash Payment $2,428.82CITY HALL GARBAGE 1280351E 100-41941-380 Utility & Services (GENE Invoice 1-08035-1 5/24/2021 Cash Payment $673.86MONTHLY RECYCLINGE 100-43232-300 Professional Srvs (GENE Invoice 1-08035-1 5/24/2021 Cash Payment $274.86PARKS GARBAGE 11039E 100-45200-380 Utility & Services (GENE Invoice 5/24/2021 Cash Payment $151.21PUBLIC WORKS GARBAGE (9100) 12E 100-43100-380 Utility & Services (GENE Invoice 1-211214-9 5/24/2021 $3,528.75TotalTransaction Date 6/4/2021 Farmers State Bank 10100 RELENTLESSDESERT SNOW Refer 37069 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 11 Current Period: June 2021 Cash Payment $599.00TrainingE 100-42100-208 Training and Instruction Invoice 10094 5/25/2021 $599.00TotalTransaction Date 6/4/2021 Farmers State Bank 10100 KOTTKE, ROBBIE Refer 37070 Cash Payment $111.99BootsE 100-41000-210 Operating Supplies (GEN Invoice 06/1/2021 6/1/2021 $111.99TotalTransaction Date 6/4/2021 Farmers State Bank 10100 CINTAS - 470 Refer 37021 Cash Payment $10.00CITY HALLE 100-41941-210 Operating Supplies (GEN Invoice 4085426221 5/26/2021 Cash Payment $0.00FLOOR MATS - POLICEE 100-42100-223 Building Repair Supplies Invoice Cash Payment $0.00PUBLIC WORKSE 100-43100-210 Operating Supplies (GEN Invoice Cash Payment $0.00CITY HALL - RUGSE 100-41941-210 Operating Supplies (GEN Invoice Cash Payment $79.05UNIFORMSE 100-43100-417 Uniforms Invoice 4085426332 5/26/2021 Cash Payment $143.26UNIFORMSE 100-43100-417 Uniforms Invoice 4085426412 5/26/2021 Cash Payment $11.66CITY HALLE 100-41941-210 Operating Supplies (GEN Invoice 4085426210 5/26/2021 Cash Payment $0.00FLOOR MATS - POLICEE 100-42100-223 Building Repair Supplies Invoice Cash Payment $0.00PUBLIC WORKSE 100-43100-210 Operating Supplies (GEN Invoice Cash Payment $0.00CITY HALL - RUGSE 100-41941-210 Operating Supplies (GEN Invoice Cash Payment $0.00UNIFORMSE 100-43100-417 Uniforms Invoice Cash Payment $0.00UNIFORMSE 100-43100-417 Uniforms Invoice Cash Payment $16.35TOWELSE 100-43100-210 Operating Supplies (GEN Invoice 4085426222 5/26/2021 $260.32TotalTransaction Date 6/4/2021 Farmers State Bank 10100 MADDEN, GALANTER, HANSEN LL Refer 37022 Cash Payment $781.17LEGAL SERVICESE 100-41600-300 Professional Srvs (GENE Invoice Cash Payment $2,268.72LEGAL SERVICESE 100-41600-300 Professional Srvs (GENE Invoice $3,049.89TotalTransaction Date 6/4/2021 Farmers State Bank 10100 BEISE, JESSICA Refer 37025 Cash Payment $12.77MILEAGEE 100-41400-210 Operating Supplies (GEN Invoice REIMBURSE Cash Payment $1,050.00DEPENDENT CAREG 100-21709 Dependent Care FSA Withhol Invoice REIMBURSE $1,062.77TotalTransaction Date 6/4/2021 Farmers State Bank 10100 WSB Refer 37027 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 12 Current Period: June 2021 Cash Payment $6,590.00HACKAMORE ROADE 419-43100-300 Professional Srvs (GENE Invoice R-017789-000-1 4/29/2021 $6,590.00TotalTransaction Date 6/4/2021 Farmers State Bank 10100 B & D PLUMBING HEATING & AC Refer 37028 Cash Payment $5,720.00INSURANCE CLAIME 100-43100-810 Refunds/Reimbursement Invoice 187896 $5,720.00TotalTransaction Date 6/4/2021 Farmers State Bank 10100 METROPOLITAN AREA MGRS ASS Refer 37029 Cash Payment $27,061.65SAC ACTIVITYE 602-49450-310 Other Professional Servic Invoice MAY 2021 $27,061.65TotalTransaction Date 6/4/2021 Farmers State Bank 10100 THEIS, CRAIG AND RITA Refer 37030 Cash Payment $42,400.00EASEMENT - 66TH/GLEASONE 427-43100-530 Improvements Other Tha Invoice Easement Agree $42,400.00TotalTransaction Date 6/4/2021 Farmers State Bank 10100 RYAN AUTOMOTIVE Refer 37031 Cash Payment $757.80INSURANCE CLAIME 100-42100-810 Refunds/Reimbursement Invoice 1155570 5/14/2021 $757.80TotalTransaction Date 6/4/2021 Farmers State Bank 10100 WRIGHT HENNEPIN COOP ELECT Refer 37032 Cash Payment $0.00Bridle/Gleason: 150-1690-5131G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Bridle/Paddock: 150-1690-5135G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Paddock Ln 150-1690-5137G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Bridle Path: 150-1690-5146G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Paddock/Bridle: 150-1690-5158G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.006471 Carriage: 150-1691-0155G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Bridle/Steeple: 150-1691-0158G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Bridle/Bluestem: 150-1691-0168G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Prairie/Bridle: 150-1691-0174G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Bridle Path: 150-1691-0177G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Elderberry Ct: 150-1691-0178G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019301 Annabelle: 150-1691-8063G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.006675 Carriage: 150-1691-8064G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.006681 Bridle: 150-1691-8066G 500-20390 Ravinia Street Lights Invoice Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 13 Current Period: June 2021 Cash Payment $0.006657 Bridle: 150-1691-8079G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019130 Galloway: 150-1691-8080G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019065 Galloway: 150-1691-8082G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.006485 Larkspur: 150-1692-0907G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.006398 Larkspur: 150-1692-0908G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0066TH/CEDAR: 150-1692-8373G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Bridle/66th Ave: 150-1692-8374G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019437 Lupine LN: 150-1693-0197G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019389 Lupine LN: 150-1693-0199G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019345 Golden TR: 150-1693-0200G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.006310 Steeple LN: 150-1693-0201G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.006370 Steeple LN: 150-1693-0202G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019367 Annabelle: 150-1693-5724G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019343 Annabelle: 150-1693-5726G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019315 Primrose: 150-1693-5731G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0019399 Primrose: 150-1693-5732G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Primrose/Wildfl: 150-1693-5733G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Wildflo/Gleason: 150-1693-5734G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Gleason/Wildflo: 150-1693-5986G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00FIR LN/75TH AVE: 150-1693-7072G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00FIR LN N: 150-1693-7074G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00FIR LN/74TH AVE: 150-1693-7075G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00FIR LN N/CR 10: 150-1693-7076G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.0074TH AVE N: 150-1693-7077G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00FIR LN N/CR 10: 150-1694-0076G 500-20420 Bass Lake Cross MI Home 17 Invoice Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 14 Current Period: June 2021 Cash Payment $0.00FIR LN N: 150-1694-0078G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00FIR LN N/LOT #8: 150-1694-0079G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00FIR LN N/72ND N: 150-1694-0080G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.0072ND AVE N: 150-1694-0081G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00FIR LN N/LOT #5: 150-1694-0082G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00ANNABELLE LOT 5 150-1694-0821G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00PRIMROSE COURT 150-1694-4502G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00SUNFLOWER COURT 150-1694-4503G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00WILDFLOWER TRL 150-1694-4505G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00WILDFLOWER TRL 150-1694-4506G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0074TH PL & MAPLE 150-1694-6889G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00JACK PINE LN N 150-1694-6891G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.0074TH AVE N 150-1694-6892G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.0075TH AVE N 150-1694-6893G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00HICKORY LN N 150-1694-6894G 500-20420 Bass Lake Cross MI Home 17 Invoice Cash Payment $0.00MEADOW RUE CT 150-1694-7911G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00STEEPLE CHASE LN 150-1694-7917G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00SNOWBERRY CT 150-1694-7918G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00MEADOW RUE CT 150-1694-7919G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00STEEPLE CHASE LN 150-1694-7920G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00LARKSPUR LN/63RD 150-1694-9986G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.0063RD AVE N 150-1694-9987G 500-20390 Ravinia Street Lights Invoice Cash Payment $52.50CTY RD10/116 000-0100-1469E 100-43100-381 Street/Signal Lights Invoice Cash Payment $55.46Ballpark: 120-1246-7200E 100-45200-380 Utility & Services (GENE Invoice Cash Payment $20.11CIVIL DEFENSE: 120-1246-8000E 100-42100-380 Utility & Services (GENE Invoice Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 15 Current Period: June 2021 Cash Payment $20.22Maple Hill Est: 120-1246-8100E 100-42100-380 Utility & Services (GENE Invoice Cash Payment $30.52School Property: 120-1247-9600E 100-41941-380 Utility & Services (GENE Invoice Cash Payment $1,729.098200 Cty Rd 116: 120-1255-6300E 100-41941-380 Utility & Services (GENE Invoice Cash Payment $39.3619090 Bass Lk Rd:150-1687-7510E 601-49400-380 Utility & Services (GENE Invoice Cash Payment $69.749525 Cain Rd: 150-1689-5230E 100-43100-380 Utility & Services (GENE Invoice Cash Payment $410.56Brockton Ln: 150-1689-6871E 602-49450-380 Utility & Services (GENE Invoice Cash Payment $92.6320120 CTY 10 LIF:150-1691-6661E 602-49450-380 Utility & Services (GENE Invoice Cash Payment $115.028200 CR116/SIGN: 150-1693-6612E 100-41941-380 Utility & Services (GENE Invoice Cash Payment $41.24BASEBALL FIELD: 150-1693-6855E 100-45200-380 Utility & Services (GENE Invoice Cash Payment $41.03WILDFLOWER: 150-1694-4774G 500-20390 Ravinia Street Lights Invoice Cash Payment $0.00Cty 10/Maple Hi: 120-1246-7300E 100-43100-381 Street/Signal Lights Invoice Cash Payment $17.85CTY 10/Treptaus: 120-1246-7400E 100-43100-381 Street/Signal Lights Invoice Cash Payment $17.85CTY 10/St Thomas:120-1246-7500E 100-43100-381 Street/Signal Lights Invoice Cash Payment $18.95Cty 10/Stanchion:120-1246-7600E 100-43100-381 Street/Signal Lights Invoice Cash Payment $18.95Co Rd 10 & 50: 120-1246-7700E 100-43100-381 Street/Signal Lights Invoice Cash Payment $0.008200 Cty Rd 116: 120-1246-7800E 100-45200-380 Utility & Services (GENE Invoice Cash Payment $0.0075th Ave/Hwy 116:120-1246-7900E 100-45200-380 Utility & Services (GENE Invoice Cash Payment $0.008200 Cty Rd 116: 150-1684-2033E 100-41941-380 Utility & Services (GENE Invoice Cash Payment $27.959100 Cty Rd 19: 150-1688-8463E 100-43100-380 Utility & Services (GENE Invoice Cash Payment $177.586510 Cty Rd 116: 150-1680-4662E 100-42100-380 Utility & Services (GENE Invoice Cash Payment $0.006629 CTY 101: 150-1691-8062G 500-20390 Ravinia Street Lights Invoice $2,996.61TotalTransaction Date 6/4/2021 Farmers State Bank 10100 Payments CITY OF CORCORAN 06/07/21 5:06 PM Page 16 Current Period: June 2021 Pre-Written Checks $0.00 Checks to be Generated by the Computer $139,288.60 Total $139,288.60 Fund Summary 10100 Farmers State Bank 100 GENERAL FUND $44,471.38 202 POLICE DONATION FUND $2,130.00 416 CAPITAL-EQUIPMENT CERTS $12,000.00 419 HACKAMORE UPGRADE (LENNAR) $6,590.00 427 GLEASON/66TH PARKWAY EXTENSION $42,976.68 500 ESCROW HOLDING FUND $3,516.34 601 WATER $39.36 602 SEWER $27,564.84 $139,288.60 STAFF REPORT Agenda Item 7d. Council Meeting: June 10, 2021 Prepared By: Sergeant Peter Ekenberg Topic: Car Seat Acceptance Action Required: Approval Summary: The Minnesota Office of Traffic Safety – Child Passenger Safety Program offered a free car seat distribution opportunity. These car seats are to be disturbed to low- income families completely free of charge. The funding of the program is primarily from the collection of fines from individuals cited for illegal or unsafe transportation of child in motor vehicle. The Corcoran Police requested and were awarded 6 child safety restraint seats to be given away. Two Convertible seats, two combination seats, and two high back boosters. This variety will allow kids of all ages to get a car seat that they require. Some of the requirements of the distribution of the car seats are: The car seats must be distributed to low-income families. They must be given out by a Certified Child Passenger Safety Technician (Sgt. Ekenberg). The recipient(s) must go through a one on one or group educational piece on the use of the car seat with a Certified Child Passenger Safety Technician. All the car seats must be distributed by the end of the calendar year. Financial/Budget: Funding for the car seats was provided by Minnesota Office of Traffic Safety – Child Passenger Safety Program at no cost to the city. Sgt. Ekenberg will be completing distribution and child seat checks and education during his normal shifts. Each education meeting, required for each seat, is approximately 1 hour long. Council Action: Approve the resolution accepting 6 child restraint seats. Attachments: Resolution 2021-57 Accepting Minnesota Office of Traffic Safety Donation City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-57 Motion By: Seconded By: A RESOLUTION ACCEPTING THE MINNESOTA OFFICE OF TRAFFIC SAFETY DONATION WHEREAS, the City Council of the City of Corcoran, Minnesota, is authorized to accept donations of real or personal property pursuant to Minnesota Statutes Section 456.03 for the benefit of citizens, and is specifically authorized to accept gifts; WHEREAS, the City received a donation from the Minnesota Office of Traffic Safety of six car seats, two (2) Evenflo Spectrum Booster Seats, two (2) Evenflo Maestro Sport Combo Seats, and two (2) Evenflo Sureride/Titan 65 Convertible Seats, with a grand total value of $500.00; WHEREAS, the City Council finds that it is appropriate to accept the donations as offered for the benefit of Corcoran’s Child Passenger Safety Program, the City of Corcoran, and residents; NOW THEREFORE BE IT RESOLVED, the City Council of the City of Corcoran acknowledges the generosity of the Minnesota Office of Traffic Safety and graciously accepts the donations. VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan Thomas, Manoj Thomas, Manoj Whereupon, said Resolution is hereby declared adopted on this 10th day of June 2021. ________________________________ Tom McKee – Mayor ATTEST: ___________________________________ Jessica Beise – Administrative Services Director City Seal Agenda Item 7d. STAFF REPORT Agenda Item 7e. Council Meeting: June 10, 2021 Prepared By: Michelle Friedrich Topic: Charitable Gambling License – St. Thomas Church Action Required: Approval Summary: The City received a request for a charitable gambling license. Pursuant to Chapter 116 of the City Code, Regulating Lawful Gambling, the City requires that persons obtain approval for temporary gambling licenses. The applicant submitted an application and required documents for approval. Financial/Budget: Pursuant to the City’s fee schedule, permits are $50.00 and are not typically budgeted due to unknown frequency of the events. Council Action: Approve the temporary gambling license and adopt Resolution 2021-55 Approving Charitable Gambling in the City of Corcoran, MN. Attachments: 1.Resolution 2021-55 Approving Charitable Gambling in the City of Corcoran, MN 2.LG220 Application for Exempt Permit 3.Certificate of Exempt Status City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-55 Page 1 of 1 Motion By: Seconded By: A RESOLUTION APPROVING CHARITABLE GAMBLING IN THE CITY OF CORCORAN, MINNESOTA BE IT RESOLVED, by the City Council of the City of Corcoran that the following Charitable Gambling License is granted effective for the dates as indicated, to the following Licensee, which provided appropriate application. LICENSEE LICENSE LICENSE EFFECTIVE DATE St. Thomas the Apostle Church Organization located at 20000 County Hwy 10, Corcoran, MN 55340 Charitable Gambling (Raffle) August 15, 2021 (One day license) Event located at 20000 County Hwy 10, Corcoran, MN 55340 VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan Thomas, Manoj Thomas, Manoj Whereupon, said Resolution is hereby declared adopted on this 10th day of June, 2021. Tom McKee - Mayor ATTEST: City Seal Jessica Beise – Administrative Services Director MINNESOTA LAWFUL GAMBLING LG220 Application for Exempt Permit An exempt permit may be issued to a nonprofit Application Fee (non-refundable) 11/17 Page 1 of 2 organization that: Applications are processed in the order received. If the application •conducts lawful gambling on five or fewer days, and is postmarked or received 30 days or more before the event, the , awards less than $50,000 In prizes during a calendar application fee is $100; otherwise the fee is $150.year. If total raffle prize value for the calendar year will be Due to the high volume of exempt applications, payment of $1,500 or less, contact the Licensing Specialist assigned to additional fees prior to 30 days before your event will not expedite your county by calling 651-539-1900. service, nor are telephone requests for expedited service accepted. ORGANIZATION INFORMATION Organization Previous Gambling Name: St. Thomas the Apostle Permit Number: Federal Employer ID Number (FEIN), if any: Zip: 55340 County: Henneein Minnesota Tax ID Number, if any: MN026945 Mailing Address: 20000 County Rd 10 City: Corcoran State: MN Name of Chief Executive Officer (CEO): Fr. Glen Jenson CEO Daytime Phone: 763-420-2385 CEO Email: (permit will be emailed to this email address unless otherwise indicated below) Email permit to (if other than the CEO): susan.wieneke@yahoo.com NONPROFIT STATUS Type of Nonprofit Organization (check one): D Fraternal 0 Religious D Veterans D Other Nonprofit Organization Attach a copy of � of the following showing proof of nonprofit status: (DO NOT attach a sales tax exempt status or federal employer ID number, as they are not proof of nonprofit status.) □A current calendar year Certificate of Good Standing Don't have a copy? Obtain this certificate from: MN Secretary of State, Business Services Division Secretary of State website, phone numbers: 60 Empire Drive, Suite 100 www.sos.state.mn.us St. Paul, MN 55103 651-296-2803, or toll free 1-877-551-6767 IRS income tax exemption {SOl{c)) letter in your organization's name 0 Don't have a copy? To obtain a copy of your federal income tax exempt letter, have an organization officer contact the IRS toll free at l-877-829-5500. □IRS -Affiliate of national, statewide, or international parent nonprofit organization {charter}If your organization falls under a parent organization, attach copies of both of the following: 1.IRS letter showing your parent organization is a nonprofit 50l(c) organization with a group ruling; and 2.the charter or letter from your parent organization recognizing your organization as a subordinate. GAMBLING PREMISES INFORMATION Name of premises where the gambling event will be conducted (for raffles, list the site where the drawing will take place): St. Thomas the Aeostle Physical Address (do not use P.O. box): 20000 Countl Rd 10 Check one: [2J City: Corcoran Zip: 55340 County: 0Township: Zip: County: Date(s) of activity (for raffles, indicate the date of the drawing): Check each type of gambling activity that your organization will conduct: Henne�in DBingo D Paddlewheels □Pull-Tabs DTipboards 0Raffle Gambling equipment for bingo paper, bingo boards, raffle boards, paddlewheels, pull-tabs, and tipboards must be obtained from a distributor licensed by the Minnesota Gambling Control Board. EXCEPTION: Bingo hard cards and bingo ball selection devices may be borrowed from another organization authorized to conduct bingo. To find a licensed distributor, go to www.mn.gov/gcb and click on Distributors under the List of Licensees tab, or call 651-539-1900. 41-6133637 STAFF REPORT Agenda Item 7f. Council Meeting: June 10, 2021 Prepared By: Michelle Friedrich Topic: Charitable Gambling License – Pheasant Acres Action Required: Approval Summary: The City received a request for a charitable gambling license. Pursuant to Chapter 116 of the City Code, Regulating Lawful Gambling, the City requires that persons obtain approval for temporary gambling licenses. The applicant submitted an application and required documents for approval. Financial/Budget: Pursuant to the City’s fee schedule, permits are $50.00 and are not typically budgeted due to unknown frequency of the events. Council Action: Approve the temporary gambling license and adopt Resolution 2021-58 Approving Charitable Gambling in the City of Corcoran, MN. Attachments: 1.Resolution 2021-58 Approving Charitable Gambling in the City of Corcoran, MN 2.LG220 Application for Exempt Permit 3.Certificate of Exempt Status City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-58 Page 1 of 1 Motion By: Seconded By: A RESOLUTION APPROVING CHARITABLE GAMBLING IN THE CITY OF CORCORAN, MINNESOTA BE IT RESOLVED, by the City Council of the City of Corcoran that the following Charitable Gambling License is granted effective for the dates as indicated, to the following Licensee, which provided appropriate application. LICENSEE LICENSE LICENSE EFFECTIVE DATE Minnesota 100 Club Organization located at PO Box 1066 Anoka, MN 55303 Charitable Gambling (Raffle) August 5, 2021 (One day license) Event located at Pheasant Acres 10705 County Road 116 Corcoran, MN 55374 VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan Thomas, Manoj Thomas, Manoj Whereupon, said Resolution is hereby declared adopted on this 10th day of June, 2021. Tom McKee - Mayor ATTEST: City Seal Jessica Beise – Administrative Services Director MINNESOTA LAWFUL GAMBLING LG220 Application for Exempt Permit An exempt permit may be issued to a nonprofit organization that: conducts lawful gambling on five or fewer days, and awards less than $50,000 in prizes during a calendar year. If total raffle prize value for the calendar year will be $1,500 or less, contact the Licensing Specialist assigned to your county by calling 651-539-1900. Application Fee (non-refundable) Applications are processed in the order received. If the application is postmarked or received 30 days or more before the event, the application fee is $100; otherwise the fee is $150. Due to the high volume of exempt applications, payment of additional fees prior to 30 days before your event will not expedite service, nor are telephone requests for expedited service accepted. ORGANIZATION INFORMATION Organization Previous Gambling Name: ________________________________________________________ Permit Number: ____________________________ Minnesota Tax ID Federal Employer ID Number, if any: ______________________________________ Number (FEIN), if any: ________________________________ Mailing Address: __________________________________________________________________________________________ City: ____________________________________ State: _________ Zip: __________ County: ___________________________ Name of Chief Executive Officer (CEO): ________________________________________________________________________ CEO Daytime Phone: _____________________ CEO Email: _____________________________________________________ (permit will be emailed to this email address unless otherwise indicated below) NONPROFIT STATUS Type of Nonprofit Organization (check one): ____ Fraternal ____ Religious ____ Veterans ____ Other Nonprofit Organization Attach a copy of one of the following showing proof of nonprofit status: (DO NOT attach a sales tax exempt status or federal employer ID number, as they are not proof of nonprofit status.) ____ A current calendar year Certificate of Good Standing Don’t have a copy? Obtain this certificate from: MN Secretary of State, Business Services Division 60 Empire Drive, Suite 100 St. Paul, MN 55103 ____ IRS income tax exemption (501(c)) letter in your organization’s name Don’t have a copy? To obtain a copy of your federal income tax exempt letter, have an organization officer contact the IRS toll free at 1-877-829-5500. ____ IRS - Affiliate of national, statewide, or international parent nonprofit organization (charter) If your organization falls under a parent organization, attach copies of both of the following: 1.IRS letter showing your parent organization is a nonprofit 501(c) organization with a group ruling; and 2. the charter or letter from your parent organization recognizing your organization as a subordinate. GAMBLING PREMISES INFORMATION Name of premises where the gambling event will be conducted (for raffles, list the site where the drawing will take place): _________________________________________________________ Physical Address (do not use P.O. box): ________________________________________________________________________ Check one: ___ City: ______________________________________________ Zip: ___________ County: __________________________ ___ Township: __________________________________________ Zip: ___________ County: __________________________ Date(s) of activity (for raffles, indicate the date of the drawing): ____________________________________________________ Check each type of gambling activity that your organization will conduct: ____ Bingo ____ Paddlewheels ____ Pull-Tabs ____ Tipboards ____ Raffle Gambling equipment for bingo paper, bingo boards, raffle boards, paddlewheels, pull-tabs, and tipboards must be obtained from a distributor licensed by the Minnesota Gambling Control Board. EXCEPTION: Bingo hard cards and bingo ball selection devices may be borrowed from another organization authorized to conduct bingo. To find a licensed distributor, go to www.mn.gov/gcb and click on Distributors under the List of Licensees tab, or call 651-539-1900. 11/17 Page 1 of 2 Secretary of State website, phone numbers: www.sos.state.mn.us 651-296-2803, or toll free 1-877-551-6767 Email permit to (if other than the CEO): _______________________________________________________________________ LG220 Application for Exempt Permit LOCAL UNIT OF GOVERNMENT ACKNOWLEDGMENT (required before submitting application to the Minnesota Gambling Control Board) CITY APPROVAL for a gambling premises located within city limits ____ The application is acknowledged with no waiting period. ____ The application is acknowledged with a 30-day waiting period, and allows the Board to issue a permit after 30 days (60 days for a 1st class city). ____ The application is denied. Print City Name: ______________________________________ Signature of City Personnel: ___________________________________________________ Title:____________________________ Date:______________ COUNTY APPROVAL for a gambling premises located in a township ____The application is acknowledged with no waiting period. ____The application is acknowledged with a 30-day waiting period, and allows the Board to issue a permit after 30 days. ____The application is denied. Print County Name: ___________________________________ Signature of County Personnel: ___________________________________________________ Title:____________________________ Date:______________ TOWNSHIP (if required by the county) On behalf of the township, I acknowledge that the organization is applying for exempted gambling activity within the township limits. (A township has no statutory authority to approve or deny an application, per Minn. Statutes, section 349.213.) Print Township Name: _________________________________ Signature of Township Officer:___________________________ Title: ___________________________ Date: ______________ CHIEF EXECUTIVE OFFICER’S SIGNATURE (required) The information provided in this application is complete and accurate to the best of my knowledge. I acknowledge that the financial report will be completed and returned to the Board within 30 days of the event date. Chief Executive Officer's Signature: ____________________________________________________ Date: ___________________ (Signature must be CEO’s signature; designee may not sign) Print Name: _______________________________________________________________________________________________ REQUIREMENTS MAIL APPLICATION AND ATTACHMENTS Complete a separate application for: all gambling conducted on two or more consecutive days; or all gambling conducted on one day. Only one application is required if one or more raffle drawings are conducted on the same day. Financial report to be completed within 30 days after the gambling activity is done: A financial report form will be mailed with your permit. Complete and return the financial report form to the Gambling Control Board. Your organization must keep all exempt records and reports for 3-1/2 years (Minn. Statutes, section 349.166, subd. 2(f)). Mail application with: ____ a copy of your proof of nonprofit status; and ____ application fee (non-refundable). If the application is postmarked or received 30 days or more before the event, the application fee is $100; otherwise the fee is $150. Make check payable to State of Minnesota. To: Minnesota Gambling Control Board 1711 West County Road B, Suite 300 South Roseville, MN 55113 Questions? Call the Licensing Section of the Gambling Control Board at 651-539-1900. The city or county must sign before submitting application to the Gambling Control Board. 11/17 Page 2 of 2 Data privacy notice: The information requested on this form (and any attachments) will be used by the Gambling Control Board (Board) to determine your organization’s qualifications to be involved in lawful gambling activities in Minnesota. Your organization has the right to refuse to supply the information; however, if your organization refuses to supply this information, the Board may not be able to determine your organization’s qualifications and, as a consequence, may refuse to issue a permit. If your organization supplies the information requested, the Board will be able to process the application. Your organization’s name and address will be public information when received by the Board. All other information provided will be private data about your organization until the Board issues the permit. When the Board issues the permit, all information provided will become public. If the Board does not issue a permit, all information provided remains private, with the exception of your organization’s name and address which will remain public. Private data about your organization are available to Board members, Board staff whose work requires access to the information; Minnesota’s Depart- ment of Public Safety; Attorney General; Commissioners of Administration, Minnesota Management & Budget, and Revenue; Legislative Auditor, national and international gambling regulatory agencies; anyone pursuant to court order; other individuals and agencies specifically authorized by state or federal law to have access to the information; individuals and agencies for which law or legal order authorizes a new use or sharing of information after this notice was given; and anyone with your written consent. This form will be made available in alternative format (i.e. large print, braille) upon request. An equal opportunity employer Office of the Minnesota Secretary of State Certificate of Existence and Registration I, Steve Simon, Secretary of State of Minnesota, do certify that: The entity listed below was filed under the chapter of Minnesota Statutes listed below with the Office of the Secretary of State on the date listed below and that this entity or filing is registered at the time this certificate has been issued. Name:Minnesota 100 Club Date Filed:12/30/2020 File Number:1205422700026 Minnesota Statutes, Chapter:333 Home Jurisdiction:Minnesota This certificate has been issued on:05/24/2021 Steve Simon Secretary of State State of Minnesota City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-56 Motion By: Seconded By: A RESOLUTION ACCEPTING THE NORTHWEST AREA JAYCEES DONATION WHEREAS, the City of Corcoran supports the efforts of the Northwest Area Jaycees; and WHEREAS, the Northwest Area Jaycees made a financial donation to the City of Corcoran in the amount of $768.00 for the Parks and Trails Commission Tree Giveaway; WHEREAS, the Northwest Area Jaycees made a financial donation to the City of Corcoran in the amount of $100,000.00 for the City Park master planning; WHEREAS, the Northwest Area Jaycees made a financial donation to the City of Corcoran in the amount of $5,000.00 for the purchasing of Parks and Recreation equipment; WHEREAS, The City Council finds that it is appropriate to accept the donations as offered for the benefit of the Parks and Trails Commission Tree Giveaway, the City of Corcoran, and residents; NOW THEREFORE BE IT RESOLVED, the City Council of the City of Corcoran acknowledges the generosity of the Northwest Area Jaycees and graciously accepts the donations. VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan Thomas, Manoj Thomas, Manoj Whereupon, said Resolution is hereby declared adopted on this 10th day of June 2021. ________________________________ Tom McKee – Mayor ATTEST: ___________________________________ Jessica Beise – Administrative Services Director City Seal Agenda Item 7g. STAFF REPORT Agenda Item 8a. Council Meeting: June 10, 2021 Prepared By: Natalie Davis Topic: Development Rights Appeal for Outlot A of Outcalt 2nd Addition (PID 09-119-23-44- 0017) (City File No. 21-024) Action Required: Denial or Direction 60-Day Review Deadline: N/A 1. Application Request The applicants, Brandon and Chelsea Magnan, request for the City Council to grant a residential development right on Outlot A of Outcalt 2nd Addition. 2. Context Zoning and Land Use The parcel is located in the Rural Residential zoning district. Residential development within the Rural Residential zoning district is subject to Corcoran’s Development Rights Program intended as a growth management tool to preserve a rural residential environment with active agri-businesses by maintaining an overall density of roughly 1 residential unit per 10 acres. Additional density allowances are permitted as part of an Open Space and Preservation (OS&P) plat. History of The Parcel Outlot A is a lot of record with no building rights created as part of Outcalt 2nd Addition in 1988. The City’s records confirm the original parcel of roughly 22.7 acres was granted two development rights. Outcalt Addition was approved in 1986 with one development right assigned to Lot 1, Block 1, and the second development right was assigned to Outlot A. The plat shows two additional outlots: Outlot B (accommodating a private drive as well as a drainage and utility easement) and Outlot C. Outcalt 2nd Addition in 1988 allowed for a lot line adjustment between Lot 1, Block 1 and Outlot C. After this plat was approved, Lot 1, Block 1 became 9305 Foxline Drive (PID 09-119-23-44-0016). “Outlot C” became Outlot A of Outcalt 2nd Addition, the subject of this appeal. This lot line adjustment did not use the remaining building right, and Outlot A from Outcalt Addition remained intact. The remaining development right assigned to Outlot A of Outcalt Addition was used in Outcalt 3rd Addition approved in 2001 to create 9475 Trail Haven Rd (PID 09-119-23- 44-0018). Unbuildable Outlots The City updated the Subdivision Regulations in 2015 to prevent future unbuildable outlots unless approved as part of an Open Space and Preservation (OS&P) Plat or for stormwater management purposes. This ordinance update did not grant development rights to existing unbuildable parcels nor was this intended by subsequent updates to the Development Rights Program. There are a number of older subdivisions that resulted in outlots with no development rights that remain today as open space and/or used for agricultural purposes. Theoretically, an outlot with no development rights can be platted with an adjacent lot that still has multiple development rights in order to create a buildable parcel. In this instance, there are no remaining development rights on any adjacent properties . The City of Corcoran does not currently allow development rights to be transferred outside of a plat with an adjoining property. Development Rights Appeal Process Section 1070.070, Subd. 3 of the City Code allows for appeals to the Development Rights Map: “Should an objection to the number of development rights remaining on a particular property arise, the property owner may file an appeal to be heard by the City Council. All appeals should be submitted in writing to the Zoning Administrator and should state the calculation error or other justification for the objection. The Council may decide the matter at any regularly scheduled meeting. A property owner may only file a second appeal for the same property if the justification has changed.” Non-Conforming Lots Section 1030.010, Subd. 4 of the City Code establishes the rights of a non-conforming lot. The applicant cites the following portion of the City Code: A. Vacant or Redeveloped Lots. 1. A lot or parcel of land for which a deed or contract for deed has been recorded in the office of the Hennepin County Recorder upon, or prior to, the effective date of this Ordinance shall be deemed a buildable lot provided: a. The lot has frontage on a public right-of-way, or is governed by a valid driveway agreement, b. The lot has access to municipal sewer and water if located within the municipal urban service boundary, has an approved well and an approved on-site septic system or is able to provide a well and on-site septic system in compliance with all City and State requirements. c. The setback and yard requirements of the applicable zoning district can be achieved while simultaneously resulting in development that complies with the character and quality of the immediate area and the objectives of the City’s Comprehensive Plan and Zoning Ordinance. The City Code does not define what constitutes a non-conforming lot. The widely understood definition of a non-conforming lot is a lot that was created lawfully based on dimensional requirements of the prevailing zoning ordinances, but it no longer meets the minimum size requirements after the adoption, revision, or amendment to the requirements of the underlying zoning district. 3. Analysis of Request The applicants do not object to the calculation of the available (or lack thereof) of development rights indicated on the Development Rights Map. Rather, the applicants make the argument that Section 1030.010, Subd. 4 of the City Code justifies a development right to be granted for Outlot A. However, this portion of the code is meant to be applied to vacant lots that no longer meet the minimum size standards of the underlying zoning district due to an update in the Zoning Ordinance but are otherwise developable or re-developable. Outlot A conforms to the lot requirements in the Rural Residential zoning district and is recorded to have no development rights. The applicants’ narrative also alludes to an argument that an undevelopable lot qualifies as a non-conforming use. However, the use of this land as open space or for agriculture is a legally conforming use. Additionally, while Outlot A of Outcalt 2nd Addition does have frontage along a public right-of-way, the parcel is not included in the shared driveway agreement with the neighboring properties. Furthermore, an additional development right on this outlot would increase the density of the immediate area in a way that does not comply with the City’s Comprehensive Plan and Zoning Ordinance. Finally, if every unbuildable outlot in the City were to be granted additional development rights based on the applicant’s interpretation of Section 1030.010, Subd. 4, this would impact the character and quality of the surrounding areas in addition to conflicting with the current Comprehensive Plan and Zoning Ordinance. While the City should be careful to not deny landowners reasonable use of their property, the denial of a building permit is legally justified when the City has clear records documenting the exhaustion of development rights assigned to a given parcel. A development right was never approved for Outlot C of Outcalt Addition or Outlot A of Outcalt 2nd Addition. Additionally, the two residential development rights granted based on acreage of the original parcel were used to create 9305 Foxline Drive and 9475 Trail Haven Rd. Outlot A of Outcalt 2nd Addition was intentionally created based on the prevailing ordinances and the request of the landowner. Staff must base recommendations on the City records, unless legal proof of additional building rights not captured by the Development Rights Map is provided. This appeal does not provide evidence or justification of an error in the calculation of development rights assigned to Outlot A of Outcalt 2nd Addition. The portions of the City Code that discuss the Development Rights Program, Development Rights Map, and Development Rights Appeal process do not provide a mechanism for the City to grant a development right based on the discretion of the City Council. In order to grant a development right in this instance, the City will need to amend the Development Rights Program in a way that all similarly situated lots are treated the same. Such a change would mean that open space previously established as a lot of record with no building rights can further develop, particularly in neighborhoods designed with clustered housing and small lots. Such a change 40 years into the Development Rights Program will create winners and losers and may lead to the overall density in the rural area to exceed the intended 1 unit per 10 acres (without preservation of significant open space). This conflicts with the 2040 Comprehensive Plan, the Metropolitan Council’s system plans and guidelines, and the City’s ability to implement cost-effective and efficient wastewater treatment services in the future. 4. Recommendation Staff recommends denying the request to grant a development right on Outlot A of Outcalt 2nd Addition. If the City Council would like to grant a development right on this parcel, City Council should direct staff to proceed with an amendment to the Development Rights Program. 5. Council Action Consider a motion to deny the building rights appeal. Attachments: 1. Resolution 2021-59 2. Applicant’s Narrative 3. Letters of Support from Neighbors 4. Outcalt Addition Plat 5. Outcalt 2nd Addition Plat 6. Outcalt 3rd Addition Plat 7. Application submitted for Outcalt 3rd Addition 8. Driveway Agreement dated July 10, 1991 9. Planning Report for Outcalt 3rd Addition dated August 22, 2001 10. Development Rights Map City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-59 Page 1 of 2 Motion By: Seconded By: A RESOLUTION DENYING AN AMENDMENT TO THE DEVELOPMENT RIGHTS MAP FOR THE PARCEL KNOWN AS OUTLOT A OF OUTCALT 2ND ADDITION (PID 09-119-23-44- 0017) (CITY FILE 21-024) WHEREAS, Brandon and Chelsea Magnan filed an appeal to request a development right be granted on the subject property; WHEREAS, the Development Rights Map shows zero development rights remaining; WHEREAS, documentation of the original lot division in 1986 reflected two development rights granted between Lot 1, Block 1 and Outlot A of Outcalt Addition; WHEREAS, documentation of the lot division in 1988 did not reflect a development right granted to Outlot A of Outcalt 2nd Addition, and the development right assigned to Lot 1, Block 1 of Outcalt Addition was used to create 9305 Foxline Drive; WHEREAS, documentation of the lot division in 2001 reflects that the single remaining development right assigned to Outlot A of Outcalt Addition was used to create 9475 Trail Haven Rd; WHEREAS, Outlot A of Outcalt 2nd Addition is a lot of record with no building rights; WHEREAS, the City Council does not find the applicant has provided facts to support the finding that the Development Rights Map is in error; NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF CORCORAN, MINNESOTA, that it should and hereby does deny the appeal and request to modify the Development Rights Map to show 1 development right on the 10.38-acre parcel. VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Thomas, Manoj Thomas, Manoj Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan Whereupon, said Resolution is hereby declared adopted on this 10th day of June 2021. City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-59 Page 2 of 2 ________________________________ Tom McKee - Mayor ATTEST: ____________________________________ City Seal Jessica Beise – Administrative Services Director Brandon and Chelsea Magnan 5225 35th Ave N, Crystal MN 55422 May 17, 2021 Dear Corcoran City Council, My wife, Chelsea, and I are requesting a building right on Outlot A, Outcalt 2nd Addition (PID # 09-119-23-44-0017). This property is 10.38 acres off Trail Haven Rd and is currently vacant land without any reasonable option to utilize the lot. The property is located outside of the Metropolitan Urban Service Area. It is guided Rural/Ag Residential in the 2040 Future Land Use Map of the City’s Comprehensive Plan. The subject property and surrounding parcels are zoned Rural Residential. We ask the Council to carefully read and consider this information in their final resolution. The History The original parcel of land was a 22-acre parcel that was divided into three separate parcels in 1986 during the Outcalt Addition. In 1988, Outcalt 2nd Addition was approved, and property lines were adjusted to create 9305 Foxline Dr to the west of Outlot A, Outcalt 2nd Addition (PID # 09-119-23-44- 0017). In 2001, the northern property Outcalt 3rd Addition (9475 Trail Haven Rd Corcoran, MN 55340) was changed from an outlot to a buildable lot. Outlot A, Outcalt 2nd Addition is now left without a building right. The property is currently vacant and there are no existing structures. According to Corcoran’s current City Code, this parcel now fails to conform to the prevailing norms. The Building Rights Appeal Kendra Lindahl reported in an email correspondence on May 10, 2021, “While our City Code no longer allows developers to create unbuildable outlots like this, it was common practice and the 1980s and 1990s…” This is confirmed in City Code in section 1040.030 Subd. 7. “No lots or outlots shall be allowed to be created without development rights, except when approved as part of an Open Space and Preservation (OS&P) Plat as allowed by Section 940 of the Subdivision Ordinance.” Rural Residential District Code, as it relates to density requirements, does NOT mention outlot allowances as part of a clustering option. This is only mentioned in the Urban Reserve District Code. As a non-buildable outlot, Outlot A, Outcalt 2nd Addition is a vacant lot with no available uses landowner. Outlot A, Outcalt 2nd Addition is non-conforming to Corcoran’s current City Code. Non- conforming is defined as “A use of land, building or structure lawfully existing at the time of adoption of this Ordinance which does not comply with all the regulations of this Ordinance or any use of land, building or structure lawfully existing prior to the adoption of an amendment of this Ordinance which would not comply with all of the newly adopted regulations.” Corcoran’s city code addresses the concern of non-conforming vacant lots in 1030.010 Subd. 4. as follows: 1) A lot or parcel of land for which a deed or contract for deed has been recorded in the office of the Hennepin County Recorder upon, or prior to, the effective date of this Ordinance shall be deemed a buildable lot provided: a) The lot has frontage on a public right-of-way, or is governed by a valid driveway agreement. We comply because Outlot A, Outcalt 2nd Addition is a corner lot and has approximately 600 feet of frontage to Trail Haven Road on the eastern lot line. Furthermore, there is a private shared driveway agreement in place among the neighboring properties. Outlot A, Outcalt 2nd Addition has frontage to this private shared driveway on the northern lot line. b) The lot has access to municipal sewer and water if located within the municipal urban service boundary, has an approved well and an approved on-site septic system or is able to provide a well and on-site septic system in compliance with all City and State requirements. We comply as there are no current municipal sewer or water located within the property boundary. There are no existing on-site septic systems or wells. It is reasonable to assume that successful well and septic systems in compliance with City and State requirements can be provided as all neighboring properties have both. c) The setback and yard requirements of the applicable zoning district can be achieved while simultaneously resulting in development that complies with the character and quality of the immediate area and the objectives of the City’s Comprehensive Plan and Zoning Ordinance • We comply because the lot is 10.38 acres and is capable of meeting the setback requirements for the Rural Residential district. The landowners also desire to maintain the rural nature of the property by placing one single-family dwelling on the property as a hobby farm. This home will meet similar quality and character standards of the homes neighboring the property. • Support from the immediate neighbors has also been given in writing for the development of a single-family dwelling on Outlot A, Outcalt 2nd Addition. This is significant because the neighbors would value a home placed on the lot more than they value the vacant space. See the attached document for further information and narratives from the neighbors. In summary, Outlot A, Outcalt 2nd Addition was legally created in 1988 in conformance to regulations and ordinances in effect at the time of its completion. However, Outcalt 2nd Addition has been sitting vacant as an unbuildable lot for 32 years. The regulations which governed the land’s use no longer comply with the subsequently enacted laws and ordinances having jurisdiction today. There is no documentation or correspondence, either by the developer or the city, that indicates this lot was reserved/intended for open space. Believing Outlot A, Outcalt 2nd Addition was intentionally left as open space is an assumption, and there is no way of discerning intentions from 1988 due to the lack of documentation. Furthermore, Outlot A, Outcalt 2nd Addition was not approved as part of an OS&P during development. Therefore, requiring Outlot A, Outcalt 2nd Addition to remain open for this purpose should not apply. The land’s lack of useful options places an untoward burden of maintenance for weed control on the landowners without assistance from the neighbors or the City. It is costly for the landowner in both time and money. Considering overwhelming neighborhood support was given for a single-family dwelling in comparison to remaining open space, the cost burden has been fruitless. The neighbors do not cherish this lot as open space but would rather see Outlot A, Outcalt 2nd Addition contribute to the rural community in the form of a residential hobby farm. The Resolution Request Our request is that the City Council rectify this situation in accordance with its current City Code. Please allow the landowners to make use of the otherwise vacant and burdensome Outlot A, Outcalt 2nd Addition by deeming it buildable as directed by the non-conforming lot section of code. We are requesting one development right to build a single-family dwelling that is in keeping with the purpose of the Rural Residential District as stated in section 1040.030 Subd. 1. “The purpose of this district is to provide large lots for single family homes and hobby farms. The district is intended to preserve Corcoran’s rural character and its identity as a unique community within the Twin Cities metropolitan area. This district allows residential and agricultural uses that will preserve the rural nature of Corcoran and directly related, complementary uses. Municipal services (sanitary sewer and municipal water) will not be available in these areas.” In guiding a resolution, 1040.030 subd 7a of the Rural Residential density requirements states “Landowners shall be permitted one development right for each 10 acres of land.” According to the general rules in section 1020.010 section C states, “the words “shall” and “must” are mandatory…” We comply with the density requirements as this land is over 10 acres regardless of the neighboring property sizes or prior rights allocations. My wife, Chelsea, and I are desperate to move away from stressful hustle and bustle of Minneapolis. She is an Emergency Room nurse at Abbott Northwestern, and it has been difficult for her to find rest and recovery living in the city. We are seeking to set down roots in the City of Corcoran to start a family, as well as contribute to a small rural community like the ones we grew up in. Our vision is to have our children enjoy neighborhood little league, county 4-H, and unencumbered free space to play. We want our children to grow up in safe wide-open spaces like we did. We believe Corcoran offers all these opportunities and, undoubtedly, more. We view Corcoran as being an excellent fit for our future, and we also believe that we are a good match for the City of Corcoran. It truly is the preference of the applicant to contribute to the City of Corcoran as excellent neighbors and responsible constituents. Finally, we ask that the council be good stewards of the land within the boundaries of the City of Corcoran and allow the landowner to make use of their property that is in keeping with the rural spirit of Corcoran. It is frankly unreasonable that the City should hold a privately owned lot in such restrictions rendering it unusable when the lot is non-conforming to the expressed standards of current City Code. Please consider voting in a manner that honors the desires of the applicants as well as the neighboring homes. We have spoken with and met the neighbors of Outlot A, Outcalt 2nd Addition and they are all wonderful and kind individuals who would rather see this land used for a family as opposed to agriculture or open space. Candidly, there is little hope of our dreams advancing without the assistance of the Corcoran City Council’s yea vote in accordance with the desires of the applicants, neighbors, and as instructed by City Code. Our honorable intentions and wishes cannot be overstated. The Council’s help and support would change our lives forever. Thank you for your valuable time and attention in this matter. Sincerely, Brandon & Chelsea Magnan 612-791-4792 $ $ $ $ $ $ $ $ !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ROADSCHUTTE GLEASON ROAD JUBERT LAKE MEISTER ROAD OLD SETTLERS RD HORSESHOE TRAIL STIEG RD WILLOW DRIVEHACKAM ORE ROADTRAIL HAVEN ROADCAIN ROADO A K D A L E D R STREHLER ROAD PIONEER TR COUN TY R OAD 117 ROLLLING HILLS RDLARKIN RD TOWNSHIP OF HASSAN CITY OF GREENFIELDCITY OF MAPLE GROVESCOTT LAKEBECHTOLD ROADMORINLAKE GOOSELAKE COOKLAKE RUSH CREEK 17 3 9 16 8 8 8 8 8 8 8 8 8 8 8 13 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 7 8 8 8 7 7 7 7 7 7 7 7 7 8 13 7 2 12 7 7 7 7 7 12 5 2 12 8 8 12 7 77 1 17 12 12 6 7 5 6 6 7 10 6 10 6 6 10 3 5 6 7 6 5 5 5 10 5 7 2 5 5 5 5 4 5 5 1 5 4 4 4 4 4 4 4 4 4 4 4 44 4 4 4 4 4 4 4 4 4 410 4 4 4 4 4 4 4 4 4 4 4 4 1 4 2 4 7 4 4 4 3 4 4 1 4 4 4 4 4 4 4 4 4 4 4 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 2 3 4 3 3 2 4 5 3 3 42 1 2 2 2 2 2 2 2 2 2 2 2 1 12 2 2 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 1 2 1 1 3 1 4 2 1 10 19 30 55 50 116 117 101 Developmen t Righ ts Map+* 4 3,000 0 3,0001,500 Feet Parcels Parcels Enrolled in the MetropolitanAgricultural Preserve Program City ofCORCORAN Current as of June 16, 2020 *Existing vacant lots of record which show no building rights may have one building right remaining. Please confer with the City Planner to confirm the actual number of building rights. +Building rights shown do not account for any existinghomes on the lot. Existing homes will count towardthe allowed development rights. STAFF REPORT Agenda Item 8b. Council Meeting: June 10, 2021 Prepared By: Natalie Davis Topic: Interim Ordinance Establishing a Development Moratorium within the Northeast District of Corcoran Action Required: Approval Summary: The current boundaries of the Northeast District are defined by the Municipal Urban Service Area boundary to the west, County Road 101 to the east, the Corcoran side of County Road 117 to the north, and the properties along the north side of Schutte Road to the south (the “Northeast District”). The City of Corcoran is in the middle of an extensive study for water supply planning in the Northeast District. Additionally, City Staff plans to move forward with formal study for the adoption of updated design standards and area plan in the Northeast District. A grant application to fund this study was submitted to Hennepin County June 8, 2021 . Regardless of this grant, this study was identified by City Staff and the City Council as a 2021 priority. The results of both of these studies will have a substantial impact on the orderly planning and development of the Northeast District. Development pressures in the Northeast District are growing faster than anticipated due to transportation improvements along County Road 101, and discussions with potential housing, commercial, and industrial developers suggest approved development will quickly outpace the water supply in the area at the current rate of interest. This is problematic as the City of Maple Grove has not agreed to selling the City of Corcoran additional water supply. Additionally, large and long-term developments along significant transportation corridors in the Northeast District may be proposed and considered prior to the establishment of standards that honor the vision of the community. An interim ordinance would allow the City of Corcoran to temporarily restrict development of the land in the Northeast District of Corcoran to protect the planning processes as well as the long-term health, safety, and welfare of the citizens of Corcoran. The proposed moratorium will permit the City to complete meaningful study without the pressure of time caused by pending applications. The maximum period of such a moratorium is one (1) year, but a moratorium may be lifted by Council action prior to this if the studies are completed earlier. A development moratorium can be specifically targeted to new plats, Planned Unit Developments, site plans, Conditional Use Permits, and building permits not associated with a previously approved project . This would allow for developers to still bring in Rezoning and Comprehensive Plan Amendment requests during the moratorium to gage viability of projects proceeding once the moratorium is lifted. Other applications exempted in the proposed interim ordinance include certificates of compliance, variances for additions to existing structures, and grading permits. A moratorium would not impact applications which have received preliminary approval prior to its effective date. We also cannot use the moratorium to extend the 60-day review deadline on existing applications. New applications received at this point can be denied based on the moratorium, but a formal denial will need to be made. Once the moratorium is in effect, prohibited applications within the Northeast District will not be accepted. Financial/Budget: Enacting the moratorium is not anticipated to impact the budget. Recommendation: Staff recommends adoption of the Ordinance establishing a 1-year development moratorium within the Northeast District of Corcoran. Council Action: Consider a motion to adopt ordinance 2021-415. Attachments: 1. Ordinance 2021-415 2. Summary Ordinance 2021-416 3. Written Notice 4. Map of the Northeast District City of Corcoran June 10, 2021 County of Hennepin State of Minnesota ORDINANCE NO. 2021-415 Page 1 of 2 Motion By: Seconded By: AN INTERIM ORDINANCE OF THE CITY OF CORCORAN, MINNESOTA PROHIBITING APPROVAL OF NEW PLATS, PLANNED UNIT DEVELOPMENTS, CONDITIONAL USE PERMITS, AND BUILDING PERMITS. THE CITY COUNCIL OF THE CITY OF CORCORAN, MINNESOTA, ORDAINS: Section 1. Recitals 1. The City of Corcoran has not received conditional use permit (CUP) applications for the development in the Study Area; and 2. The City of Corcoran has not received building permit applications outside of projects granted preliminary approvals in the Study Area; and 3. The City of Corcoran has received two complete plat and Planned Unit Development (PUD) applications for Amberley and Bellwether (City File No. 21-017) for the Study Area which will be exempt from this ordinance; and 4. The City Council is actively studying water supply planning in the Study Area generally bounded by County Road 117, County Road 101, Schutte Road, and the MUSA boundary (the “Northeast District”) and intends to study design standards and implement updates to the Northeast District master plan. 5. A moratorium on development in the Study Area within the Corcoran city limits, which is depicted on the attached graphic titled “Proposed Master Planning Area” is needed to allow time to finalize water supply planning, correct any defects, or clear up any ambiguities in the City’s Comprehensive Plan and zoning ordinance, and to provide additional information that will be beneficial for the future development of properties in the Study Area. Section 2. Definitions. The following terms, whenever used in this ordinance, shall be interpreted to mean: Plat – A drawing or map of a subdivision prepared for filing of record pursuant to Minnesota Statutes Chapter 505, and containing all the elements set forth in Shakopee city code adopted pursuant to Minn. Stat. 462.358 and Chap. 505. Section 3. Purpose and Intent. The City desires to conduct an in-depth study of the following: - Water supply and treatment infrastructure development in the Study Area; - The most desirable mix of residential, commercial, and industrial uses in the Study Area; - The most desirable design standards in the Study Area. Minnesota Statutes, Section 462.355 Subdivision 4 allows the City to adopt an interim ordinance to protect the City’s planning process and the health, safety and welfare of the citizens of the community. The City Council finds that it is necessary to adopt an interim ordinance to allow sufficient time for the studies to be conducted to determine whether there is a need to amend the City’s official controls or its comprehensive plan. City of Corcoran June 10, 2021 County of Hennepin State of Minnesota ORDINANCE NO. 2021-415 Page 2 of 2 Section 4. Temporary Prohibition. 1. Pending the completion of the studies referred to above, plat, PUD, and CUP applications for development shall not be processed, approved, or accepted. 2. Pending the completion of the studies referred to above, building permits not associated with a project that received preliminary approvals prior to the effective date of this ordinance shall not be processed, approved, or accepted. 3. Pending the completion of the studies referred to above, site plans not associated with a rezoning or comprehensive plan amendment application shall not be processed or accepted. Section 5. Permitted Applications. Complete applications for rezoning, comprehensive plan amendments, variances for additions of existing structures, certificates of compliance, grading permits, and building permits associated with a project that received preliminary approvals prior to this ordinance will be accepted and processed. Section 6. Area Impacted by the Moratorium. This moratorium shall apply only to the land within the Northeast District of the city limits. The total Study Area is bordered by the Municipal Urban Service Area boundary to the west, County Road 101 to the east, County Road 117 to the north, and the properties along the north side of Schutte Road to the south, all located in Hennepin County, Minnesota. Section 7. Effective Date. This Ordinance becomes effective from and after the date of its passage, and shall remain in effect until June 10, 2022 or the date of acceptance of the above-named land use studies by the City Council, whichever occurs first. Adopted by City Council on the 10th day of June, 2021. VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Thomas, Manoj Thomas, Manoj Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan ________________________________ Tom McKee - Mayor ATTEST: ____________________________________ City Seal Jessica Beise – Administrative Services Director City of Corcoran June 10, 2021 County of Hennepin State of Minnesota ORDINANCE NO. 2021-416 Page 1 of 1 Motion By: Seconded By: SUMMARY OF ORDINANCE NO. 2021-415 AN INTERIM ORDINANCE OF THE CITY OF CORCORAN, MINNESOTA PROHIBITING APPROVAL OF NEW PLATS, PLANNED UNIT DEVELOPMENTS, CONDITIONAL USE PERMITS, AND BUILDING PERMITS. Ordinance 2021-0415 issues a moratorium on development applications for new plats, Planned Unit Developments, Conditional Use Permits, and Building Permits within the Northeast District of Corcoran, Minnesota pending the study of water supply and treatment planning and revised standards as part of a master plan. A printed copy of the complete ordinance is available for inspection by any person at City Hall during the City Clerk’s regular office hours. VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Thomas, Manoj Thomas, Manoj Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan Whereupon, said Ordinance is hereby declared adopted on this 10th day of June, 2021. ________________________________ Tom McKee - Mayor ATTEST: ____________________________________ City Seal Jessica Beise – Administrative Services Director CITY OF CORCORAN 8200 County Road 116, Corcoran, MN 55340 763.420.2288 – Office 763.420.6056 – Fax E-mail - general@ci.corcoran.mn.us / Web Site - www.ci.corcoran.mn.us CITY OF CORCORAN NOTICE OF PUBLIC HEARING Interim Ordinance for up to a One (1) Year Moratorium on Development within the Northeast District Notice is hereby given that the Corcoran City Council will hold a public hearing at City Hall, 8200 County Road 116, on Thursday, June 10, 2021 at 7:00 PM or as soon thereafter as possible, to consider an interim ordinance that would establish up to a one (1) year moratorium on development applications for properties within the Northeast District of Corcoran. The proposed interim ordinance and map of impacted properties is available at City Hall upon request. The purpose of the moratorium would be to allow time for the completion of a water supply and treatment infrastructure planning study and master land use planning study for the lands in the Northeast District. Planning for the entire study area in a comprehensive way will prevent development from outpacing the City’s water capacity, may lead to more effective and efficient layout and investment in infrastructure, and enable staff to advocate for the community’s long- term vision for the area. It is possible that the study would be completed sufficiently within six (6 months), in which case it would be anticipated that the moratorium would be lifted before the expiration of one (1) year. All persons wishing to speak on this item will be heard. Comments may be submitted in writing prior to the meeting. Due to the COVID-19 health pandemic, public meetings may be held by telephone or other electronic means pursuant to Minnesota Statute 13D.021. Please visit the City’s website at www.ci.corcoran.mn.us for up-to-date information about the City Council meeting. ____________________________ Natalie Davis, Planner ______________________ Dated: June 4, 2021 June 4, 2021 CITY OF CORCORAN 8200 County Road 116, Corcoran, MN 55340 763.420.2288 – Office 763.420.6056 – Fax E-mail - general@ci.corcoran.mn.us / Web Site - www.ci.corcoran.mn.us 06/04/2021 Pulte Homes ATTN: Paul Heuer & Dean Lotter 7500 Flying Cloud Drive, Suite 670 Eden Prairie, MN 55344 RE: Proposed Interim Ordinance for up to a One (1) Year Moratorium on Development Dear Eric & Erik: On Thursday, June 10, 2021, at or about 7:00 p.m., the Corcoran City Council will hold a public hearing at City Hall, 8200 County Road 116, to consider the adoption of an interim ordinance that would establish up to a one (1) year moratorium on development applications for properties within the Northeast District of Corcoran. The Amberley & Bellwether application (City File No. 21-017) is specifically exempt from the proposed interim ordinance, but legal notice is required to all impacted housing proposals three (3) business days prior to the public hearing per Minnesota State Statute. Detailed information will be available in the City Council packet on the City’s website as of 6/4/2021 and upon request. The purpose of the moratorium would be to allow time for the completion of a water supply and treatment infrastructure planning study and master land use planning study for the lands in the Northeast District depicted on the attached map. Planning for the entire study area in a comprehensive way will prevent development from outpacing the City’s water capacity, may lead to the more effective and efficient layout and investment in infrastructure, and enable staff to advocate for the community’s long-term vision for the area. It is possible that the study will be completed sufficiently within six (6 months), in which case it would be anticipated that the moratorium would be lifted before the expiration of one (1) year. If you have any questions regarding either the June 10th meeting and proposed action, or the proposed studies, please feel free to contact me at 763-258-4272 or ndavis@corcoranmn.gov. Sincerely, Natalie Davis Planner CITY OF CORCORAN 8200 County Road 116, Corcoran, MN 55340 763.420.2288 – Office 763.420.6056 – Fax E-mail - general@ci.corcoran.mn.us / Web Site - www.ci.corcoran.mn.us 06/04/2021 Ebert Construction ATTN: Greg Hayes 23350 County Road 10 Corcoran, MN 55357 RE: Proposed Interim Ordinance for up to a One (1) Year Moratorium on Development Dear Greg : As discussed previously, on Thursday, June 10, 2021, at or about 7:00 p.m., the Corcoran City Council will hold a public hearing at City Hall, 8200 County Road 116, to consider the adoption of an interim ordinance that would establish up to a one (1) year moratorium on development applications for properties within the Northeast District of Corcoran. Detailed information will be available in the City Council packet on the City’s website as of 6/4/2021 and upon request. The purpose of the moratorium would be to allow time for the completion of a water supply and treatment infrastructure planning study and master land use planning study for the lands in the Northeast District depicted on the attached map. Planning for the entire study area in a comprehensive way will prevent development from outpacing the City’s water capacity, may lead to the more effective and efficient layout and investment in infrastructure, and enable staff to advocate for the community’s long-term vision for the area. It is possible that the study will be completed sufficiently within six (6 months), in which case it would be anticipated that the moratorium would be lifted before the expiration of one (1) year. If you have any questions regarding either the June 10th meeting and proposed action, or the proposed studies, please feel free to contact me at 763-258-4272 or ndavis@corcoranmn.gov. Sincerely, Natalie Davis Planner CITY OF CORCORAN 8200 County Road 116, Corcoran, MN 55340 763.420.2288 – Office 763.420.6056 – Fax E-mail - general@ci.corcoran.mn.us / Web Site - www.ci.corcoran.mn.us 06/04/2021 Continental Properties ATTN: Eric Thom & Erik Hahn W134 N8675 Executive Parkway Menomonee Falls, WI 53051-3310 RE: Proposed Interim Ordinance for up to a One (1) Year Moratorium on Development Dear Eric & Erik: As discussed previously, on Thursday, June 10, 2021, at or about 7:00 p.m., the Corcoran City Council will hold a public hearing at City Hall, 8200 County Road 116, to consider the adoption of an interim ordinance that would establish up to a one (1) year moratorium on development applications for properties within the Northeast District of Corcoran. Detailed information will be available in the City Council packet on the City’s website as of 6/4/2021 and upon request. The purpose of the moratorium would be to allow time for the completion of a water supply and treatment infrastructure planning study and master land use planning study for the lands in the Northeast District depicted on the attached map. Planning for the entire study area in a comprehensive way will prevent development from outpacing the City’s water capacity, may lead to the more effective and efficient layout and investment in infrastructure, and enable staff to advocate for the community’s long-term vision for the area. It is possible that the study will be completed sufficiently within six (6 months), in which case it would be anticipated that the moratorium would be lifted before the expiration of one (1) year. If you have any questions regarding either the June 10th meeting and proposed action, or the proposed studies, please feel free to contact me at 763-258 -4272 or ndavis@corcoranmn.gov. Sincerely, Natalie Davis Planner STAFF REPORT Agenda Item 9a. Council Meeting: June 10, 2021 Prepared By: Jessica Beise Topic: Finance Software Request for Proposal Action Required: Approval Summary: In 2019 staff b egan to explore the need for more robust software for many City functions including accounting, permitting, and utility billing. As part of the 2020-2021 Capital Improvement Plan, the City has dedicated $50,000 toward software. To assist with the search for software staff received a quotes for consultant services and bega n to work with Bergen KDV to outline an RFP for software services and complete a review of the financial processes Staff received 3 responses to the RFP with two vendors (Tyler and BS &A) prov iding all the preferred system and one vendor providing a payroll system option (Berg en KDV providing Kronos). Staff conducted demonstrations with Tyler Technologies and BS&A Software in late April and early May respectively. Staff reached out to City’s in the Twin Cities metro area t o get feedback from their finance staff and received favorable feedback . Staff recommends moving forward with the BS&A software with utilizi ng Kronos as the payroll option. BS&A’s software was intuitive and is more responsibly priced for the 10-year price to own. Additionally, BS&A’s pr oposal would be paired down a bit with preferring a separate payroll, timing keeping, and human resources functions as well as purchase orders and invoicing would not be added due to our limited use of purchase orders and invoicing. Staff heard from severa l City’s their positive response related to customer service from BS&A. Staff recommends Kronos through BergenKVD as the payroll vendor . BergenKDV provides de dicated support for Kronos payroll as well as processes all the taxes and required state and federal reporting as well as W2s. As payroll taxes and reporting are comp licated and are currently provided by ADP, staff prefers a vendor who can provide those services. In the proposal, it provides a cost for timekeeping machines however the City would not need these as there is a mobile application that staff log into rather than punching in on site. The costs for running payroll are similar to our current provider for payroll and timekeeping. Financial/Budget: Total Project Implementation Costs: Software Implementation and Financial Process Review $20,000 BS&A Implementation $114,790 Kronos Payroll Implementation $5,300 Funding Sources: 2020-2021 Capital Improvement Plan $50,000 General Fund $50,090 Water Fund $20,000 Sewer Fund $20,000 A portion of the general fund budget projection was contemplated in the 2021 budget and the remainder would be unbudgeted. Options: 1. Authorize staff to proceed forward with implementing BS&A software and Kronos for payroll. 2. Decline to proceed forward with implementing BS&A software and Kronos for payroll. Recommendation Consi der a motion to authorizing staff to proceed forward with implementing BS&A software and Kronos for payroll. Council Action: Consi der a motion to authorizing staff to proceed forward with implementing BS&A software and Kronos for payroll. Attachments: Attachments 1, 3 and 5 wi ll be included on the online packet as these are large documents. 1. Tyler Technologies – RFP Response – SEE ONLINE PAC KET 2. Tyler Technologies Cost Proposal 3. BS & A – RFP Response – SEE ONLINE PAC KET 4. BS & A Cost Proposal 5. Kronos – RFP Proposal – SEE ONLINE PACKET 6. Kronos – Cost Proposal KZ/'/E> ŝƚLJŽĨŽƌĐŽƌĂŶ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵ dĞĐŚŶŝĐĂůWƌŽƉŽƐĂů dŚƵƌƐĚĂLJ͕&ĞďƌƵĂƌLJϭϴ͕ϮϬϮϭ ŽĚLJ'ƵŶƐƚĞŶƐŽŶͲĐĐŽƵŶƚdžĞĐƵƚŝǀĞ ϱϱϭϵϱϯƌĚ^ƚƌĞĞƚ͕>ƵďďŽĐŬ͕dyϳϵϰϭϰ WŚŽŶĞ͗Ϯϭϰ͘ϱϳϴ͘ϱϭϲϲ ŵĂŝů͗ŽĚLJ͘'ƵŶƐƚĞŶƐŽŶΛƚLJůĞƌƚĞĐŚ͘ĐŽŵ KWz ŝƚLJŽĨŽƌĐŽƌĂŶ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵ dĞĐŚŶŝĐĂůWƌŽƉŽƐĂů dŚƵƌƐĚĂLJ͕&ĞďƌƵĂƌLJϭϴ͕ϮϬϮϭ ŽĚLJ'ƵŶƐƚĞŶƐŽŶͲĐĐŽƵŶƚdžĞĐƵƚŝǀĞ ϱϱϭϵϱϯƌĚ^ƚƌĞĞƚ͕>ƵďďŽĐŬ͕dyϳϵϰϭϰ WŚŽŶĞ͗Ϯϭϰ͘ϱϳϴ͘ϱϭϲϲ ŵĂŝů͗ŽĚLJ͘'ƵŶƐƚĞŶƐŽŶΛƚLJůĞƌƚĞĐŚ͘ĐŽŵ ZĞƐƚƌŝĐƚŝŽŶƐŽŶŝƐĐůŽƐƵƌĞ dŚŝƐƉƌŽƉŽƐĂůĨƌŽŵdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘;͞dLJůĞƌ͟ͿĐŽŶƚĂŝŶƐƉƌŽƉƌŝĞƚĂƌLJĂŶĚĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶ͕ ŝŶĐůƵĚŝŶŐƚƌĂĚĞƐĞĐƌĞƚƐ͕ďĞůŽŶŐŝŶŐƚŽdLJůĞƌŽƌdLJůĞƌ͛ƐƉĂƌƚŶĞƌƐ͘dLJůĞƌŝƐƐƵďŵŝƚƚŝŶŐƚŚŝƐƉƌŽƉŽƐĂůŽŶƚŚĞĞdžƉƌĞƐƐ ĐŽŶĚŝƚŝŽŶƚŚĂƚƚŚĞĨŽůůŽǁŝŶŐƉŽƌƚŝŽŶƐǁŝůůŶŽƚďĞĚƵƉůŝĐĂƚĞĚ͕ĚŝƐĐůŽƐĞĚ͕ŽƌŽƚŚĞƌǁŝƐĞŵĂĚĞĂǀĂŝůĂďůĞ͕ĞdžĐĞƉƚĨŽƌ ŝŶƚĞƌŶĂůĞǀĂůƵĂƚŝŽŶƉƵƌƉŽƐĞƐ͗ xZĞƐƉŽŶƐĞƚŽƚŚĞ&ƵŶĐƚŝŽŶĂůZĞƋƵŝƌĞŵĞŶƚƐ͕Žƌ͞ŚĞĐŬůŝƐƚ͟ x>ŝŶĞͲŝƚĞŵƉƌŝĐŝŶŐ;ƚŽƚĂůƉƌŽƉŽƐĞĚĐŽŶƚƌĂĐƚĂŵŽƵŶƚŵĂLJďĞĚŝƐĐůŽƐĞĚͿ x^ĐƌĞĞŶƐŚŽƚƐ͕ŝĨĂŶLJ xĞƚĂŝůĞĚŝŶĨŽƌŵĂƚŝŽŶƌĞŐĂƌĚŝŶŐĐƵƌƌĞŶƚĐƵƐƚŽŵĞƌƐ xĞƚĂŝůĞĚĞŵƉůŽLJĞĞƌĞƐƵŵĞƐͬsƐ xƵƐƚŽŵŝnjĞĚ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬͬ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ dŽƚŚĞĞdžƚĞŶƚĚŝƐĐůŽƐƵƌĞŽĨƚŚŽƐĞƉŽƌƚŝŽŶƐŝƐƌĞƋƵĞƐƚĞĚŽƌŽƌĚĞƌĞĚ͕dLJůĞƌƌĞƋƵŝƌĞƐǁƌŝƚƚĞŶŶŽƚŝĐĞŽĨƚŚĞ ƌĞƋƵĞƐƚŽƌŽƌĚĞƌ͘/ĨĚŝƐĐůŽƐƵƌĞŝƐƐƵďũĞĐƚƚŽdLJůĞƌ͛ƐƉĞƌŵŝƐƐŝŽŶ͕dLJůĞƌǁŝůůŐƌĂŶƚƚŚĂƚƉĞƌŵŝƐƐŝŽŶŝŶǁƌŝƚŝŶŐ͕ŝŶ dLJůĞƌ͛ƐƐŽůĞĚŝƐĐƌĞƚŝŽŶ͘/ĨĚŝƐĐůŽƐƵƌĞŝƐƐƵďũĞĐƚƚŽĂĐŽƵƌƚŽƌŽƚŚĞƌůĞŐĂůŽƌĚĞƌ͕dLJůĞƌǁŝůůƚĂŬĞǁŚĂƚĞǀĞƌĂĐƚŝŽŶ dLJůĞƌĚĞĞŵƐŶĞĐĞƐƐĂƌLJƚŽƉƌŽƚĞĐƚŝƚƐƉƌŽƉƌŝĞƚĂƌLJĂŶĚĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶĂŶĚǁŝůůĂƐƐƵŵĞĂůů ƌĞƐƉŽŶƐŝďŝůŝƚLJĂŶĚůŝĂďŝůŝƚLJĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĂƚĂĐƚŝŽŶ͘ dLJůĞƌĂŐƌĞĞƐƚŚĂƚĂŶLJƉŽƌƚŝŽŶƐŶŽƚůŝƐƚĞĚĂďŽǀĞĂŶĚŵĂƌŬĞĚĂĐĐŽƌĚŝŶŐůLJĂƌĞƚŽďĞŵĂĚĞĂǀĂŝůĂďůĞĨŽƌƉƵďůŝĐ ĚŝƐĐůŽƐƵƌĞ͕ĂƐƌĞƋƵŝƌĞĚƵŶĚĞƌĂƉƉůŝĐĂďůĞƉƵďůŝĐƌĞĐŽƌĚƐůĂǁƐĂŶĚƉƌŽĐƵƌĞŵĞŶƚƉƌŽĐĞƐƐĞƐ͘ dƌĂĚĞŵĂƌŬƐŝƐĐůĂŝŵĞƌ ĞĐĂƵƐĞŽĨƚŚĞŶĂƚƵƌĞŽĨƚŚŝƐƉƌŽƉŽƐĂů͕ƚŚŝƌĚͲƉĂƌƚLJŚĂƌĚǁĂƌĞĂŶĚƐŽĨƚǁĂƌĞƉƌŽĚƵĐƚƐŵĂLJďĞŵĞŶƚŝŽŶĞĚďLJ ŶĂŵĞ͘dŚĞƐĞŶĂŵĞƐŵĂLJďĞƚƌĂĚĞŵĂƌŬĞĚďLJƚŚĞĐŽŵƉĂŶŝĞƐƚŚĂƚŵĂŶƵĨĂĐƚƵƌĞƚŚĞƉƌŽĚƵĐƚƐ͘/ƚŝƐŶŽƚdLJůĞƌ͛Ɛ ŝŶƚĞŶƚƚŽĐůĂŝŵƚŚĞƐĞŶĂŵĞƐŽƌƚƌĂĚĞŵĂƌŬƐĂƐŽƵƌŽǁŶ͘ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞŝ dŚƵƌƐĚĂLJ͕&ĞďƌƵĂƌLJϭϴ͕ϮϬϮϭ ŽǀĞƌ>ĞƚƚĞƌ ŝƚLJŽĨŽƌĐŽƌĂŶ :ĞƐƐŝĐĂĞŝƐĞ ĚŵŝŶŝƐƚƌĂƚŝǀĞ^ĞƌǀŝĐĞƐŝƌĞĐƚŽƌ ϴϮϬϬŝƚLJZŽĂĚϭϭϲ ŽƌĐŽƌĂŶ͕DEϱϱϯϰϬ ĞĂƌ:ĞƐƐŝĐĂĞŝƐĞ͕ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘;dLJůĞƌͿŝƐƉůĞĂƐĞĚƚŽƐƵďŵŝƚƚŚĞĞŶĐůŽƐĞĚƉƌŽƉŽƐĂůĨŽƌLJŽƵƌĞǀĂůƵĂƚŝŽŶĂŶĚ ĐŽŶƐŝĚĞƌĂƚŝŽŶŝŶƌĞƐƉŽŶƐĞƚŽƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶ͛ƐZ&WĨŽƌŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵ dĞĐŚŶŝĐĂůWƌŽƉŽƐĂů͘ dŚĞĂƚƚĂĐŚĞĚƉƌŽƉŽƐĂůĚĞƚĂŝůƐŽƵƌĐŽŵƉůĞƚĞŽĨĨĞƌŝŶŐ͘/ƚŝŶĐůƵĚĞƐ͗ x/ŶĐŽĚĞƐŽĨƚǁĂƌĞĂƉƉůŝĐĂƚŝŽŶƐ xƵƐŝŶĞƐƐWƌŽĐĞƐƐĂƐƐĞƐƐŵĞŶƚΘĐŽŶƐƵůƚŝŶŐ x/ŵƉůĞŵĞŶƚĂƚŝŽŶŽĨƐŽĨƚǁĂƌĞΘƐĞƌǀŝĐĞƐ xdĞĐŚŶŝĐĂůĂŶĚĨƵŶĐƚŝŽŶĂůƐƚĂĨĨƚƌĂŝŶŝŶŐ xKŶŐŽŝŶŐŵĂŝŶƚĞŶĂŶĐĞΘƐƵƉƉŽƌƚ dLJůĞƌŚĂƐĐĂƌĞĨƵůůLJƌĞǀŝĞǁĞĚƚŚĞƉƌŽũĞĐƚŐŽĂůƐ͕ƐƚĂƚĞĚŽďũĞĐƚŝǀĞƐ͕ĂŶĚƌĞƋƵŝƌĞŵĞŶƚƐĚĞĨŝŶĞĚǁŝƚŚŝŶƚŚĞZ&W͕ ĂŶĚǁĞĂƌĞĞdžĐŝƚĞĚĂďŽƵƚƚŚĞŽƉƉŽƌƚƵŶŝƚLJƚŽǁŽƌŬǁŝƚŚƚŚĞŝƚLJŽŶƚŚŝƐƉƌŽũĞĐƚ͘tĞĂƌĞĐŽŶĨŝĚĞŶƚƚŚĂƚdLJůĞƌ͛Ɛ /ŶĐŽĚĞƐŽůƵƚŝŽŶďƌŝŶŐƐƚŚĞƌŝŐŚƚŵŝdžŽĨƌĞƐŽƵƌĐĞƐ͕ĞdžƉĞƌŝĞŶĐĞ͕ĂŶĚƚĞĐŚŶŽůŽŐLJƚŽĨŽƐƚĞƌĂŶĞŶǀŝƌŽŶŵĞŶƚĨŽƌ ƐƵĐĐĞƐƐ͘ dLJůĞƌƉƌŽǀŝĚĞƐ͗ x^ƚƌĞŶŐƚŚʹdLJůĞƌ͛ƐƐƚƌŽŶŐĨŝŶĂŶĐŝĂůƉŽƐŝƚŝŽŶĂŶĚƐŽůŝĚďƵƐŝŶĞƐƐƉůĂŶĞŶƐƵƌĞƐƚŚĂƚLJŽƵƌ/ŶĐŽĚĞƐŽĨƚǁĂƌĞ ŝƐƐĂĨĞĨƌŽŵĞĐŽŶŽŵŝĐĚŽǁŶƚƵƌŶƐ͘ƐĂƉƵďůŝĐůLJƚƌĂĚĞĚĐŽŵƉĂŶLJ͕ƚŚĞĨŝŶĂŶĐŝĂůƐƚƌĞŶŐƚŚŽĨdLJůĞƌŝƐ ƚƌĂŶƐƉĂƌĞŶƚ͘dLJůĞƌ͛ƐƉƌŽǀĞŶƚƌĂĐŬƌĞĐŽƌĚĂŶĚůŽŶŐͲƚĞƌŵďƵƐŝŶĞƐƐƐƚƌĂƚĞŐLJƉƌŽƚĞĐƚƐLJŽƵƌŽĨĨŝĐĞĨƌŽŵ ƚŚĞŚĂƌĚƐŚŝƉLJŽƵŵĂLJŚĂǀĞĞdžƉĞƌŝĞŶĐĞĚŽĨŽƚŚĞƌǀĞŶĚŽƌƐƚŚĂƚƐĞůůƵŶƉƌŽǀĞŶƐŽůƵƚŝŽŶƐ͘dLJůĞƌĞdžƉĞĐƚƐ ƚŽďĞLJŽƵƌǀĞŶĚŽƌĨŽƌůŝĨĞ͘ xdžƉĞƌŝĞŶĐĞʹdLJůĞƌŬŶŽǁƐDEͲKƵƌƵƐŝŶĞƐƐŶĂůLJƐƚƐĂĐƚŝǀĞůLJƚƌĂĐŬůĞŐŝƐůĂƚŝǀĞĐŚĂŶŐĞƐĂŶĚƉƌŽǀŝĚĞ ƉƌŽĂĐƚŝǀĞƐŽůƵƚŝŽŶƐƚŽĐůŝĞŶƚƐ͘tĞŵĂŬĞĐĞƌƚĂŝŶƚŚĂƚLJŽƵƌ/ŶĐŽĚĞƐŽĨƚǁĂƌĞŝƐĐŽŵƉůŝĂŶƚǁŝƚŚƐƚĂƚĞ ƐƚĂƚƵƚĞƐĂŶĚďĞƐƚƉƌĂĐƚŝĐĞƐ͘ xZĞƐƉŽŶƐŝǀĞŶĞƐƐʹdLJůĞƌƉŽƐŝƚŝŽŶƐŽƵƌƉƌŽĚƵĐƚůŝŶĞƐƚŽƌƵŶĂƐŝŶĚĞƉĞŶĚĞŶƚ͕ƌĞƐƉŽŶƐŝǀĞďƵƐŝŶĞƐƐƵŶŝƚƐ͘ tĞŚĂǀĞĂƚĞĂŵŽĨƉƌŽĨĞƐƐŝŽŶĂůƐĚĞĚŝĐĂƚĞĚĞdžĐůƵƐŝǀĞůLJƚŽƚŚĞ/ŶĐŽĚĞƐŽůƵƚŝŽŶ͘KƵƌƚĞĂŵŝƐŶŽƚƉƵůůĞĚ ŝŶŵƵůƚŝƉůĞĚŝƌĞĐƚŝŽŶƐůŝŬĞŽƚŚĞƌǀĞŶĚŽƌƐǁŚŽƐĞƐƚĂĨĨŵƵƐƚĚĞǀĞůŽƉ͕ƐƵƉƉŽƌƚ͕ĂŶĚŝŵƉůĞŵĞŶƚŵƵůƚŝƉůĞ ƉƌŽĚƵĐƚƐǁŝƚŚĚŝĨĨĞƌĞŶƚŵŝƐƐŝŽŶƐ͘dLJůĞƌƌĞƐƉŽŶĚƐƚŽLJŽƵƌŶĞĞĚƐ͘ xŽŶƚŝŶƵŝƚLJʹdLJůĞƌ͛ƐĞŵƉůŽLJĞĞůŽŶŐĞǀŝƚLJŚĞůƉƐĞŶƐƵƌĞƚŚĂƚLJŽƵƌŝŵƉůĞŵĞŶƚĂƚŝŽŶĐŽŵĞƐĨƌŽŵ ĞdžƉĞƌŝĞŶĐĞĚĂŶĚŬŶŽǁůĞĚŐĞĂďůĞƉĞƌƐŽŶŶĞů͘DŽƌĞƚŚĂŶϲϬйŽĨĞŵƉůŽLJĞĞƐǁŚŽǁĞƌĞǁŝƚŚdLJůĞƌĂ ĚĞĐĂĚĞĂŐŽĂƌĞƐƚŝůůǁŝƚŚdLJůĞƌƚŽĚĂLJ͘ xdLJůĞƌŽŵŵƵŶŝƚLJʹdLJůĞƌĐŽŶŶĞĐƚƐLJŽƵƌŽĨĨŝĐĞƚŽĂŶĞdžƚĞŶƐŝǀĞƵƐĞƌĐŽŵŵƵŶŝƚLJƚŚƌŽƵŐŚdLJůĞƌ ŽŵŵƵŶŝƚLJ͘dLJůĞƌŽŵŵƵŶŝƚLJŝƐǁŚĞƌĞƵƐĞƌƐƐŚĂƌĞĂŶĚůĞĂƌŶďĞƐƚͲƉƌĂĐƚŝĐĞƐǁŝƚŚŝŶĂŶĞƚǁŽƌŬŽĨ ŚƵŶĚƌĞĚƐŽĨŽƚŚĞƌ/ŶĐŽĚĞƵƐĞƌƐ͘hƐĞƌƐƚĂŬĞƉĂƌƚŝŶƋƵĂƌƚĞƌůLJĚĞƐŝŐŶŶŽŵŝŶĂƚŝŽŶƐĂŶĚǀŽƚĞĨŽƌĚĞƐŝŐŶ ĐŚĂŶŐĞƐĂƐƚŚĞ/ŶĐŽĚĞƚĞĂŵĐŽŽƌĚŝŶĂƚĞƐŝĚĞĂƐĨƌŽŵƚŚĞŬŶŽǁůĞĚŐĞďĂƐĞĂŶĚƉƌĂĐƚŝĐĂůĞdžƉĞƌŝĞŶĐĞŽĨ ŽƵƌƵƐĞƌĐŽŵŵƵŶŝƚLJ͘zŽƵƌǀŽŝĐĞŵĂƚƚĞƌƐ͕ĂŶĚǁĞůŝƐƚĞŶ͘ ϱϱϭϵϱϯƌĚ^ƚƌĞĞƚ >ƵďďŽĐŬ͕dyϳϵϰϭϰ W͗ϴϬϬ͘ϲϰϲ͘Ϯϲϯϯ &͗ϴϬϲ͘ϳϵϳ͘ϰϴϰϵ ǁǁǁ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞŝŝ xWƌŽƚĞĐƚŝŽŶʹdLJůĞƌ͛ƐǀĞƌŐƌĞĞŶƉŚŝůŽƐŽƉŚLJŐŝǀĞƐĐůŝĞŶƚƐƚŚĞůĂƚĞƐƚƚĞĐŚŶŽůŽŐLJĨŽƌƚŚĞůŝĨĞŽĨƚŚĞ ƉƌŽĚƵĐƚ͘ǀĞƌŐƌĞĞŶĞŶƐƵƌĞƐƚŚĂƚLJŽƵƌ/ŶĐŽĚĞƐŽĨƚǁĂƌĞŝƐĂůǁĂLJƐƵƉͲƚŽͲĚĂƚĞǁŝƚŚĐƵƌƌĞŶƚƐƚĂƚƵƚĞƐĂŶĚ ŶĞǁƚĞĐŚŶŽůŽŐŝĞƐ͘KƵƌĚĞǀĞůŽƉŵĞŶƚƚĞĂŵĚĞůŝǀĞƌƐĨŽƵƌƋƵĂƌƚĞƌůLJƐŽĨƚǁĂƌĞƵƉĚĂƚĞƐĂŶŶƵĂůůLJƚŽ ĞŶƐƵƌĞƚŚĂƚƚŚĞŝƚLJ͛ƐŽĨĨŝĐĞĂŶĚĐŝƚŝnjĞŶƐŚĂǀĞĂƐƵƉĞƌŝŽƌĞdžƉĞƌŝĞŶĐĞƵƐŝŶŐƚŚĞƐŽĨƚǁĂƌĞ͘ xZŝƐŬǀŽŝĚĂŶĐĞʹdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ŝƐƚŚĞůĂƌŐĞƐƚŐŽǀĞƌŶŵĞŶƚƐĞĐƚŽƌƐŽĨƚǁĂƌĞƉƌŽǀŝĚĞƌŝŶƚŚĞ hŶŝƚĞĚ^ƚĂƚĞƐ͕ǁŝƚŚŵŽƌĞƚŚĂŶϮϲ͕ϬϬϬƐƵĐĐĞƐƐĨƵůŝŶƐƚĂůůĂƚŝŽŶƐĂĐƌŽƐƐϭϬ͕ϬϬϬƐŝƚĞƐ͕ϰ͕ϲϬϬĞŵƉůŽLJĞĞƐ͕ϰ ŵŝůůŝŽŶĐůŽƵĚƵƐĞƌƐ͕ĂŶĚϵϬϬнŵŝůůŝŽŶŝŶĂŶŶƵĂůƌĞǀĞŶƵĞ͘KƵƌĐŽŵŵŝƚŵĞŶƚĂŶĚŝŶǀĞƐƚŵĞŶƚŝŶƚŚĞ ŐŽǀĞƌŶŵĞŶƚƚĞĐŚŶŽůŽŐLJŵĂƌŬĞƚŝƐŽƵƌƐŽůĞĨŽĐƵƐĂŶĚƐƚƌĂƚĞŐLJ͘ dŚŝƐƉƌŽƉŽƐĂůĂŶĚĐŽƐƚƐĐŚĞĚƵůĞŝƐǀĂůŝĚĂŶĚďŝŶĚŝŶŐĨŽƌϭϮϬĚĂLJƐĨŽůůŽǁŝŶŐƚŚĞZ&WĚƵĞĚĂƚĞ͘džĐĞƉƚĂƐƐĞƚ ĨŽƌƚŚŝŶƚŚŝƐƉƌŽƉŽƐĂů͕ƚŚŝƐƉƌŽƉŽƐĂůĐĂŶďĞƌĞůĞĂƐĞĚŝŶƉĂƌƚŽƌŝŶƚŽƚĂůĂƐƉƵďůŝĐŝŶĨŽƌŵĂƚŝŽŶŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚ ƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚĞůĂǁƐĐŽǀĞƌŝŶŐƐĂŵĞ͘ dLJůĞƌĐŽŶƚŝŶƵĂůůLJƐĞĞŬƐŽƵƚďƵƐŝŶĞƐƐƉĂƌƚŶĞƌƐƚŽƐŚĂƌĞŝŶŽƵƌƐƵĐĐĞƐƐƌĂƚŚĞƌƚŚĂŶũƵƐƚĐƵƐƚŽŵĞƌƐ͘KƵƌƉĂƌƚŶĞƌƐ͕ ůŝŬĞLJŽƵ͕ƵŶĚĞƌƐƚĂŶĚƚŚĞĚŝĨĨĞƌĞŶĐĞďĞƚǁĞĞŶǀĂůƵĞĂŶĚĐŽƐƚĂŶĚǁĂŶƚǁŚĂƚŝƐďĞƐƚĨŽƌƚŚĞŝƌĐŽŵŵƵŶŝƚŝĞƐ͘/Ĩ LJŽƵŚĂǀĞĂŶLJƋƵĞƐƚŝŽŶƐ͕ƉůĞĂƐĞĐŽŶƚĂĐƚŽĚLJ'ƵŶƐƚĞŶƐŽŶ͕LJŽƵƌĐĐŽƵŶƚdžĞĐƵƚŝǀĞĂƚϮϭϰ͘ϱϳϴ͘ϱϭϲϲŽƌǀŝĂ ĞŵĂŝůĂƚŽĚLJ͘'ƵŶƐƚĞŶƐŽŶΛƚLJůĞƌƚĞĐŚ͘ĐŽŵĨŽƌŵŽƌĞŝŶĨŽƌŵĂƚŝŽŶ͘ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĂƵƚŚŽƌŝnjĞƐƚŚĞƐŝŐŶĂƚŽƌLJŽĨƚŚŝƐůĞƚƚĞƌƚŽŶĞŐŽƚŝĂƚĞĂŶĚďŝŶĚdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƚŽƚŚŝƐ ƌĞƐƉŽŶƐĞ͘ ZĞƐƉĞĐƚĨƵůůLJƐƵďŵŝƚƚĞĚ͕ ĂŶĞtŽŵďůĞ WƌĞƐŝĚĞŶƚʹ>ŽĐĂů'ŽǀĞƌŶŵĞŶƚŝǀŝƐŝŽŶ͕dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ dĂdž/ηϳϱͲϮϯϬϯϵϮϬ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞŝ dĂďůĞŽĨŽŶƚĞŶƚƐ ŽǀĞƌ>ĞƚƚĞƌ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ŝ ^ĞĐƚŝŽŶϭ͘ϬͲdžĞĐƵƚŝǀĞ^ƵŵŵĂƌLJĂŶĚ/ŶƚƌŽĚƵĐƚŽƌLJDĂƚĞƌŝĂůƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ ^ĞĐƚŝŽŶϯ͘ϬͲ&ƵŶĐƚŝŽŶĂůZĞƋƵŝƌĞŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϱ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϲϵ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϵϱ ^ĞĐƚŝŽŶϲ͘ϬͲdžĐĞƉƚŝŽŶƐƚŽZ&W͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϭϵ ^ĞĐƚŝŽŶϳ͘ϬͲĞůŝǀĞƌĂďůĞƐĂŶĚWƌŽũĞĐƚKƵƚĐŽŵĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϮϮϯ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϮϮϱ ^ĞĐƚŝŽŶϵ͘ϬͲWƌŝĐĞWƌŽƉŽƐĂů;dŽĞ^ƵďŵŝƚƚĞĚhŶĚĞƌ^ĞƉĂƌĂƚĞŽǀĞƌͿ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϭϭ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞŝŝ ^ĞĐƚŝŽŶϭ͘ϬͲdžĞĐƵƚŝǀĞ^ƵŵŵĂƌLJĂŶĚ/ŶƚƌŽĚƵĐƚŽƌLJDĂƚĞƌŝĂůƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭ ^ĞĐƚŝŽŶϭ͘ϬͲdžĞĐƵƚŝǀĞ^ƵŵŵĂƌLJĂŶĚ/ŶƚƌŽĚƵĐƚŽƌLJDĂƚĞƌŝĂůƐ /ŶƌĞƐƉŽŶƐĞƚŽƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶ͚ƐZ&W͕dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŝƐƉƌŽƉŽƐŝŶŐŝƚƐ/ŶĐŽĚĞƐŽůƵƚŝŽŶ͘KƵƌƌĞƐƉŽŶƐĞ ƌĞĨůĞĐƚƐŽƵƌƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨLJŽƵƌƌĞƋƵŝƌĞŵĞŶƚƐĂŶĚŽƵƌĂďŝůŝƚLJƚŽĚĞůŝǀĞƌƚŚĞƋƵĂůŝƚLJƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐ LJŽƵŶĞĞĚĨŽƌĂƐƵĐĐĞƐƐĨƵůƉƌŽũĞĐƚ͘dLJůĞƌ͛Ɛ/ŶĐŽĚĞƐŽůƵƚŝŽŶƌĞƉƌĞƐĞŶƚƐƚŚĞƉŝŶŶĂĐůĞŽĨƉƵďůŝĐƐĞĐƚŽƌƐŽĨƚǁĂƌĞ ŽĨĨĞƌŝŶŐĂŶŝŶƚĞŐƌĂƚĞĚƐŽůƵƚŝŽŶŽĨĐŽŵƉƌĞŚĞŶƐŝǀĞĂƉƉůŝĐĂƚŝŽŶƐĚĞƐŝŐŶĞĚƚŽƌĞƐŽůǀĞƚŚĞŝƚLJ͛ƐĐŽŵƉůĞdžŶĞĞĚƐ͘ ŚŽŝĐĞ dŚŽƵŐŚƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶǁŝůůƌĞǀŝĞǁŵĂŶLJĐŚŽŝĐĞƐĚƵƌŝŶŐƚŚŝƐĞǀĂůƵĂƚŝŽŶƉƌŽĐĞƐƐ͕ŽƵƌŐŽĂůŝƐƚŽŵĂŬĞLJŽƵƌ ĐŚŽŝĐĞĂŶĞĂƐLJŽŶĞ͘tŝƚŚdLJůĞƌ͕ƚŚĞƌĞŝƐŶŽŶĞĞĚƚŽŵŽǀĞĨƌŽŵǀĞŶĚŽƌƚŽǀĞŶĚŽƌ͕ƐŽůƵƚŝŽŶƚŽƐŽůƵƚŝŽŶ͕ ƚĞĐŚŶŽůŽŐLJƚŽƚĞĐŚŶŽůŽŐLJ͘dLJůĞƌ͛Ɛ/ŶĐŽĚĞƐŽůƵƚŝŽŶŝƐĂŶŝŶƚĞŐƌĂůƉĂƌƚŽĨĂĐŽŵŵƵŶŝƚLJŽĨĞŵƉůŽLJĞĞƐ͕ ĐƵƐƚŽŵĞƌƐ͕ĂŶĚƉĂƌƚŶĞƌƐǁŚŽĂůůƐŚĂƌĞĂƉĂƐƐŝŽŶĨŽƌƐĞƌǀŝŶŐƚŚĞƉƵďůŝĐ͘ ƐƉĂƌƚŽĨƚŚĂƚĐŽŵŵƵŶŝƚLJ͕ƚŚĞŝƚLJǁŝůůŚĂǀĞĂĐĐĞƐƐƚŽĂůůƚŚĞƚŽŽůƐŶĞĞĚĞĚƚŽĞĨĨŝĐŝĞŶƚůLJŵĂŶĂŐĞLJŽƵƌ ŽƉĞƌĂƚŝŽŶƐ͘tŝƚŚƚŚĞŐŽĂůŽĨďĞŝŶŐƚŚĞůĂƐƚƐŽĨƚǁĂƌĞĐŽŵƉĂŶLJLJŽƵĞǀĞƌĐŚŽŽƐĞ͖dLJůĞƌǁŝůůǁŽƌŬĨŽƌĂŶĚǁŝƚŚ LJŽƵƚŽĐŽŶƐŝƐƚĞŶƚůLJƉƌŽǀŝĚĞLJŽƵǁŝƚŚƚŚĞďƌŽĂĚĞƐƚĂŶĚŵŽƐƚĂĚǀĂŶĐĞĚƉƵďůŝĐƐĞĐƚŽƌƐŽůƵƚŝŽŶƐĂǀĂŝůĂďůĞ͘ dLJůĞƌ͛Ɛ/ŶĐŽĚĞ^ŽůƵƚŝŽŶ dŚĞ/ŶĐŽĚĞƐŽůƵƚŝŽŶĐŽŶƐŝƐƚƐŽĨŵŽƌĞƚŚĂŶĨŝĨƚLJŝŶƚĞŐƌĂƚĞĚŵŽĚƵůĞƐ͘dŚĞƐĞƐŽĨƚǁĂƌĞĂƉƉůŝĐĂƚŝŽŶƐĂƌĞ ƐƉĞĐŝĨŝĐĂůůLJĚĞƐŝŐŶĞĚƚŽĞŶĂďůĞŐŽǀĞƌŶŵĞŶƚƐƚŽďĞŵŽƌĞĞĨĨŝĐŝĞŶƚ͕ŵŽƌĞĂĐĐĞƐƐŝďůĞ͕ĂŶĚŵŽƌĞƌĞƐƉŽŶƐŝǀĞƚŽ ƚŚĞŶĞĞĚƐŽĨƚŚĞŝƌĐŝƚŝnjĞŶƐ͘dŚĞŵŽĚƵůĂƌĚĞƐŝŐŶŽĨƚŚĞƐŽĨƚǁĂƌĞĂůůŽǁƐĐƵƐƚŽŵĞƌƐƚŚĞďĞŶĞĨŝƚŽĨŐƌŽǁŝŶŐŝŶƚŽ dLJůĞƌ͛Ɛ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐďLJĂĚĚŝŶŐŵŽĚƵůĞƐǁŚĞŶƚŚĞƚŝŵĞŝƐƌŝŐŚƚ͘ ŽŶƐŝƐƚĞŶƚŝŶƚĞŐƌĂƚŝŽŶĂŵŽŶŐ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐŚĂƐĂůǁĂLJƐďĞĞŶĂƉƌŝŽƌŝƚLJĂŶĚĂŬĞLJďĞŶĞĨŝƚƚŽ ŽƌŐĂŶŝnjĂƚŝŽŶƐůŽŽŬŝŶŐƚŽŝŵƉƌŽǀĞƚŚĞŝƌďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐ͘ŽŶƐĞƋƵĞŶƚůLJ͕ĂůůƉƌŽĚƵĐƚƐŝŶƚŚŝƐƉƌŽƉŽƐĂůĂƌĞ ĚĞƐŝŐŶĞĚĂŶĚƐƵƉƉŽƌƚĞĚďLJdLJůĞƌŽƌŽŶĞŽĨŽƵƌƵƐŝŶĞƐƐWĂƌƚŶĞƌƐǁŝƚŚƐĞĂŵůĞƐƐŝŶƚĞŐƌĂƚŝŽŶďĞƚǁĞĞŶ ĂƉƉůŝĐĂƚŝŽŶƐ͘ ĞŶĞĨŝƚƐŽĨdLJůĞƌΖƐ/ŶĐŽĚĞƐŽůƵƚŝŽŶ͗ x^ƚƌĞŶŐƚŚĂŶĚƐƚĂďŝůŝƚLJ͗ǁĞΖǀĞďĞĞŶƉƌŽǀŝĚŝŶŐ/ŶĐŽĚĞƚŽůŽĐĂůŐŽǀĞƌŶŵĞŶƚƐƚŚƌŽƵŐŚŽƵƚƚŚĞŶĂƚŝŽŶƐŝŶĐĞ ϭϵϴϭ xhƉŐƌĂĚĞǁŚĞŶŝƚŵĂŬĞƐƐĞŶƐĞĨŽƌLJŽƵ͕ĂƚŶŽĂĚĚŝƚŝŽŶĂůĐŽƐƚ xWŝĐŬͲĂŶĚͲĐŚŽŽƐĞƚŚĞ/ŶĐŽĚĞŵŽĚƵůĞƐƚŚĂƚĨŝƚLJŽƵƌŶĞĞĚƐĂŶĚďƵĚŐĞƚ xĨĨŝĐŝĞŶƚǁŽƌŬĨůŽǁĐĂƉĂďŝůŝƚŝĞƐĂƌĞƵƐĞƌͲĚĞĨŝŶĞĚĂŶĚĐƵƐƚŽŵŝnjĞĚ xhƐĞƌͲĨƌŝĞŶĚůLJǁŽƌŬƐƉĂĐĞƐƚŚĂƚĂƌĞĐƵƐƚŽŵŝnjĂďůĞďĂƐĞĚŽŶŝŶĚŝǀŝĚƵĂůƌŽůĞƐ KďũĞĐƚŝǀĞƐΘ^ĐŽƉĞ ƚdLJůĞƌ͕ǁĞĂƌĞƵŶŝƋƵĞůLJƋƵĂůŝĨŝĞĚƚŽŵĞĞƚƚŚĞŶĞĞĚƐŽĨƚŚĞŝƚLJƚŚƌŽƵŐŚŽƵƌĞdžƉĞƌŝĞŶĐĞ͕ŽƵƌƐŽĨƚǁĂƌĞ͕ĂŶĚ ŽƵƌĂďƐŽůƵƚĞĐŽŵŵŝƚŵĞŶƚƚŽĐƵƐƚŽŵĞƌƐĂƚŝƐĨĂĐƚŝŽŶ͘KƵƌĐƵƐƚŽŵĞƌƐŚĂǀĞĂĚŝƌĞĐƚŝŵƉĂĐƚŽŶƚŚĞĞǀŽůƵƚŝŽŶŽĨ ƚŚĞƐŽĨƚǁĂƌĞĂŶĚƚŚĞƉƌŽĐĞƐƐĞƐŝŶǀŽůǀĞĚŝŶŝŵƉůĞŵĞŶƚŝŶŐĂŶĚƐƵƉƉŽƌƚŝŶŐŝƚ͘ĂĐŚŽĨƚŚĞƉƌŽĚƵĐƚƐĂŶĚ ƐĞƌǀŝĐĞƐůŝƐƚĞĚŝŶƚŚĞƌĞƐƉŽŶƐĞĂƌĞƌĞƉƌĞƐĞŶƚĞĚĂƐĂĚĞƐĐƌŝƉƚŝŽŶĂŶĚĂůŝƐƚŽĨĂĐƚŝǀŝƚŝĞƐĂŶĚĂƐƐƵŵƉƚŝŽŶƐ͘dLJůĞƌ ƉƌŽĚƵĐƚƐǁŝůůďĞŝŵƉůĞŵĞŶƚĞĚ͞ŽĨĨƚŚĞƐŚĞůĨ͟ǁŝƚŚŽƵƚĐƵƐƚŽŵŝnjĂƚŝŽŶŽƌŵŽĚŝĨŝĐĂƚŝŽŶ͕ĞdžĐĞƉƚĂƐĚĞƚĂŝůĞĚŝŶƚŚĞ ƌĞƐƉŽŶƐĞ͘ dLJůĞƌ͛Ɛ/ŶĐŽĚĞƐƵŝƚĞŽĨĨĞƌƐŝŶƚĞŐƌĂƚĞĚĂƉƉůŝĐĂƚŝŽŶƐƚŚĂƚĂƌĞƐƉĞĐŝĨŝĐĂůůLJĚĞƐŝŐŶĞĚƚŽĞŶĂďůĞŐŽǀĞƌŶŵĞŶƚƐƚŽďĞ ŵŽƌĞĞĨĨŝĐŝĞŶƚ͕ŵŽƌĞĂĐĐĞƐƐŝďůĞ͕ĂŶĚŵŽƌĞƌĞƐƉŽŶƐŝǀĞƚŽƚŚĞŶĞĞĚƐŽĨƚŚĞŝƌĐŝƚŝnjĞŶƐ͘ŽŶƐŝƐƚĞŶƚŝŶƚĞŐƌĂƚŝŽŶ ĂŵŽŶŐ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐŚĂƐĂůǁĂLJƐďĞĞŶĂƉƌŝŽƌŝƚLJĂŶĚĂŬĞLJďĞŶĞĨŝƚƚŽŽƌŐĂŶŝnjĂƚŝŽŶƐůŽŽŬŝŶŐƚŽŝŵƉƌŽǀĞ ƚŚĞŝƌďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐ͘dŚĞŬĞLJďĞŶĞĨŝƚƐƚŽƚŚĞƐLJƐƚĞŵŝŶĐůƵĚĞ͕ďƵƚĂƌĞŶŽƚůŝŵŝƚĞĚƚŽ͗ xWƌŽǀŝĚŝŶŐĂƐŝŶŐůĞ͕ĐŽŵƉƌĞŚĞŶƐŝǀĞ͕ĂŶĚŝŶƚĞŐƌĂƚĞĚƐŽůƵƚŝŽŶƚŽŵĂŶĂŐĞƚŚĞŝƚLJ͛ƐďƵƐŝŶĞƐƐĨƵŶĐƚŝŽŶƐ ^ĞĐƚŝŽŶϭ͘ϬͲdžĞĐƵƚŝǀĞ^ƵŵŵĂƌLJĂŶĚ/ŶƚƌŽĚƵĐƚŽƌLJDĂƚĞƌŝĂůƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮ x^ƚƌĞĂŵůŝŶŝŶŐďƵƐŝŶĞƐƐƉƌŽĐĞƐƐĞƐƚŚƌŽƵŐŚĂƵƚŽŵĂƚŝŽŶ͕ŝŶƚĞŐƌĂƚŝŽŶ͕ĂŶĚǁŽƌŬĨůŽǁƐ xWƌŽǀŝĚŝŶŐĂƵƐĞƌͲĨƌŝĞŶĚůLJƵƐĞƌŝŶƚĞƌĨĂĐĞƚŽƉƌŽŵŽƚĞƐLJƐƚĞŵƵƐĞ͕ƉƌŽĚƵĐƚŝǀŝƚLJ͕ĂŶĚŵŝŶŝŵŝnjĞƚŚĞŶĞĞĚ ĨŽƌƚƌĂŝŶŝŶŐ xůŝŵŝŶĂƚŝŶŐƌĞĚƵŶĚĂŶƚĚĂƚĂĞŶƚƌLJ xWƌŽǀŝĚŝŶŐŵĂŶLJƐƚĂŶĚĂƌĚƌĞƉŽƌƚƐĚŝƌĞĐƚůLJĨƌŽŵƚŚĞƐŽĨƚǁĂƌĞǁŝƚŚĂĐĐĞƐƐƚŽĚĂƚĂƚŚƌŽƵŐŚŝŶƋƵŝƌLJĂŶĚ ĚƌŝůůĚŽǁŶĐĂƉĂďŝůŝƚŝĞƐ xWƌŽǀŝĚŝŶŐŵƵůƚŝƉůĞŝŶƚĞƌĨĂĐĞƐƚŽĐŽŵŵŽŶůLJƵƐĞĚϯƌĚƉĂƌƚLJƐLJƐƚĞŵƐ ŽŵƉƌĞŚĞŶƐŝǀĞ^ŽĨƚǁĂƌĞΘ^ĞƌǀŝĐĞƐ dLJůĞƌ͛ƐƐŽůƵƚŝŽŶŝƐŝŶƚĞŶĚĞĚƚŽƵƉŐƌĂĚĞŝƚLJŽĨŽƌĐŽƌĂŶ͛ƐĚĞƉĂƌƚŵĞŶƚƐƚŽƚŚĞůĂƚĞƐƚƐLJƐƚĞŵĂǀĂŝůĂďůĞŝŶƚŽĚĂLJ͛Ɛ ŵĂƌŬĞƚƉůĂĐĞ͘dLJůĞƌ͛Ɛ/ŶĐŽĚĞƉůĂƚĨŽƌŵŝƐĚŝƐƚŝŶŐƵŝƐŚĞĚĨƌŽŵƚŚĞĐŽŵƉĞƚŝƚŝǀĞůĂŶĚƐĐĂƉĞďLJƚŚĞĨĂĐƚƚŚĂƚǁĞ ĚĞǀĞůŽƉĂŶĚƐƵƉƉŽƌƚϭϬϬйŽĨŽƵƌƉƌŽĚƵĐƚƐŝŶͲŚŽƵƐĞ͘ůůƐŽĨƚǁĂƌĞĚĞǀĞůŽƉŵĞŶƚ͕ŝŵƉůĞŵĞŶƚĂƚŝŽŶ͕ĂŶĚ ƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐĂƌĞƉƌŽǀŝĚĞĚƐŽůĞůLJďLJŽƵƌŝŶͲŚŽƵƐĞƉĞƌƐŽŶŶĞů͘dŚŝƐŚĂƐĞŶĂďůĞĚƵƐƚŽďƵŝůĚĂŶĚĞǀŽůǀĞĂ ƐŽĨƚǁĂƌĞƉůĂƚĨŽƌŵĂŶĚĞĐŽƐLJƐƚĞŵƚŚĂƚŝŶĨƵƐĞƐĞŵƉůŽLJĞĞƉĂƐƐŝŽŶĨŽƌŝŶĚƵƐƚƌLJͲƐƉĞĐŝĨŝĐƐŽĨƚǁĂƌĞĂƵƚŽŵĂƚŝŽŶ ǁŝƚŚƚŚĞĨƌŽŶƚͲůŝŶĞĞdžƉĞƌŝĞŶĐĞƐŽƵƌůĞĂĚŝŶŐĐƵƐƚŽŵĞƌƐŚĂǀĞƉƌŽǀŝĚĞĚ͘dŚĞƌĞƐƵůƚŽĨƚŚŝƐĐŽŵŵŝƚŵĞŶƚŝƐƚŚĞ ŝŶĚƵƐƚƌLJ͛ƐŵŽƐƚƉŽǁĞƌĨƵů͕ƐĞĂŵůĞƐƐ͕ĞĨĨŝĐŝĞŶƚ͕ƵƐĞƌͲŝŶƚƵŝƚŝǀĞ͕ĂŶĚƐĐĂůĂďůĞƉůĂƚĨŽƌŵĨŽƌůŽĐĂůŐŽǀĞƌŶŵĞŶƚ ĂƵƚŽŵĂƚŝŽŶ͘KƵƌŐƌŽƵƉŽĨƐĞĂƐŽŶĞĚĐŽŶƐƵůƚĂŶƚƐ͕ƚƌĂŝŶĞƌƐ͕ƉƌŽĚƵĐƚĞdžƉĞƌƚƐ͕ĂŶĚƉƌŽŐƌĂŵŵĞƌƐďƌŝŶŐLJĞĂƌƐŽĨ ůŽĐĂůŐŽǀĞƌŶŵĞŶƚƐŽĨƚǁĂƌĞĞdžƉĞƌŝĞŶĐĞƚŽŵĂŬĞLJŽƵƌƚƌĂŶƐŝƚŝŽŶĂƐŵŽŽƚŚƐƵĐĐĞƐƐ͘ dLJůĞƌŚĂŶĚůĞƐƚŚĞĨŽůůŽǁŝŶŐĂƐƉĞĐƚƐŽĨLJŽƵƌƉƌŽũĞĐƚƵŶĚĞƌĂƐŝŶŐůĞĐŽŶƚƌĂĐƚ͗ x^LJƐƚĞŵĞůŝǀĞƌLJ x/ŵƉůĞŵĞŶƚĂƚŝŽŶ xdƌĂŝŶŝŶŐ x^ƵƉƉŽƌƚĂŶĚDĂŝŶƚĞŶĂŶĐĞ x^ŽĨƚǁĂƌĞhƉĚĂƚĞƐĂŶĚhƉŐƌĂĚĞƐ ŽŵƉůĞƚĞ^ĞƌǀŝĐĞƐ /ŵƉůĞŵĞŶƚĂƚŝŽŶƉƉƌŽĂĐŚ dLJůĞƌƵƚŝůŝnjĞƐĂƉƌŽǀĞŶƉŚĂƐĞĚŝŵƉůĞŵĞŶƚĂƚŝŽŶĂƉƉƌŽĂĐŚ͕ǁŚŝĐŚĞŶƐƵƌĞƐƚŚĂƚƉƌŽĐĞƐƐƐƉĞĐŝĨŝĐĚĞƚĂŝůƐĂƌĞ ŵĂƐƚĞƌĞĚƉƌŝŽƌƚŽĞĂĐŚƐƵďƐĞƋƵĞŶƚƐƚĂŐĞ͘ĨŽƌŵĂůŝnjĞĚƐŝŐŶŽĨĨƉƌŽĐĞƐƐ͕ĚĞĨŝŶĞĚďLJĂĐůĞĂƌůLJƐƚĂƚĞĚ ĚĞůŝǀĞƌĂďůĞ͕ĂƌĞƚŚĞŬĞLJƚŽĂƐƵĐĐĞƐƐĨƵůŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘&ŽƌŵƵůƚŝͲƉŚĂƐĞƉƌŽũĞĐƚƐ͕ƐƵĐŚĂƐƐŝƚĞƐƚŚĂƚ ŝŵƉůĞŵĞŶƚŵŽƌĞƚŚĂŶŽŶĞdLJůĞƌƉƌŽĚƵĐƚ͕ƚŚĞƐƚĂŐĞƐĂƌĞƌĞƉĞĂƚĞĚĂƐŶĞĐĞƐƐĂƌLJ͘ dƌĂŝŶŝŶŐ KƵƌĐůŝĞŶƚƐĞdžƉĞĐƚƚŽƌĞĐĞŝǀĞƚŚĞƌŝŐŚƚƚƌĂŝŶŝŶŐĨŽƌƚŚĞŝƌŶĞĞĚƐďĞĐĂƵƐĞůĞĂƌŶŝŶŐƚŚĞƚŽŽůƐ͕ďĞŶĞĨŝƚƐ͕ĂŶĚ ƉŽǁĞƌĨƵůĨƵŶĐƚŝŽŶƐŝƐƉĂƌƚŽĨƚŚĞƉƌŽĐĞƐƐ͘/ƚ͛ƐĂĨĂĐƚƚŚĂƚĨƵůůLJƚƌĂŝŶĞĚĐůŝĞŶƚƐǁŚŽƵŶĚĞƌƐƚĂŶĚŚŽǁƚŽƵƐĞdLJůĞƌ ƉƌŽĚƵĐƚƐĂƌĞĂďůĞƚŽĚŽƚŚĞŝƌũŽďƐďĞƚƚĞƌ͕ƉĞƌŝŽĚ͘dLJůĞƌŽĨĨĞƌƐŵƵůƚŝƉůĞƚƌĂŝŶŝŶŐŽƉƚŝŽŶƐƚŽĨŝƚLJŽƵƌŶĞĞĚƐ͘ ^ƵƉƉŽƌƚ dŚĞŐŽĂůŽĨƚŚĞdLJůĞƌ^ƵƉƉŽƌƚĚĞƉĂƌƚŵĞŶƚŝƐƚŽƉƌŽǀŝĚĞĞdžƉĞĚŝƚŝŽƵƐƚĞĐŚŶŝĐĂůĂƐƐŝƐƚĂŶĐĞƚŽdLJůĞƌƐŽĨƚǁĂƌĞ ƵƐĞƌƐŝŶŽǀĞƌĐŽŵŝŶŐŝƐƐƵĞƐ͕ƵŶĚĞƌƐƚĂŶĚŝŶŐĨƵŶĐƚŝŽŶĂůŝƚLJ͕ĂŶĚƌĞĐŽŵŵĞŶĚŝŶŐĂƉƉƌŽĂĐŚĞƐƚŽǀĂƌŝŽƵƐƐĐĞŶĂƌŝŽƐ͘ tĞƐƚƌŝǀĞƚŽĂŶƐǁĞƌLJŽƵƌƋƵĞƐƚŝŽŶƐƋƵŝĐŬůLJĂŶĚĂĐĐƵƌĂƚĞůLJ͘dLJůĞƌŽĨĨĞƌƐŵƵůƚŝƉůĞǁĂLJƐƚŽĐŽŶƚĂĐƚLJŽƵƌƐƵƉƉŽƌƚ ƉĞƌƐŽŶŶĞů͕ĂƐǁĞůůĂƐĂĐĐĞƐƐƚŽƚŚŽƵƐĂŶĚƐŽĨƵƐĞƌƐĂĐƌŽƐƐƚŚĞĐŽƵŶƚƌLJǁŚŽŚĂǀĞƚŚĞĞdžƉĞƌŝĞŶĐĞƚŽŚĞůƉLJŽƵ ƵƚŝůŝnjĞƚŚĞƐŽĨƚǁĂƌĞƚŽLJŽƵƌŐƌĞĂƚĞƐƚďĞŶĞĨŝƚ͘ tŚĂƚ^ĞƚƐdLJůĞƌƉĂƌƚ dŚĞƌĞĂƌĞĂŶƵŵďĞƌŽĨŬĞLJĚŝĨĨĞƌĞŶƚŝĂƚŽƌƐŽĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĂŶĚŝƚƐƉƌŽƉŽƐĞĚ/ŶĐŽĚĞƐŽůƵƚŝŽŶƚŚĂƚƐŚŽƵůĚ ďĞǀŝĞǁĞĚĂƐƐŝŐŶŝĨŝĐĂŶƚůLJĂĚǀĂŶƚĂŐĞŽƵƐƚŽƚŚĞŝƚLJ͘ ^ĞĐƚŝŽŶϭ͘ϬͲdžĞĐƵƚŝǀĞ^ƵŵŵĂƌLJĂŶĚ/ŶƚƌŽĚƵĐƚŽƌLJDĂƚĞƌŝĂůƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯ &ŝƌƐƚĂŶĚĨŽƌĞŵŽƐƚ͕ĂůůŽĨdLJůĞƌ͛ƐĞĨĨŽƌƚƐĂƌĞĨŽĐƵƐĞĚŽŶƉƌŽǀŝĚŝŶŐƚĞĐŚŶŽůŽŐLJƐŽůƵƚŝŽŶƐƚŽƚŚĞƉƵďůŝĐƐĞĐƚŽƌ͘ KƵƌĂƚƚĞŶƚŝŽŶŝƐŶŽƚĚŝůƵƚĞĚďLJƉƌŽǀŝĚŝŶŐƐŽůƵƚŝŽŶƐƚŽŽƚŚĞƌŝŶĚƵƐƚƌŝĞƐĂŶĚŽƵƌƐƚĂĨĨĂƌĞŝŶĚƵƐƚƌLJĞdžƉĞƌƚƐŝŶƚŚĞ ƉƵďůŝĐƐĞĐƚŽƌĂƌĞŶĂ͘ ^ĞĐŽŶĚůLJ͕dLJůĞƌŚĂƐĐŽŶƐĐŝŽƵƐůLJĚĞĐŝĚĞĚƚŽŝŵƉůĞŵĞŶƚŝƚƐŽǁŶƉƌŽũĞĐƚƐ͘tĞĚŽŶ͛ƚŽƵƚƐŽƵƌĐĞŽƵƌ ŝŵƉůĞŵĞŶƚĂƚŝŽŶĞĨĨŽƌƚƐƚŽϯƌĚƉĂƌƚLJŝŶƚĞŐƌĂƚŽƌƐ͘tĞĨĞĞůƚŚŝƐĂůůŽǁƐƵƐƚŽƉƌŽǀŝĚĞďĞƚƚĞƌƐĞƌǀŝĐĞƚŽŽƵƌ ĐƵƐƚŽŵĞƌƐĂƚĂŵƵĐŚůŽǁĞƌĐŽƐƚ͘&ƵƌƚŚĞƌŵŽƌĞ͕ĚƵĞƚŽŽƵƌĞdžƉĞƌƚŝƐĞŝŶƚŚĞƉƵďůŝĐƐĞĐƚŽƌ͕ǁĞ͛ƌĞĂďůĞƚŽŵŽƌĞ ĐůĞĂƌůLJŝĚĞŶƚŝĨLJƚŽŽƵƌĐƵƐƚŽŵĞƌƐƚŚĞďĞƐƚďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐŽĨƚŚĞƉƵďůŝĐƐĞĐƚŽƌ͘KƵƌĂƉƉƌŽĂĐŚƚŽ ŝŵƉůĞŵĞŶƚĂƚŝŽŶǁŝůůŝŶĞǀŝƚĂďůLJƌĞƐƵůƚŝŶĂƉƌŽũĞĐƚǁŝƚŚĂŐƌĞĂƚĞƌĚĞĨŝŶŝƚŝŽŶŽĨďŽƚŚĐŽƐƚĂŶĚƚŝŵĞĨƌĂŵĞ͘ dŚŝƌĚ͕dLJůĞƌĂĚŚĞƌĞƐƚŽĂƉŚŝůŽƐŽƉŚLJĐĂůůĞĚ͞ǀĞƌŐƌĞĞŶĞǀĞůŽƉŵĞŶƚ͘͟hŶĚĞƌƚŚŝƐĂƉƉƌŽĂĐŚ͕dLJůĞƌǁŝůůƉƌŽǀŝĚĞ ĂůůĨƵƚƵƌĞĞŶŚĂŶĐĞŵĞŶƚƐŝŶĐůƵĚŝŶŐƉůĂƚĨŽƌŵĐŚĂŶŐĞƐƚŽ/ŶĐŽĚĞƐŽůƵƚŝŽŶƚŽƚŚĞŝƚLJĂƐƉĂƌƚŽĨŝƚƐĂŶŶƵĂů ŵĂŝŶƚĞŶĂŶĐĞĂŐƌĞĞŵĞŶƚǁŝƚŚŽƵƚĂĚĚŝƚŝŽŶĂůƌĞͲůŝĐĞŶƐŝŶŐĨĞĞƐ͘dŚŝƐŝƐĂƐŝŐŶŝĨŝĐĂŶƚĚŝǀĞƌŐĞŶĐĞĨƌŽŵƚŚĞƚLJƉŝĐĂů ďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐŽĨƚƌĂĚŝƚŝŽŶĂůǀĞŶĚŽƌƐ͘ &ŽƵƌƚŚ͕ǁĞŽĨĨĞƌ^ŽĨƚǁĂƌĞĂƐĂ^ĞƌǀŝĐĞŵŽĚĞů͘tŚŝůĞŽƚŚĞƌƐŵĂLJŽĨĨĞƌƚŚŝƐƐĞƌǀŝĐĞƚŚĞLJƚLJƉŝĐĂůůLJŽƵƚƐŽƵƌĐĞƚŚĞ ĚĂƚĂĐĞŶƚĞƌƚŽĂϯƌĚƉĂƌƚLJ͘dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŽǁŶƐĂŶĚŽƉĞƌĂƚĞƐŝƚƐŽǁŶĚĂƚĂĐĞŶƚĞƌƐůŽĐĂƚĞĚŝŶzĂƌŵŽƵƚŚ͕ DĂŶĚWůĂŶŽ͕dy͘ &ŝĨƚŚ͕ŝĨƚŚĞƌĞĂƌĞŵŽĚŝĨŝĐĂƚŝŽŶƐƚŽďĞĚĞůŝǀĞƌĞĚƚŚƌŽƵŐŚƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽĐĞƐƐ͕ŝƚŝƐŝŵƉŽƌƚĂŶƚƚŽŶŽƚĞ ƚŚĂƚƚŚĞƐĞŵŽĚŝĨŝĐĂƚŝŽŶƐĨŽƌƚŚĞŝƚLJǁŽƵůĚďĞĐŽŵĞƉĂƌƚŽĨƚŚĞŐĞŶĞƌĂůůLJͲƌĞůĞĂƐĞĚ/ŶĐŽĚĞƐLJƐƚĞŵĂǀĂŝůĂďůĞƚŽ ĂůůĐůŝĞŶƚƐŐŽŝŶŐĨŽƌǁĂƌĚ͘dŚŝƐĂůůŽǁƐŽƵƌĐůŝĞŶƚƐŽŶĂŶŶƵĂůŵĂŝŶƚĞŶĂŶĐĞƚŽƌĞĐĞŝǀĞĂĚĚŝƚŝŽŶĂůĨƵŶĐƚŝŽŶĂůŝƚLJ ĨƌŽŵŶĞǁĐůŝĞŶƚƐĂƐǁĞůůĂƐŽƵƌƐƵƉƉŽƌƚƚĞĂŵĚŽĞƐŶŽƚŚĂǀĞƚŽǁŽƌƌLJƚŚĂƚLJŽƵŚĂǀĞŵŽĚŝĨŝĐĂƚŝŽŶƐǁŚĞŶĞŝƚŚĞƌ ƐƵƉƉŽƌƚŝŶŐŽƌƵƉŐƌĂĚŝŶŐLJŽƵ͘DŽƐƚǀĞŶĚŽƌƐƚŽĚĂLJƐƚŝůůŵĂŝŶƚĂŝŶŵŽĚŝĨŝĐĂƚŝŽŶƐďLJŝŶĚŝǀŝĚƵĂůĐůŝĞŶƚƐǁŚŝĐŚ ƉůĂĐĞƐŵŽƌĞƐƚƌĞƐƐŽŶƚŚĞŝƌƐƵƉƉŽƌƚƚĞĂŵƐĂŶĚĐŽƐƚƚŽƚŚĞĐůŝĞŶƚǁŚĞŶƵƉŐƌĂĚŝŶŐ͘ ŽŵŵŝƚŵĞŶƚ ƚdLJůĞƌ͕ǁĞĂƌĞƵŶŝƋƵĞůLJƋƵĂůŝĨŝĞĚƚŽŵĞĞƚƚŚĞŶĞĞĚƐŽĨƚŚĞŝƚLJƚŚƌŽƵŐŚŽƵƌĞdžƉĞƌŝĞŶĐĞ͕ŽƵƌƐŽĨƚǁĂƌĞ͕ĂŶĚ ŽƵƌĂďƐŽůƵƚĞĐŽŵŵŝƚŵĞŶƚƚŽĐƵƐƚŽŵĞƌƐĂƚŝƐĨĂĐƚŝŽŶ͘dŚĂƚĐŽŵŵŝƚŵĞŶƚ͕ĂůŽŶŐǁŝƚŚƚŚĞĐŽŶƐŝƐƚĞŶƚĞǀŽůƵƚŝŽŶŽĨ ƚĞĐŚŶŽůŽŐLJĂŶĚƐŽĨƚǁĂƌĞĨĞĂƚƵƌĞƐ͕ŚĂƐƌĞƐƵůƚĞĚŝŶĂƌĞƚĞŶƚŝŽŶƌĂƚĞŽĨŵŽƌĞƚŚĂŶϵϴƉĞƌĐĞŶƚĂŶĚůŽŶŐͲƚĞƌŵ ƌĞůĂƚŝŽŶƐŚŝƉƐǁŝƚŚŽƵƌƵƐĞƌƐ͘tŝƚŚŵŽƌĞƚŚĂŶϮϲ͕ϬϬϬĐƵƐƚŽŵĞƌƐ͕ƚŚŝƐƉĂƌƚŶĞƌƐŚŝƉŝƐĂŶŝŶƚĞŐƌĂůƉĂƌƚŽĨǁŚŽǁĞ ĂƌĞĂŶĚǁŚĂƚǁĞĚŽ͘KƵƌĐƵƐƚŽŵĞƌƐŚĂǀĞĂĚŝƌĞĐƚŝŵƉĂĐƚŽŶƚŚĞĞǀŽůƵƚŝŽŶŽĨƚŚĞƐŽĨƚǁĂƌĞĂŶĚƚŚĞƉƌŽĐĞƐƐĞƐ ŝŶǀŽůǀĞĚŝŶŝŵƉůĞŵĞŶƚŝŶŐĂŶĚƐƵƉƉŽƌƚŝŶŐŝƚ͘ WƌŽƚĞĐƚŝŶŐzŽƵƌ/ŶǀĞƐƚŵĞŶƚĨŽƌzĞĂƌƐƚŽŽŵĞ dLJůĞƌ͛Ɛ͞ǀĞƌŐƌĞĞŶ͟ĞǀĞůŽƉŵĞŶƚWŚŝůŽƐŽƉŚLJĞŶƐƵƌĞƐƚŚĂƚƚŚĞŝƚLJǁŝůůĂůǁĂLJƐŚĂǀĞŝŶĚƵƐƚƌLJͲůĞĂĚŝŶŐ ĨƵŶĐƚŝŽŶĂůŝƚLJƚŚĂƚƵƚŝůŝnjĞƐĐƵƌƌĞŶƚƚĞĐŚŶŽůŽŐLJ͘ƐƉĂƌƚŽĨŽƵƌĂŶŶƵĂůƐƵƉƉŽƌƚĨĞĞ͕ĂůůĞŶŚĂŶĐĞŵĞŶƚƐƚŽŽƵƌ ƐŽĨƚǁĂƌĞĂƌĞƉƌŽǀŝĚĞĚĂƚŶŽĂĚĚŝƚŝŽŶĂůĐŚĂƌŐĞ͘dŚŝƐĂůůŽǁƐŽƵƌƵƐĞƌƐƚŽĐŽŶƚŝŶƵĞƚŽƚĂŬĞĂĚǀĂŶƚĂŐĞŽĨŶĞǁ ĂĚǀĂŶĐĞƐǁŝƚŚŽƵƚŚĂǀŝŶŐƚŽƌĞůŝĐĞŶƐĞƚŚĞƐŽĨƚǁĂƌĞ͘ĚĚŝƚŝŽŶĂůůLJ͕ƚŚĞƐĞĞŶŚĂŶĐĞŵĞŶƚƐĂƌĞĚĞůŝǀĞƌĞĚŝŶ ŵĂŶĂŐĞĂďůĞƵƉŐƌĂĚĞƐƚŚĂƚĚŽŶŽƚƌĞƋƵŝƌĞĂĐŽŵƉůĞƚĞƌĞŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨƚŚĞƐŽĨƚǁĂƌĞ͘ WĂƌƚŶĞƌƐŚŝƉ tĞǁĂŶƚƚŽƚŚĂŶŬƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶĨŽƌƚŚĞŽƉƉŽƌƚƵŶŝƚLJƚŽƌĞƐƉŽŶĚƚŽLJŽƵƌZĞƋƵĞƐƚĨŽƌWƌŽƉŽƐĂůĂŶĚĨŽƌ LJŽƵƌƚŝŵĞĂŶĚĐŽŶƐŝĚĞƌĂƚŝŽŶĚƵƌŝŶŐƚŚĞƌĞǀŝĞǁƉƌŽĐĞƐƐ͘ƚdLJůĞƌ͕ǁĞĨĞĞůƚŚĞĞǀĂůƵĂƚŝŽŶĂŶĚƐĞůĞĐƚŝŽŶŽĨŶĞǁ ƐŽĨƚǁĂƌĞƐŚŽƵůĚďĞĂƐŵƵĐŚĂďŽƵƚƉĞŽƉůĞĂƐŝƚŝƐƉƌŽĚƵĐƚ͕ǁŝƚŚƚŚĞƵůƚŝŵĂƚĞĚĞĐŝƐŝŽŶƌĞƐƵůƚŝŶŐŝŶĂƉĂƌƚŶĞƌƐŚŝƉ ďĞƚǁĞĞŶƚŚĞĐƵƐƚŽŵĞƌĂŶĚƚŚĞŝƌĐŚŽƐĞŶƐŽĨƚǁĂƌĞƉƌŽǀŝĚĞƌ͘/ƚŝƐŽƵƌĨŝƌŵďĞůŝĞĨƚŚĂƚdLJůĞƌŝƐƵŶŝƋƵĞůLJƋƵĂůŝĨŝĞĚ ƚŽďĞƚŚĂƚƉĂƌƚŶĞƌĂŶĚŵŽƌĞƚŚĂŶŵĞĞƚƐƚŚĞŶĞĞĚƐŽƵƚůŝŶĞĚďLJƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶŝŶƚŚŝƐĚŽĐƵŵĞŶƚ͘^ŚŽƵůĚ LJŽƵĂŐƌĞĞ͕ǁĞůŽŽŬĨŽƌǁĂƌĚƚŽƉƌŽŐƌĞƐƐŝŶŐƚŽƚŚĞŶĞdžƚƐƚĂŐĞŝŶLJŽƵƌĞǀĂůƵĂƚŝŽŶƉƌŽĐĞƐƐ͘ ^ĞĐƚŝŽŶϭ͘ϬͲdžĞĐƵƚŝǀĞ^ƵŵŵĂƌLJĂŶĚ/ŶƚƌŽĚƵĐƚŽƌLJDĂƚĞƌŝĂůƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϰ E.1 ƚƚĂĐŚŵĞŶƚϭ;Z&W^ƵďŵŝƚƚĂůŚĞĐŬůŝƐƚͿ 6XEPLWWDO&KHFNOLVW 6HFWLRQ,WHP6XEPLWWHG % ([HFXWLYH6XPPDU\DQG,QWURGXFWRU\0DWHULDOVy ( $WWDFKPHQW5)36XEPLWWDO&KHFNOLVWy ( $WWDFKPHQW6LJQDWXUH3DJHy ( $WWDFKPHQW3URSRVHU6WDWHPHQWy % 6FRSHRI6HUYLFHVy ( $WWDFKPHQW6FRSHRI3URSRVDOy ( $WWDFKPHQW&RPSDQ\%DFNJURXQGy ( $WWDFKPHQW5HIHUHQFH)RUPy % )XQFWLRQDO5HTXLUHPHQWVy ( $WWDFKPHQW)XQFWLRQDO5HTXLUHPHQWVy ( $WWDFKPHQW7HFKQLFDO6SHFLILFDWLRQVy % ,PSOHPHQWDWLRQ3ODQy ( $WWDFKPHQW&RQYHUVLRQVy ( $WWDFKPHQW6WDIILQJy % 2QJRLQJ6XSSRUWDQG+RVWLQJ6HUYLFHVy ( $WWDFKPHQW6RIWZDUHDVD6HUYLFHV+RVWLQJy ( $WWDFKPHQW3URSRVHG6HUYLFH/HYHO$JUHHPHQWy ( $WWDFKPHQW0DLQWHQDQFHDQG6XSSRUWy % ([FHSWLRQVWRWKH5)3y % 'HOLYHUDEOHVDQG3URMHFW2XWFRPHVy % 6DPSOH'RFXPHQWVy % 3ULFH3URSRVDOXQGHUVHSDUDWHFRYHUy ($WWDFKPHQW&RVWy ^ĞĐƚŝŽŶϭ͘ϬͲdžĞĐƵƚŝǀĞ^ƵŵŵĂƌLJĂŶĚ/ŶƚƌŽĚƵĐƚŽƌLJDĂƚĞƌŝĂůƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϱ ($WWDFKPHQW6LJQDWXUH3DJH 7KHXQGHUVLJQHGSURSRVHUKDYLQJH[DPLQHGWKLV5)3DQGKDYLQJIXOONQRZOHGJHRIWKHFRQGLWLRQ XQGHUZKLFKWKHZRUNGHVFULEHGKHUHLQPXVWEHSHUIRUPHGKHUHE\SURSRVHVWKDWWKHSURSRVHU ZLOOIXOILOOWKHREOLJDWLRQVFRQWDLQHGKHUHLQLQDFFRUGDQFHZLWKDOOLQVWUXFWLRQVWHUPVFRQGLWLRQV DQGVSHFLILFDWLRQVVHWIRUWKDQGWKDWWKHSURSRVHUZLOOIXUQLVKDOOUHTXLUHGSURGXFWVVHUYLFHVDQG SD\DOOLQFLGHQWDOFRVWVLQVWULFWFRQIRUPLW\ZLWKWKHVHGRFXPHQWVIRUWKHVWDWHGSULFHVDV SURSRVHG *džĐĞƉƚĂƐŵŽĚŝĨŝĞĚďLJ͕ƚĂŬĞŶĞdžĐĞƉƚŝŽŶƚŽ͕ĂŶĚĂƐŽƚŚĞƌǁŝƐĞƉƌŽǀŝĚĞĚŝŶdLJůĞƌ͛ƐWƌŽƉŽƐĂů 6XEPLWWLQJ)LUP7\OHU7HFKQRORJLHV,QF $GGUHVVUG6WUHHW *RYHUQPHQW/XEERFN 6WDWH7; =LS $XWKRUL]HG5HSUHVHQWDWLYHSULQW'DQH:RPEOH 7LWOH3UHVLGHQW/*' $XWKRUL]HG6LJQDWXUH 'DWH Contact Information: 1DPH&RG\*XQVWHQVRQ 7LWOH$FFRXQW([HFXWLYH $GGUHVV7HQQ\VRQ3NZ\ *RYHUQPHQW3ODQR 6WDWH7;=LS (PDLOFRG\JXQVWHQVRQ#W\OHUWHFKFRP 3KRQH &HOO3KRQH )D[ Software Demonstrations / Implementation Interviews: 6RIWZDUHGHPRQVWUDWLRQVDUHFXUUHQWO\VFKHGXOHGIRUWKHIROORZLQJGDWHV3OHDVHLQGLFDWH\RXUDYDLODELOLW\ DQGGDWHSUHIHUHQFHWRSURYLGHVRIWZDUHGHPRQVWUDWLRQVLQWKHHYHQW\RXUSURSRVDOLVHOHYDWHGWRVRIWZDUH GHPRQVWUDWLRQV(OHYDWHGSURSRVHUVZLOOEHQRWLILHGRIWKHVFKHGXOHGGHPRQVWUDWHGDWHZKHQHOHYDWHG x:HHNx$YDLODELOLW\<1x 3UHIHUHQFH1R3UHIHUHQFH x±z^ ϯ xDQGz^ ϭ x±z^ Ϯ ^ĞĐƚŝŽŶϭ͘ϬͲdžĞĐƵƚŝǀĞ^ƵŵŵĂƌLJĂŶĚ/ŶƚƌŽĚƵĐƚŽƌLJDĂƚĞƌŝĂůƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϲ 1.ƚƚĂĐŚŵĞŶƚϯ;WƌŽƉŽƐĞƌ^ƚĂƚĞŵĞŶƚͿ %\VXEPLWWLQJDUHVSRQVHWKHUHVSRQGHQWDFNQRZOHGJHVWKDWKHVKHKDVDFTXDLQWHGWKHPVHOYHVZLWKWKH WHUPVVFRSHDQGUHTXLUHPHQWVRIWKHSURMHFWEDVHGRQWKHLQIRUPDWLRQFRQWDLQHGLQWKLV5)3DQGDQ\ DGGHQGXPV$Q\IDLOXUHE\WKHSURSRVHUWRDFTXDLQWWKHPVHOYHVZLWKDYDLODEOHLQIRUPDWLRQZLOOQRWUHOLHYH WKHPIURPWKHUHVSRQVLELOLW\IRUHVWLPDWLQJSURSHUO\WKHGLIILFXOW\RUFRVWRIVXFFHVVIXOO\SHUIRUPLQJWKH ZRUNDYDLODEOH7KH*RYHUQPHQWLVQRWUHVSRQVLEOHIRUDQ\FRQFOXVLRQVRULQWHUSUHWDWLRQVPDGHE\WKH SURSRVHURQWKHEDVLVRIWKHLQIRUPDWLRQPDGHDYDLODEOHE\WKH*RYHUQPHQW 7KHIROORZLQJDGGHQGXPVKDYHEHHQDFNQRZOHGJHGDQGDUHLQFOXGHGLQRXUUHVSRQVH3URSRVDOVWKDWGR QRWDFNQRZOHGJHDGGHQGXPVPD\EHUHMHFWHG $GGHQGXP,QLWLDOV 'ĞŶĞƌĂůdĞĐŚ ZĞƋƵŝƌĞŵĞŶƚƐ ' 'ĞŶĞƌĂů>ĞĚŐĞƌ ƌĞƋƵŝƌĞŵĞŶƚƐ ' WƵƌĐŚĂƐŝŶŐ ZĞƋƵŝƌĞŵĞŶƚƐ ' ƵĚŐĞƚ ƌĞƋƵŝƌĞŵĞŶƚƐ ' W ƌĞƋƵŝƌĞŵĞŶƚƐ ' WƌŝĐĞŽƐƚ ' 'DQH:RPEOH3UHVLGHQW/*' 35,17('1$0(2)$87+25,=('$*(177,7/( 6,*1$785(2)$87+25,=('$*(17 '$7( ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϳ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ($WWDFKPHQW6FRSHRI3URSRVDO ,GHQWLI\WKHVFRSHRIWKHSURSRVDODQGLIWKHSURSRVDOFRQWDLQVVRIWZDUHDQGVHUYLFHVIRUHDFKVFRSH RSWLRQ6FRSHRSWLRQVDUHGHILQHGLQWKH5)3LQVHFWLRQ$DQG6HFWLRQ& 6RIWZDUHDQG,PSOHPHQWDWLRQ6HUYLFHV ; 3URSRVHG 1RW3URSRVHG Primary Software Firm Tyler Technologies, Inc. Software Product Proposed Incode 10 9HUVLRQ Primary Implementation Firm Tyler Technologies, Inc. 7HFKQRORJ\6HUYLFHV ; +RVWLQJ6HUYLFHV ; 3URSRVHG6RIWZDUHDVD6HUYLFH3URSRVHG 1RW3URSRVHG Hosting Provider: Tyler Technologies, Inc. 2QJRLQJ6XSSRUW yx2QJRLQJ6XSSRUW3URYLGHGE\6RIWZDUH9HQGRU yx2QJRLQJ6XSSRUW3URYLGHGE\,PSOHPHQWDWLRQ)LUP x2QJRLQJ6XSSRUW3URYLGHGE\7KLUG3DUW\ Firm Primarily Responsible for Ongoing Support: Tyler Technologies, Inc. 7KLUG3DUW\3URGXFWV6HUYLFHV 7KLUG3DUW\3URGXFWV6HUYLFHV3URSRVHG ; 1R7KLUG3DUW\3URGXFWV6HUYLFHV3URSRVHG Firm Purpose Firm Purpose Firm Purpose Firm Purpose Firm 3urpose Firm Purpose 1DPHRI,QGLYLGXDO)LUP6XEPLWWLQJ3URSRVDO 7\OHU7HFKQRORJLHV,QF 6LJQDWXUHRI3URSRVHU ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϴ 1.ƚƚĂĐŚŵĞŶƚϱ;ŽŵƉĂŶLJĂĐŬŐƌŽƵŶĚͿ &RPSOHWHRQHIRUPIRUHDFKILUPLQFOXGHGLQWKHSURSRVDO &RPSDQ\%DFNJURXQG &RPSDQ\1DPHdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ /RFDWLRQRIFRUSRUDWHKHDGTXDUWHUVWůĂŶŽ͕dy 3URSRVHU([SHULHQFH RI\HDUVLQEXVLQHVVϯϬнLJĞĂƌƐ RI\HDUVSURYLGLQJV\VWHPVVHUYLFHVWRSXEOLF VHFWRU ϯϬнLJĞĂƌƐ &XVWRPHU%DVH RIFOLHQWVXVLQJSURSRVHGVRIWZDUHVHUYLFHVϵϭϮůŝĞŶƚƐdŽƚĂůƵƐŝŶŐ/ŶĐŽĚĞsϭϬ RIFOLHQWVXVLQJRWKHUVLPLODUVRIWZDUHVHUYLFHVϭϱϬϬнůŝĞŶƚƐEĂƚŝŽŶǁŝĚĞhƐŝŶŐ/ŶĐŽĚĞ^ŽĨƚǁĂƌĞ 0DUNHW)RFXV ,GHQWLI\RWKHULQGXVWULHVVHUYLFHGRWKHUWKDQ ORFDOJRYHUQPHQWV dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĨŽĐƵƐĞƐƐŽůĞůLJŽŶƚŚĞWƵďůŝĐ^ĞĐƚŽƌ ĨŽƌƵƐŝŶĞƐƐKƉĞƌĂƚŝŽŶƐ͘tĞĚŽŶŽƚŽƉĞƌĂƚĞŽƵƚƐŝĚĞŽĨ ƚŚĞWƵďůŝĐ^ĞĐƚŽƌ͘ ,IQRW3ULPDU\3URSRVHU RISDVWSURMHFWVSDUWQHULQJZLWKSULPDU\ SURSRVHU Eͬ 2IILFLDO3DUWQHUVKLSVWDWXVFHUWLILFDWLRQLI DSSOLFDEOH Eͬ $ERXWWKH&RPSDQ\ 1XPEHURI7RWDO(PSOR\HHVϵϬϬн 1XPEHURI(PSOR\HHV3URYLGLQJ ,PSOHPHQWDWLRQ6HUYLFHVLIDSSOLFDEOH ϮϵϮ 1XPEHURI(PSOR\HHV6XSSRUWLQJ3URGXFW 0DLQWHQDQFHDQG6XSSRUWLIDSSOLFDEOH Ϯϲϰ 1XPEHURI(PSOR\HHV'HGLFDWHGWR3URGXFW 'HYHORSPHQWLIDSSOLFDEOH ϱϯ ĚĚŝƚŝŽŶĂůŽŵƉĂŶLJ/ŶĨŽƌŵĂƚŝŽŶ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŝƐƚŚĞůĂƌŐĞƐƚĂŶĚŵŽƐƚĞƐƚĂďůŝƐŚĞĚƉƌŽǀŝĚĞƌŽĨŝŶƚĞŐƌĂƚĞĚƐŽĨƚǁĂƌĞĂŶĚƚĞĐŚŶŽůŽŐLJ ƐĞƌǀŝĐĞƐĨŽĐƵƐĞĚŽŶƚŚĞƉƵďůŝĐƐĞĐƚŽƌ͘dLJůĞƌΖƐĞŶĚͲƚŽͲĞŶĚƐŽůƵƚŝŽŶƐĞŵƉŽǁĞƌůŽĐĂů͕ƐƚĂƚĞ͕ĂŶĚĨĞĚĞƌĂů ŐŽǀĞƌŶŵĞŶƚĞŶƚŝƚŝĞƐƚŽŽƉĞƌĂƚĞŵŽƌĞĞĨĨŝĐŝĞŶƚůLJĂŶĚĐŽŶŶĞĐƚŵŽƌĞƚƌĂŶƐƉĂƌĞŶƚůLJǁŝƚŚƚŚĞŝƌĐŽŶƐƚŝƚƵĞŶƚƐĂŶĚ ǁŝƚŚĞĂĐŚŽƚŚĞƌ͘LJĐŽŶŶĞĐƚŝŶŐĚĂƚĂĂŶĚƉƌŽĐĞƐƐĞƐĂĐƌŽƐƐĚŝƐƉĂƌĂƚĞƐLJƐƚĞŵƐ͕dLJůĞƌΖƐƐŽůƵƚŝŽŶƐĂƌĞ ƚƌĂŶƐĨŽƌŵŝŶŐŚŽǁĐůŝĞŶƚƐŐĂŝŶĂĐƚŝŽŶĂďůĞŝŶƐŝŐŚƚƐƚŚĂƚƐŽůǀĞƉƌŽďůĞŵƐŝŶƚŚĞŝƌĐŽŵŵƵŶŝƚŝĞƐ͘dLJůĞƌŚĂƐŵŽƌĞ ƚŚĂŶϮϳ͕ϬϬϬƐƵĐĐĞƐƐĨƵůŝŶƐƚĂůůĂƚŝŽŶƐĂĐƌŽƐƐŵŽƌĞƚŚĂŶϭϭ͕ϬϬϬƐŝƚĞƐ͕ǁŝƚŚĐůŝĞŶƚƐŝŶĂůůϱϬƐƚĂƚĞƐ͕ĂŶĂĚĂ͕ƚŚĞ ĂƌŝďďĞĂŶ͕ƵƐƚƌĂůŝĂ͕ĂŶĚŽƚŚĞƌŝŶƚĞƌŶĂƚŝŽŶĂůůŽĐĂƚŝŽŶƐ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϵ KƵƌWƌŽĚƵĐƚƐ tŝƚŚĚĞĐĂĚĞƐŽĨĞdžĐůƵƐŝǀĞƉƵďůŝĐƐĞĐƚŽƌĞdžƉĞƌŝĞŶĐĞ͕dLJůĞƌŝƐƚŚĞŵĂƌŬĞƚůĞĂĚĞƌƉƌŽǀŝĚŝŶŐŝŶƚĞŐƌĂƚĞĚƐŽĨƚǁĂƌĞ ĂŶĚƐĞƌǀŝĐĞƐ͘^ƵďũĞĐƚŵĂƚƚĞƌĞdžƉĞƌƚƐĂŶĚŝŶͲĚĞƉƚŚƉƌŽĚƵĐƚƐƌĞƐƵůƚŝŶĂƐƵƐƚĂŝŶĂďůĞĐůŝĞŶƚƉĂƌƚŶĞƌƐŚŝƉƚŚĂƚ ĚĞůŝǀĞƌƐƚŚĞŝŶĚƵƐƚƌLJ͛ƐŵŽƐƚĐŽŵƉƌĞŚĞŶƐŝǀĞƐŽůƵƚŝŽŶ͘tĞƉƌŽǀŝĚĞƚŚĞŝŶĚƵƐƚƌLJ͛ƐďƌŽĂĚĞƐƚůŝŶĞŽĨƐŽĨƚǁĂƌĞ ƉƌŽĚƵĐƚƐĂŶĚŽĨĨĞƌĐůŝĞŶƚƐĂƐŝŶŐůĞƐŽƵƌĐĞĨŽƌĂůůƚŚĞŝƌŝŶĨŽƌŵĂƚŝŽŶƚĞĐŚŶŽůŽŐLJŶĞĞĚƐŝŶƐĞǀĞƌĂůŵĂũŽƌĂƌĞĂƐ͗ ƉƉƌĂŝƐĂůΘdĂdž͕ZW͕ŝǀŝĐ^ĞƌǀŝĐĞƐ͕>ĂŶĚΘKĨĨŝĐŝĂůZĞĐŽƌĚƐ͕ŽƵƌƚƐΘ:ƵƐƚŝĐĞ͕WƵďůŝĐ^ĂĨĞƚLJ͕ĂƚĂΘ/ŶƐŝŐŚƚƐ͕ ĂŶĚ^ĐŚŽŽůƐ͘ tĞĂƌĞŬŶŽǁŶĨŽƌůŽŶŐͲƐƚĂŶĚŝŶŐĐůŝĞŶƚƌĞůĂƚŝŽŶƐŚŝƉƐ͕ĨƵŶĐƚŝŽŶĂůĂŶĚĨĞĂƚƵƌĞͲƌŝĐŚƉƌŽĚƵĐƚƐ͕ĂŶĚƚŚĞůĂƚĞƐƚ ƚĞĐŚŶŽůŽŐLJ͘/ŶĂĚĚŝƚŝŽŶƚŽƐŽĨƚǁĂƌĞƉƌŽĚƵĐƚƐ͕dLJůĞƌƉƌŽǀŝĚĞƐƌĞůĂƚĞĚƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐŝŶĐůƵĚŝŶŐ ŝŶƐƚĂůůĂƚŝŽŶ͕ĚĂƚĂĐŽŶǀĞƌƐŝŽŶ͕ĐŽŶƐƵůƚŝŶŐ͕ƚƌĂŝŶŝŶŐ͕ĐƵƐƚŽŵŝnjĂƚŝŽŶ͕ƐƵƉƉŽƌƚ͕ĚŝƐĂƐƚĞƌƌĞĐŽǀĞƌLJ͕ĂŶĚĂƉƉůŝĐĂƚŝŽŶ ĂŶĚĚĂƚĂŚŽƐƚŝŶŐ͘ ďŽƵƚdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ xŵƉŽǁĞƌŝŶŐŐŽǀĞƌŶŵĞŶƚĂŶĚƐĐŚŽŽůƐƚŽĐƌĞĂƚĞƐĂĨĞƌ͕ƐŵĂƌƚĞƌĂŶĚŵŽƌĞǀŝďƌĂŶƚĐŽŵŵƵŶŝƚŝĞƐ x^ŽůƵƚŝŽŶƐŝŶĐůƵĚĞ͗ƉƉƌĂŝƐĂůΘdĂdž͕ŝǀŝĐ^ĞƌǀŝĐĞƐ͕ŽƵƌƚƐΘ:ƵƐƚŝĐĞ͕ĂƚĂΘ/ŶƐŝŐŚƚƐ͕ZW͕>ĂŶĚΘ KĨĨŝĐŝĂůZĞĐŽƌĚƐ͕WƵďůŝĐ^ĂĨĞƚLJĂŶĚ^ĐŚŽŽůƐ x,ĞĂĚƋƵĂƌƚĞƌĞĚŝŶWůĂŶŽ͕dĞdžĂƐ͕ǁŝƚŚϮϴŽĨĨŝĐĞůŽĐĂƚŝŽŶƐĂĐƌŽƐƐƚŚĞh͘^͘ĂŶĚĂŶĂĚĂ xdLJůĞƌǁĂƐŝŶĐŽƌƉŽƌĂƚĞĚŝŶĞůĂǁĂƌĞŝŶEŽǀĞŵďĞƌϭϵϴϵ xdLJůĞƌŝƐĂƉƵďůŝĐůLJƚƌĂĚĞĚĐŽƌƉŽƌĂƚŝŽŶŽŶƚŚĞEz^;dz>Ϳ x&ŽƵŶĚĞĚŝŶϭϵϲϲ xdžĐůƵƐŝǀĞůLJĨŽĐƵƐĞĚŽŶůŽĐĂůŐŽǀĞƌŶŵĞŶƚƐŝŶĐĞϭϵϵϳ xDŽƌĞƚŚĂŶϮϲ͕ϬϬϬƐƵĐĐĞƐƐĨƵůŝŶƐƚĂůůĂƚŝŽŶƐĂĐƌŽƐƐϭϬ͕ϬϬϬƐŝƚĞƐ͕ǁŝƚŚĐůŝĞŶƚƐŝŶĂůůϱϬƐƚĂƚĞƐ͕ĂŶĂĚĂ͕ƚŚĞ ĂƌŝďďĞĂŶ͕ƵƐƚƌĂůŝĂĂŶĚŽƚŚĞƌŝŶƚĞƌŶĂƚŝŽŶĂůůŽĐĂƚŝŽŶƐ xůŝĞŶƚƌĞƚĞŶƚŝŽŶƌĂƚĞŽĨϵϴй xϱ͕ϱϬϬнĞŵƉůŽLJĞĞƐ xŶŶƵĂůƌĞǀĞŶƵĞƐŽĨΨϭ͘ϬϴďŝůůŝŽŶ;ϮϬϭϵͿ xZĞŝŶǀĞƐƚŵĞŶƚŽĨΨϲϰDŝŶƚŽZĞƐĞĂƌĐŚΘĞǀĞůŽƉŵĞŶƚ x^ĐĂůĂďůĞƉƌŽĚƵĐƚƐǁŝƚŚƚŚĞƐŵĂůůĞƐƚũƵƌŝƐĚŝĐƚŝŽŶ;>ŽǀŝŶŐŝƚLJ͕dĞdžĂƐ͕ǁŝƚŚĂƉŽƉƵůĂƚŝŽŶŽĨϴϮͿƚŽƚŚĞ ůĂƌŐĞƐƚ;>ŽƐŶŐĞůĞƐŝƚLJ͕ĂůŝĨŽƌŶŝĂ͕ǁŝƚŚĂƉŽƉƵůĂƚŝŽŶŽĨϭϬ͘ϭDͿ WƵďůŝĐ^ĞĐƚŽƌ&ŽĐƵƐ dLJůĞƌ͛ƐďƵƐŝŶĞƐƐƵŶŝƚƐŚĂǀĞƉƌŽǀŝĚĞĚƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐƚŽĐůŝĞŶƚƐĨŽƌŵŽƌĞƚŚĂŶϱϬLJĞĂƌƐĂŶĚŚĂǀĞůŽŶŐͲ ƐƚĂŶĚŝŶŐƌĞƉƵƚĂƚŝŽŶƐŝŶƚŚĞůŽĐĂůŐŽǀĞƌŶŵĞŶƚŵĂƌŬĞƚĨŽƌƋƵĂůŝƚLJƉƌŽĚƵĐƚƐĂŶĚĐƵƐƚŽŵĞƌƐĞƌǀŝĐĞ͘dLJůĞƌŝƐƚŚĞ ůĂƌŐĞƐƚĐŽŵƉĂŶLJŝŶƚŚĞhŶŝƚĞĚ^ƚĂƚĞƐĨŽĐƵƐĞĚƐŽůĞůLJŽŶƉƌŽǀŝĚŝŶŐƐŽĨƚǁĂƌĞƐŽůƵƚŝŽŶƐƚŽƚŚĞƉƵďůŝĐƐĞĐƚŽƌ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϬ tŚŝůĞŵĂŶLJŽĨŽƵƌĐŽŵƉĞƚŝƚŽƌƐĐŽŵƉĞƚĞŝŶŵƵůƚŝƉůĞǀĞƌƚŝĐĂůŵĂƌŬĞƚƐ͕dLJůĞƌŝƐƐŝŶŐƵůĂƌůLJĨŽĐƵƐĞĚŽŶƚŚĞƉƵďůŝĐ ƐĞĐƚŽƌ͘/ƚŝƐϭϬϬƉĞƌĐĞŶƚŽĨŽƵƌďƵƐŝŶĞƐƐ͘ dLJůĞƌƌĞĐŽŐŶŝnjĞƐƚŚĂƚƚŚĞƉƵďůŝĐƐĞĐƚŽƌŝƐŐĞŶĞƌĂůůLJƐƚĂďůĞĂŶĚƌŝƐŬͲĂǀĞƌƐĞ͕ĂŶĚĐƌĂǀĞƐĐŽŵŵƵŶŝƚLJĂĐĐĞƐƐŝďŝůŝƚLJ͕ ƐĞĐƵƌŝƚLJĂŶĚƚƌĂŶƐƉĂƌĞŶĐLJ͘dŚĂƚŝƐǁŚLJůŽĐĂůŐŽǀĞƌŶŵĞŶƚĂŶĚƐĐŚŽŽůĞŶƚŝƚŝĞƐƐĞĞŬƌĞůŝĂďůĞĂŶĚĞĨĨŝĐŝĞŶƚ ƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐĨƌŽŵdLJůĞƌʹĂǀĞŶĚŽƌǁŚŽŝƐƉƌŽĨĞƐƐŝŽŶĂů͕ƌĞƉƵƚĂďůĞĂŶĚĚĞĚŝĐĂƚĞĚĂŶĚĂĐŚŝĞǀĞƐ ƌĞƐƵůƚƐ͘dLJůĞƌŚĂƐƚŚĞĞdžƉĞƌŝĞŶĐĞƚŽƵŶĚĞƌƐƚĂŶĚƚŚĞƵŶŝƋƵĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚĞƉƵďůŝĐƐĞĐƚŽƌ͕ƚŚĞŶĞĐĞƐƐĂƌLJ ƌĞƐŽƵƌĐĞƐƚŽŝŶǀĞƐƚŝŶŝƚƐƉƌŽĚƵĐƚƐĂŶĚƚŚĞĂďŝůŝƚLJƚŽĚĞůŝǀĞƌƋƵĂůŝƚLJƐĞƌǀŝĐĞƐ͘ &ŝŶĂŶĐŝĂů^ƚĂďŝůŝƚLJ dLJůĞƌĐŽŶƐŝƐƚĞŶƚůLJŵĂŝŶƚĂŝŶƐĂƐŽůŝĚďĂůĂŶĐĞƐŚĞĞƚĂŶĚƐƚƌŽŶŐĐĂƐŚĨůŽǁĂŶĚůŽǁ ĚĞďƚ͕ĞdžƉĞƌŝĞŶĐŝŶŐĐŽŶƐŝƐƚĞŶƚƌĞǀĞŶƵĞŐƌŽǁƚŚǁŝƚŚϮϵĐŽŶƐĞĐƵƚŝǀĞƋƵĂƌƚĞƌƐŽĨ ƉƌŽĨŝƚĂďŝůŝƚLJ͕ĂŶĚĂƚŽƚĂůƌĞǀĞŶƵĞĨŽƌϮϬϭϵŽĨΨϭ͘ϬϴďŝůůŝŽŶ͘tŚŝůĞĞdžƉĞƌŝĞŶĐŝŶŐ ƐŝŐŶŝĨŝĐĂŶƚŐƌŽǁƚŚŽƉƉŽƌƚƵŶŝƚŝĞƐĨƌŽŵĂŶŝŶĐƌĞĂƐĞŝŶƐƚĂĨĨĂŶĚĞdžƉĂŶĚŝŶŐ ƚĞƌƌŝƚŽƌŝĞƐ͕ǁĞĂŶƚŝĐŝƉĂƚĞĂĚĚŝƚŝŽŶĂůƉƌŽĚƵĐƚŽĨĨĞƌŝŶŐƐĂŶĚŶĞǁƚĞĐŚŶŽůŽŐLJǁŝůů ĂĐĐĞůĞƌĂƚĞƚŚŝƐŐƌŽǁƚŚƐƵďƐƚĂŶƚŝĂůůLJŝŶƚŚĞĨƵƚƵƌĞ͘tĞďĞůŝĞǀĞĂĚĞďƚͲĨƌĞĞ ďĂůĂŶĐĞƐŚĞĞƚ͕ƐƵďƐƚĂŶƚŝĂůĐĂƐŚƌĞƐĞƌǀĞƐ͕ĂŶĚĂĐŽŵŵŝƚƚĞĚĐƵƐƚŽŵĞƌďĂƐĞƉƵƚ dLJůĞƌŝŶĂŐƌĞĂƚƉŽƐŝƚŝŽŶŝŶŽƵƌŝŶĚƵƐƚƌLJƚŽǁĞĂƚŚĞƌĂŶLJƵŶĞdžƉĞĐƚĞĚƚƵƌďƵůĞŶĐĞ ŝŶƚŚĞĞĐŽŶŽŵLJ͘ &ŽƌĂĚĚŝƚŝŽŶĂůƌĞǀĞŶƵĞŝŶĨŽƌŵĂƚŝŽŶƉůĞĂƐĞǀŝƐŝƚǁǁǁ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵ /ŶĚƵƐƚƌLJ>ĞĂĚĞƌƐŚŝƉ dLJůĞƌƐƚƌŝǀĞƐƚŽƉƌŽǀŝĚĞƚŚĞďĞƐƚĐůŝĞŶƚƐĞƌǀŝĐĞƐŝŶƚŚĞŝŶĚƵƐƚƌLJ͘KƵƌƉƌŽĚƵĐƚƐƵŶĚĞƌŐŽƚĞƐƚŝŶŐďLJƚƌĂŝŶĞĚ ƋƵĂůŝƚLJĂƐƐƵƌĂŶĐĞĂŶĚĐĞƌƚŝĨŝĞĚƵƐĂďŝůŝƚLJĂŶĂůLJƐƚƐ͕ƚŚĞƌĞĨŽƌĞŽƵƌĐůŝĞŶƚƐďĞŶĞĨŝƚĨƌŽŵƉƌŽĚƵĐƚƐƚŚĂƚǁŽƌŬ ůŽŐŝĐĂůůLJďĂƐĞĚƵƉŽŶƵƐĞƌĞdžƉĞƌŝĞŶĐĞĂŶĚŝŶƉƵƚ͘tĞĂůƐŽĨŽĐƵƐŽƵƌŝŵƉůĞŵĞŶƚĂƚŝŽŶĂŶĚƐƵƉƉŽƌƚƉƌŽĨĞƐƐŝŽŶĂůƐ ŽŶƐƉĞĐŝĨŝĐŐƌŽƵƉƐŽĨĂƉƉůŝĐĂƚŝŽŶƐƐŽƚŚĞLJĐĂŶŽĨĨĞƌŵŽƌĞƐƉĞĐŝĂůŝnjĞĚƐĞƌǀŝĐĞƐ͘ KƵƌĐŽŵŵŝƚŵĞŶƚĂƚdLJůĞƌŝƐƚŽĞŶƐƵƌĞƚŚĞŚŝŐŚĞƐƚůĞǀĞůŽĨĐůŝĞŶƚƐĂƚŝƐĨĂĐƚŝŽŶƚŚƌŽƵŐŚƚŚĞĞĨĨŽƌƚƐŽĨdLJůĞƌ͛Ɛ ŵŽƐƚǀĂůƵĞĚƌĞƐŽƵƌĐĞ͗ŝƚƐƉĞŽƉůĞ͘tĞĐŚĂůůĞŶŐĞŽƵƌĞŵƉůŽLJĞĞƐƚŽƉƵƌƐƵĞŶĞǁŝŶŝƚŝĂƚŝǀĞƐĂŐŐƌĞƐƐŝǀĞůLJĂŶĚ ďĞĐŽŵĞŝŶĚƵƐƚƌLJůĞĂĚĞƌƐŝŶƚŚĞŝƌƌĞƐƉĞĐƚŝǀĞĨŝĞůĚƐ͘dLJůĞƌĞŵƉůŽLJƐϱ͕ϱϬϬнŝŶĚŝǀŝĚƵĂůƐ͕ŵĂŶLJŽĨǁŚŽŵĂƌĞ ƐĞĂƐŽŶĞĚƉƌŽĨĞƐƐŝŽŶĂůƐǁŝƚŚƵŶŝƋƵĞĂŶĚƉƌŽƉƌŝĞƚĂƌLJƐŬŝůůƐĂŶĚLJĞĂƌƐŽĨŝŶĚƵƐƚƌLJĞdžƉĞƌŝĞŶĐĞ͘/ŶĨĂĐƚ͕ŽƵƌ ĞŵƉůŽLJĞĞƚƵƌŶŽǀĞƌƌĂƚĞŝƐǀĞƌLJůŽǁʹŝŶƌĞĐĞŶƚLJĞĂƌƐ͕ĂďŽƵƚŚĂůĨŽĨƚŚĞŝŶĚƵƐƚƌLJĂǀĞƌĂŐĞ͘ ŽŵƉĂŶLJZĞĐŽŐŶŝƚŝŽŶ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŚĂƐĞĂƌŶĞĚƚŚĞƌĞƉƵƚĂƚŝŽŶĂƐĂŶŝŶĚƵƐƚƌLJůĞĂĚĞƌďĂƐĞĚŽŶŽƵƌƉƌŽĚƵĐƚƐĂŶĚĐŽŵŵŝƚŵĞŶƚ ƚŽŽƵƌĐůŝĞŶƚƐ͘dŚĞƐĞĨĂĐƚŽƌƐ͕ĂůŽŶŐǁŝƚŚŽƵƌĨŝŶĂŶĐŝĂůƐƚƌĞŶŐƚŚĂŶĚŝŶĚƵƐƚƌLJƉĂƌƚŶĞƌƐŚŝƉƐ͕ŚĂǀĞƌĞƐƵůƚĞĚŝŶ ŶƵŵĞƌŽƵƐĂĐĐŽůĂĚĞƐ͘ΗdŚĞƌĞĐŽŐŶŝƚŝŽŶĞŵƉŚĂƐŝnjĞƐdLJůĞƌΖƐĐŽŶƐŝƐƚĞŶƚůLJƐƚƌŽŶŐŐƌŽǁƚŚ͕ǁŚŝĐŚŝƐĂĚŝƌĞĐƚƌĞƐƵůƚ ŽĨŽƵƌĐŽŵŵŝƚŵĞŶƚƚŽƐƵƉƉŽƌƚŝŶŐŽƵƌŵŽƌĞƚŚĂŶϮϳ͕ϬϬϬĐůŝĞŶƚƐĂŶĚƚŚĞĚĞǀĞůŽƉŵĞŶƚŽĨďĞƐƚͲŝŶͲĐůĂƐƐ ƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐƚŽƐĞƌǀĞƚŚĞŶĞĞĚƐŽĨƚŚĞƉƵďůŝĐƐĞĐƚŽƌΗƐĂŝĚ:ŽŚŶ^͘DĂƌƌ:ƌ͕͘ŚĂŝƌŵĂŶŽĨƚŚĞŽĂƌĚŽĨ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͘ dLJůĞƌŚĂƐďĞĞŶŶĂŵĞĚƚŽƚŚĞĨŽůůŽǁŝŶŐƉƌĞƐƚŝŐŝŽƵƐůŝƐƚƐĂůŽŶŐƐŝĚĞƐŽŵĞŽĨƚŚĞŵŽƐƚŝŶŶŽǀĂƚŝǀĞĂŶĚŝŶĨůƵĞŶƚŝĂů ĐŽŵƉĂŶŝĞƐŝŶƚŚĞhŶŝƚĞĚ^ƚĂƚĞƐ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϭ /ŶŶŽǀĂƚŝǀĞĂŶĚ^ƚƌŽŶŐ xĂůůĂƐƵƐŝŶĞƐƐ:ŽƵƌŶĂůƌĂŶŬĞĚdLJůĞƌ͛ƐWůĂŶŽŽĨĨŝĐĞηϴŝŶŝƚƐ͞EŽƌƚŚdĞdžĂƐ&ĂƐƚĞƐƚͲ'ƌŽǁŝŶŐWƵďůŝĐ ŽŵƉĂŶŝĞƐ͟ůŝƐƚ;ϮϬϭϳͿ x&ŽƌďĞƐ͛͞DŽƐƚ/ŶŶŽǀĂƚŝǀĞ'ƌŽǁƚŚŽŵƉĂŶŝĞƐ͟ůŝƐƚ;ϮϬϭϲ͕ϮϬϭϳͿ x&ŽƌďĞƐ͛͞ŵĞƌŝĐĂ͛ƐĞƐƚ^ŵĂůůŽŵƉĂŶŝĞƐ͟ůŝƐƚ;ŶŝŶĞƚŝŵĞƐͿ xĂƌƌŽŶ͛ƐϰϬϬ/ŶĚĞdžƌĂŶŬŝŶŐ͕ĂŵĞĂƐƵƌĞŽĨƚŚĞŵŽƐƚƉƌŽŵŝƐŝŶŐĐŽŵƉĂŶŝĞƐŝŶŵĞƌŝĐĂ;ƐŝdžƚŝŵĞƐͿ x^ŽĨƚǁĂƌĞDĂŐĂnjŝŶĞ͛Ɛ͞^ŽĨƚǁĂƌĞϱϬϬ͟ƌĂŶŬŝŶŐŽĨƚŚĞǁŽƌůĚ͛ƐůĂƌŐĞƐƚƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐƵƉƉůŝĞƌƐ ;ƐĞǀĞŶƚŝŵĞƐͿ xƵĚŝƚ/ŶƚĞŐƌŝƚLJ͛Ɛ͞ŵĞƌŝĐĂ͛ƐDŽƐƚdƌƵƐƚǁŽƌƚŚLJŽŵƉĂŶŝĞƐ͟ůŝƐƚ;ϮϬϬϳͿ ŵƉůŽLJĞƌŽĨŚŽŝĐĞ x&ŽƌďĞƐ͛͞ĞƐƚŵƉůŽLJĞƌƐĨŽƌŝǀĞƌƐŝƚLJ͟;ϮϬϭϵͿ x&ŽƌďĞƐ͛͞ĞƐƚŵƉůŽLJĞƌƐĨŽƌtŽŵĞŶ͟ůŝƐƚ;ϮϬϭϴͿ x&ŽƌďĞƐ͛͞ĞƐƚDŝĚƐŝnjĞŵƉůŽLJĞƌƐ͟ůŝƐƚ;ϮϬϭϴͿ xdLJůĞƌ͛ƐƚŚƌĞĞDĂŝŶĞŽĨĨŝĐĞƐƌĞĐŽŐŶŝnjĞĚĂƐ͞ĞƐƚWůĂĐĞƐƚŽtŽƌŬŝŶDĂŝŶĞ͟;ŶŝŶĞƚŝŵĞƐƐŝŶĐĞϮϬϬϳͿ xĂůůĂƐDŽƌŶŝŶŐEĞǁƐ͛͞ĞƐƚŝŶ&t͗dŽƉtŽƌŬƉůĂĐĞƐ͟ƌĞĐŽŐŶŝnjĞĚdLJůĞƌ͛ƐWůĂŶŽ͕dĞdžĂƐ͕ŽĨĨŝĐĞ;ĨŝǀĞ ƚŝŵĞƐͿ xĂLJƚŽŶĂŝůLJEĞǁƐ͛͞dŽƉtŽƌŬƉůĂĐĞƐŝŶƚŚĞĂLJƚŽŶDĞƚƌŽƌĞĂ͟ƌĞĐŽŐŶŝnjĞĚdLJůĞƌ͛ƐDŽƌĂŝŶĞ͕KŚŝŽ͕ ŽĨĨŝĐĞ xdLJůĞƌ͛Ɛ>ƵďďŽĐŬ͕dĞdžĂƐ͕ŽĨĨŝĐĞŶĂŵĞĚƚŽƚŚĞ͞ĞƐƚŽĨ>ƵďďŽĐŬ͟ůŝƐƚďLJƚŚĞ>ƵďďŽĐŬǀĂůĂŶĐŚĞͲ:ŽƵƌŶĂů ;ϮϬϭϲĂŶĚϮϬϭϳͿ xĞƚƌŽŝƚ&ƌĞĞWƌĞƐƐŶĂŵĞĚdLJůĞƌ͛ƐdƌŽLJ͕DŝĐŚŝŐĂŶ͕ŽĨĨŝĐĞĂƚŽƉǁŽƌŬƉůĂĐĞ;ϮϬϭϳͿ xWŚŽĞŶŝdžƵƐŝŶĞƐƐ:ŽƵƌŶĂůŶĂŵĞĚdLJůĞƌ͛ƐdĞŵƉĞ͕ƌŝnjŽŶĂ͕ŽĨĨŝĐĞŽŶĞƐƚWůĂĐĞƐƚŽtŽƌŬůŝƐƚ;ϮϬϭϳͿ ĞĚŝĐĂƚĞĚtŽƌŬĨŽƌĐĞ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŚĂƐŵŽƌĞƚŚĂŶϱ͕ϱϬϬнĞŵƉůŽLJĞĞƐǁŝƚŚ ŵŽƌĞƚŚĂŶϵϬϬŽĨƚŚŽƐĞƐŽůĞůLJĚĞǀŽƚĞĚƚŽƚŚĞƉƌŽƉŽƐĞĚ ƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐ͘ŵƉůŽLJĞĞƐǁŝƚŚŝŶƚŚĞdLJůĞƌĨĂŵŝůLJ ƐŚĂƌĞĂĐŽŵŵŽŶĞŶƚŚƵƐŝĂƐŵĨŽƌƐĞƌǀŝŶŐŽƌŐĂŶŝnjĂƚŝŽŶƐŝŶƚŚĞ ƉƵďůŝĐƐĞĐƚŽƌ͘ dLJůĞƌ͛ƐƚƌĂŝŶŝŶŐĂŶĚƐƵƉƉŽƌƚƐƚĂĨĨĨŽƌŽƵƌƉƌŽƉŽƐĞĚƉƌŽĚƵĐƚƐ ĂŶĚƐĞƌǀŝĐĞƐŝŶĐůƵĚĞƐĞdžƉĞƌŝĞŶĐĞĚĚĞǀĞůŽƉĞƌƐ͕ŝŶƐƚĂůůĞƌƐ͕ ĐŽŶƐƵůƚĂŶƚƐ͕ŝŶĚƵƐƚƌLJƉƌŽĨĞƐƐŝŽŶĂůƐ͕ĂŶĚĐĞƌƚŝĨŝĞĚŶĞƚǁŽƌŬ ƚĞĐŚŶŝĐŝĂŶƐ͘dŚĞŝƌĐŽŵŵŝƚŵĞŶƚƚŽĞdžĐĞůůĞŶĐĞ͕ƋƵĂůŝƚLJ ƚƌĂŝŶŝŶŐ͕ĂŶĚƐƵƉƉŽƌƚŝƐƐĞĐŽŶĚͲƚŽͲŶŽŶĞ͘ KƵƌdžƉĞƌŝĞŶĐĞ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͛ƐŽůƵƚŝŽŶƐŽĨĨĞƌƚŚĞǁŝĚĞƐƚďƌĞĂĚƚŚŽĨ ƉƌŽĚƵĐƚƐŝŶƚŚĞŝŶĚƵƐƚƌLJ͕ƚŚĞůĂƚĞƐƚƚĞĐŚŶŽůŽŐLJĂǀĂŝůĂďůĞ͕ĂŶĚĂŶŝŶƚĞŐƌĂƚĞĚƐLJƐƚĞŵƚŚĂƚĐĂŶŽƉĞƌĂƚĞŝŶĚŝǀĞƌƐĞ ŽĨĨŝĐĞƐƚŚƌŽƵŐŚŽƵƚĂũƵƌŝƐĚŝĐƚŝŽŶ͘DŽƌĞŝŵƉŽƌƚĂŶƚůLJ͕dLJůĞƌ͛ƐǀŝƐŝŽŶĂŶĚƐŬŝůůŝŶĞdžĞĐƵƚŝŶŐƚŚĂƚǀŝƐŝŽŶŝƐǁŚĂƚ ƵůƚŝŵĂƚĞůLJůĞĂĚƐƚŽĂƐƵĐĐĞƐƐĨƵůŝŵƉůĞŵĞŶƚĂƚŝŽŶĂŶĚůŽŶŐͲƚĞƌŵƐŽůƵƚŝŽŶĨŽƌŽƵƌĐůŝĞŶƚƐ͘KƵƌĞdžƉĞƌŝĞŶĐĞĚƚĞĂŵ ĐŽŶƐŝƐƚƐŽĨŝŶĚƵƐƚƌLJůĞĂĚĞƌƐƚŚĂƚŬĞĞƉŽƵƌƚĞĂŵŵŽǀŝŶŐĂŶĚŵĂŬŝŶŐƐƵƌĞǁĞĐĂŶŐŝǀĞLJŽƵƚŚĞƚŽŽůƐƚŽƐƵĐĐĞĞĚ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϮ ZĞĨĞƌĞŶĐĞƐ ƚƚĂĐŚŵĞŶƚϲ;ZĞĨĞƌĞŶĐĞ&ŽƌŵͿ 3OHDVHSURYLGHDWOHDVWILYHUHIHUHQFHVIRUSDVWSURMHFWVWKDWLQFOXGHSURGXFWVDQGVHUYLFHVVLPLODUWR WKRVHSURSRVHGIRUWKLV5)33OHDVHXVHWKHIROORZLQJIRUPDWLQVXEPLWWLQJUHIHUHQFHV 'EZ><'ZKhE 'EZ><'ZKhE 1DPHRI&OLHQW&LW\RI&RWWDJH*URYH01 3URMHFW0DQDJHU&RQWDFW5RELQ5RODQG 7LWOH)LQDQFH'LUHFWRU 3KRQH(PDLOUURODQG#FRWWDJHJURYHPQJRY 6RIWZDUH3URJUDP9HUVLRQ,QFRGH9 6XPPDU\RI3URMHFW,QFRGH)LQDQFLDOV3HUVRQQHO0DQDJHPHQW&RPPXQLW\'HYHORSPHQW6ROXWLRQV 3XUFKDVHG 1XPEHURI(PSOR\HHV 6L]HRI2SHUDWLQJ%XGJHW WZK:d^KW 3OHDVHLQGLFDWHE\FKHFNLQJER[IXQFWLRQDOLW\LQVWDOOHG <(6)LQDQFLDOV <(6 %XGJHWLQJ <(6+5 <(63D\UROO d,EK>K'z/E&KZDd/KE +RVWHG"<HV1R2Q3UHP,I\HVKRVWLQJSURYLGHU ,03/(0(17$7,21,1)250$7,21 3URMHFW'XUDWLRQ\HDU ,QLWLDO*R/LYH 'HVFULEH5ROHRQ3URMHFW1$ 3URMHFW&KDOOHQJHV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS 0DMRU$FFRPSOLVKPHQWV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϯ 'EZ><'ZKhE 1DPHRI&OLHQW&LW\RI)ULGOH\01 3URMHFW0DQDJHU&RQWDFW6DQGL+DUD 7LWOH8WLOLW\%LOOLQJ&OHUN 3KRQH(PDLOVDQGUDKDUD#IULGOH\PQJRY 6RIWZDUH3URJUDP9HUVLRQ,QFRGH9 6XPPDU\RI3URMHFW,QFRGH)LQDQFLDOV3HUVRQQHO0DQDJHPHQW8WLOLW\%LOOLQJ 1XPEHURI(PSOR\HHV 6L]HRI2SHUDWLQJ%XGJHW WZK:d^KW 3OHDVHLQGLFDWHE\FKHFNLQJER[IXQFWLRQDOLW\LQVWDOOHG <(6)LQDQFLDOV <(6 %XGJHWLQJ <(6+5 <(63D\UROO d,EK>K'z/E&KZDd/KE +RVWHG"<HV1R2Q3UHPLVH,I\HVKRVWLQJSURYLGHU ,03/(0(17$7,21,1)250$7,21 3URMHFW'XUDWLRQ\HDU ,QLWLDO*R/LYH 'HVFULEH5ROHRQ3URMHFW1$ 3URMHFW&KDOOHQJHV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS 0DMRU$FFRPSOLVKPHQWV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϰ 'EZ><'ZKhE 1DPHRI&OLHQW&LW\RI&KDPSOLQ01 3URMHFW0DQDJHU&RQWDFW6KHOOH\3HWHUVRQ 7LWOH)LQDQFH'LUHFWRU 3KRQH(PDLO6SHWHUVRQ#FLFKDPSOLQPQXV 6RIWZDUH3URJUDP9HUVLRQ,QFRGH9 6XPPDU\RI3URMHFW,QFRGH 1XPEHURI(PSOR\HHV 6L]HRI2SHUDWLQJ%XGJHW WZK:d^KW 3OHDVHLQGLFDWHE\FKHFNLQJER[IXQFWLRQDOLW\LQVWDOOHG <(6)LQDQFLDOV <(6 %XGJHWLQJ <(6+5 <(63D\UROO d,EK>K'z/E&KZDd/KE +RVWHG"<HV1R2Q3UHPLVH,I\HVKRVWLQJSURYLGHU ,03/(0(17$7,21,1)250$7,21 3URMHFW'XUDWLRQ\HDU ,QLWLDO*R/LYH 'HVFULEH5ROHRQ3URMHFW,QLWLDO6DOHVUROHRQWKH3URMHFW:RUNHGZLWK6KHOO\GXULQJ6DOHVSURFHVVDQG ,PSOHPHQWDWLRQ 3URMHFW&KDOOHQJHV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS 0DMRU$FFRPSOLVKPHQWV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϱ 'EZ><'ZKhE 1DPHRI&OLHQW&LW\RI/H6XHXU01 3URMHFW0DQDJHU&RQWDFW=DFKDU\'RXG 7LWOH )LQDQFH'LUHFWRU 3KRQH(PDLOnjĚŽƵĚΛĐŝƚLJŽĨůĞƐƵĞƵƌ͘ĐŽŵ 6RIWZDUH3URJUDP9HUVLRQ,QFRGH9 6XPPDU\RI3URMHFW,QFRGH)LQDQFLDOV3HUVRQQHO0DQDJHPHQW8WLOLW\%LOOLQJ 1XPEHURI(PSOR\HHV 6L]HRI2SHUDWLQJ%XGJHW WZK:d^KW 3OHDVHLQGLFDWHE\FKHFNLQJER[IXQFWLRQDOLW\LQVWDOOHG <(6)LQDQFLDOV <(6 %XGJHWLQJ <(6+5 <(63D\UROO d,EK>K'z/E&KZDd/KE +RVWHG"<HV1R2Q3UHPLVH,I\HVKRVWLQJSURYLGHU ,03/(0(17$7,21,1)250$7,21 3URMHFW'XUDWLRQ\HDU ,QLWLDO*R/LYH 'HVFULEH5ROHRQ3URMHFW1$ 3URMHFW&KDOOHQJHV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS 0DMRU$FFRPSOLVKPHQWV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϲ 'EZ><'ZKhE 1DPHRI&OLHQW&LW\RI1RUWK0DQNDWR01 3URMHFW0DQDJHU&RQWDFW.HYLQ0F&DQQ7LWOH )LQDQFH'LUHFWRU 3KRQH;ϱϬϳͿ ϲϮϱͲϰϭϰϭϬ(PDLOŬŵĐĐĂŶŶΛŶŽƌƚŚŵĂŶŬĂƚŽ͘ĐŽŵ 6RIWZDUH3URJUDP9HUVLRQ,QFRGH9 6XPPDU\RI3URMHFW,QFRGH)LQDQFLDOV3HUVRQQHO0DQDJHPHQW8WLOLW\%LOOLQJ&RPPXQLW\ 'HYHORSPHQW 1XPEHURI(PSOR\HHV 6L]HRI2SHUDWLQJ%XGJHW WZK:d^KW 3OHDVHLQGLFDWHE\FKHFNLQJER[IXQFWLRQDOLW\LQVWDOOHG <(6)LQDQFLDOV <(6 %XGJHWLQJ <(6+5 <(63D\UROO d,EK>K'z/E&KZDd/KE +RVWHG"<HV1R2Q3UHPLVH,I\HVKRVWLQJSURYLGHU ,03/(0(17$7,21,1)250$7,21 3URMHFW'XUDWLRQ\HDU ,QLWLDO*R/LYH 'HVFULEH5ROHRQ3URMHFW1$ 3URMHFW&KDOOHQJHV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS 0DMRU$FFRPSOLVKPHQWV6XFFHVVIXOLPSOHPHQWDWLRQDQGSDUWQHUVKLS ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳ ^ŽĨƚǁĂƌĞĞƐĐƌŝƉƚŝŽŶƐ /LVWDQGGHVFULEHDOOSURSRVHGVRIWZDUHSURGXFWVWKDWZLOOEHGHOLYHUHGDVSDUWRIWKHSURMHFWDQGLIWKH *RYHUQPHQWZLOOQHHGWRPDLQWDLQKRVWWKHVRIWZDUHRQLWVVHUYHUV,IVRIWZDUHLVVROGE\ PRGXOHSURSRVHU PXVWH[SOLFLWO\VWDWHWKHVRIWZDUHPRGXOHQDPHDQGYHUVLRQVWKDWDUHSURSRVHG ŀ$OOIXQFWLRQDOUHTXLUHPHQWVWKDWDUHUHVSRQGHGWRZLWKDSRVLWLYHUHVSRQVHDQ\WKLQJ H[FHSW³1´DUH FRQVLGHUHGWREHLQVFRSH 3URSRVHGVRIWZDUHDQGDQ\QHFHVVDU\VHUYLFHV UHTXLUHGWRPHHWWKH UHTXLUHPHQWVRIWKH5)3RULPSOHPHQWWKHSURSRVHGVRIWZDUHVKRXOG EHLQFOXGHGLQWKHSURSRVDO ^ŽĨƚǁĂƌĞdĞĐŚŶŽůŽŐLJ ĚŚĞƌŝŶŐƚŽĂƉŚŝůŽƐŽƉŚLJŽĨ͞ƉƌŽŐƌĞƐƐǁŝƚŚŽƵƚďƌĞĂŬĂŐĞ͟ŵĞĂŶƐǁĞĂƌĞĐŽŶƚŝŶƵĂůůLJĞǀŽůǀŝŶŐďŽƚŚƚŚĞ ƚĞĐŚŶŽůŽŐLJĂŶĚƚŚĞĨƵŶĐƚŝŽŶĂůŝƚLJŽĨŽƵƌƉƌŽĚƵĐƚǁŚŝůĞƐƵĐĐĞƐƐĨƵůůLJƚƌĂŶƐŝƚŝŽŶŝŶŐŽƵƌĐƵƐƚŽŵĞƌƐƚŚƌŽƵŐŚĞĂĐŚ ƐƵďƐĞƋƵĞŶƚŐĞŶĞƌĂƚŝŽŶŽĨƐŽĨƚǁĂƌĞ͘dŚŝƐƐƚƌĂƚĞŐLJŚĂƐĐŽŶƚƌŝďƵƚĞĚƐŝŐŶŝĨŝĐĂŶƚůLJƚŽƚŚĞϵϵйĐƵƐƚŽŵĞƌƌĞƚĞŶƚŝŽŶ ƌĂƚĞǁŝƚŚŝŶƚŚĞ/ŶĐŽĚĞĐƵƐƚŽŵĞƌďĂƐĞ͘ dŚĞƉƌŽƉŽƐĞĚ/ŶĐŽĚĞƐŽůƵƚŝŽŶŝƐĐŽŵƉƌŝƐĞĚŽĨŝŵƉŽƌƚĂŶƚůĂLJĞƌƐ͘ xdŚĞĚĂƚĂďĂƐĞůĂLJĞƌ͕ǁŚŝĐŚƵƚŝůŝnjĞƐDŝĐƌŽƐŽĨƚ^Y> xdŚĞďƵƐŝŶĞƐƐůŽŐŝĐůĂLJĞƌ͕ǁŚŝĐŚƵƐĞƐĐƚŝǀĞy͕sŝƐƵĂůĂƐŝĐ͕ĞůƉŚŝ͕ĂŶĚŽƚŚĞƌƐ xdŚĞĐůŝĞŶƚŝŶƚĞƌĨĂĐĞůĂLJĞƌĐŽŵƉƌŝƐĞĚŽĨŽďũĞĐƚƐǁƌŝƚƚĞŶŝŶĞůƉŚŝĂŶĚн x/ŶĐŽĚĞ͛ƐůĂƚĞƐƚŐĞŶĞƌĂƚŝŽŶŽĨƐŽĨƚǁĂƌĞŽĨĨĞƌƐDŝĐƌŽƐŽĨƚ͘EdƚĞĐŚŶŽůŽŐLJ dĂŬŝŶŐĂĚǀĂŶƚĂŐĞŽĨƚŚĞƚŽŽůƐŽĨĨĞƌĞĚƚŚƌŽƵŐŚƚŚŝƐƌĞǀŽůƵƚŝŽŶĂƌLJƉƌŽĚƵĐƚĂůŽŶŐǁŝƚŚDŝĐƌŽƐŽĨƚ^ŚĂƌĞWŽŝŶƚ͕ ĐƵƐƚŽŵĞƌƐĐĂŶĚĞĨŝŶĞƌŽůĞͲƐƉĞĐŝĨŝĐƐĞĐƵƌŝƚLJ͕ĐƌĞĂƚĞƵƐĞƌͲƐƉĞĐŝĨŝĐĐŽŶƐŽůĞƐ͕ĂŶĚƐĞƚƵƉƵƐĞƌͲĚĞĨŝŶĞĚĂŶĚƵƐĞƌͲ ƐƉĞĐŝĨŝĐƉƌŽĐĞƐƐĞƐ͘YƵĞƌLJͲďLJͲĞdžĂŵƉůĞƐĞĂƌĐŚĞƐĂŶĚƌĞĐĞŶƚĂĐƚŝǀŝƚLJƚƌĂĐŬŝŶŐĂůůŽǁƵƐĞƌƐƚŽŽƌŐĂŶŝnjĞĂŶĚ ĂĐĐĞƐƐĚĂƚĂŵŽƌĞĞĨĨŝĐŝĞŶƚůLJ͘dŚĞƐĞƚŽŽůƐ͕ĂůŽŶŐǁŝƚŚŵĞƐƐĂŐŝŶŐŽƉƚŝŽŶƐĂŶĚĞdžƉĂŶƐŝǀĞƌĞƉŽƌƚŝŶŐĐĂƉĂďŝůŝƚLJ͕ ŐŝǀĞĐƵƐƚŽŵĞƌƐǁŚĂƚƚŚĞLJŶĞĞĚƚŽƐƚƌĞĂŵůŝŶĞƚŚĞŝƌŽƉĞƌĂƚŝŽŶƐ͘ ĂƚĂďĂƐĞ DŝĐƌŽƐŽĨƚ^Y>ŝƐƚŚĞƵŶĚĞƌůLJŝŶŐĚĂƚĂďĂƐĞĨŽƌdLJůĞƌ͛ƐĂƉƉůŝĐĂƚŝŽŶƐ͕ŽĨĨĞƌŝŶŐĂŶZD^ĞŶǀŝƌŽŶŵĞŶƚǁŝƚŚĞĂƐLJ ĂĐĐĞƐƐƚŽƚŚĞĚĂƚĂĨŽƌĞdžƉŽƌƚŝŶŐ͕ƋƵĞƌLJŝŶŐĂŶĚƌĞƉŽƌƚŝŶŐƉƵƌƉŽƐĞƐ͘dŚŝƐĚĂƚĂďĂƐĞƐŽůƵƚŝŽŶĂůƐŽƐƵƉƉŽƌƚƐĂŶ D^^Y>ĂƚĂtĂƌĞŚŽƵƐĞŽƉƚŝŽŶĨŽƌĚĂƚĂŵŝŶŝŶŐ͕ƌĞƉŽƌƚŝŶŐĂŶĚĂŶĂůLJƐŝƐĐĂƉĂďŝůŝƚŝĞƐŝŶĂƵƐĞƌͲĨƌŝĞŶĚůLJ ĞŶǀŝƌŽŶŵĞŶƚǁŝƚŚŽƵƚŝŵƉĂĐƚŝŶŐƉĞƌĨŽƌŵĂŶĐĞ͘ DŽĚƵůĂƌ/ŶƚĞŐƌĂƚŝŽŶ dŚĞ/ŶĐŽĚĞƐŽůƵƚŝŽŶƌĞƉƌĞƐĞŶƚƐĂŶĞdžƚĞŶƐŝǀĞĐŽůůĞĐƚŝŽŶŽĨŝŶƚĞŐƌĂƚĞĚĂƉƉůŝĐĂƚŝŽŶƐƚŚĂƚĂƌĞĐĂƚĞŐŽƌŝnjĞĚŝŶƚŽ ƐƵŝƚĞƐĨŽƌ&ŝŶĂŶĐŝĂůDĂŶĂŐĞŵĞŶƚ͕WĞƌƐŽŶŶĞůDĂŶĂŐĞŵĞŶƚ͕ŝƚŝnjĞŶ^ĞƌǀŝĐĞƐ͕ŽƵƌƚĂƐĞDĂŶĂŐĞŵĞŶƚ͕WƵďůŝĐ ^ĂĨĞƚLJDĂŶĂŐĞŵĞŶƚ͕DŽďŝůĞƉƉůŝĐĂƚŝŽŶƐ͕ĂŶĚKŶůŝŶĞ^ŽůƵƚŝŽŶƐ͘ /ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐĂƌĞŽƌŐĂŶŝnjĞĚŝŶĂŵŽĚƵůĂƌĚĞƐŝŐŶĂŶĚƵƚŝůŝnjĞĂƐŝŶŐůĞĚĂƚĂďĂƐĞĨŽƌĂůůĂƉƉůŝĐĂƚŝŽŶƐǁŝƚŚ ƵŶůŝŵŝƚĞĚĐŽŶĐƵƌƌĞŶƚƵƐĞƌƐ͘dŚĞƚǁŽͲĨŽůĚďĞŶĞĨŝƚŽĨƚŚŝƐŵŽĚƵůĂƌĂƉƉƌŽĂĐŚĂůůŽǁƐĐƵƐƚŽŵĞƌƐƚŽƉƵƌĐŚĂƐĞĂŶĚ ŝŵƉůĞŵĞŶƚƐƉĞĐŝĨŝĐĂƉƉůŝĐĂƚŝŽŶƐĂƐŶĞĞĚƐĂƌŝƐĞĂŶĚďƵĚŐĞƚƐĂůůŽǁǁŚŝůĞƐƚŝůůŽĨĨĞƌŝŶŐƚŚĞŝŶƚĞŐƌĂƚŝŽŶŶĞĐĞƐƐĂƌLJ ƚŽŵĂŝŶƚĂŝŶĂƉƌŽĚƵĐƚŝǀĞĂŶĚĐŽƐƚͲĞĨĨĞĐƚŝǀĞĞŶǀŝƌŽŶŵĞŶƚĂƐŶĞǁŵŽĚƵůĞƐĂƌĞĂĚĚĞĚ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴ tŽƌŬĨůŽǁĂƉĂďŝůŝƚŝĞƐ /ŶĐŽĚĞƐŽĨƚǁĂƌĞƉƌŽǀŝĚĞƐƚŚĞƚŽŽůƐƚŽĂůůŽǁƵƐĞƌƐƚŽĂĐŚŝĞǀĞŽƉƚŝŵĂůŽƉĞƌĂƚŝŽŶĂůĞĨĨŝĐŝĞŶĐLJĂŶĚŽƌŐĂŶŝnjĂƚŝŽŶĂů ĞĨĨĞĐƚŝǀĞŶĞƐƐ͘tŝƚŚƚŚĂƚŝŶŵŝŶĚ͕Ăůů/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐŝŶƚŚŝƐƉƌŽƉŽƐĂůŽĨĨĞƌĐůŽƐĞŝŶƚĞŐƌĂƚŝŽŶĂŶĚĂǀĂƌŝĞƚLJ ŽĨƐĞĐƵƌŝƚLJŽƉƚŝŽŶƐ͘ /ŶĐŽĚĞƐŽĨƚǁĂƌĞŽĨĨĞƌƐĞůĞĐƚƌŽŶŝĐǁŽƌŬĨůŽǁƚŚƌŽƵŐŚŽƵƚƚŚĞƐLJƐƚĞŵ͘/ŶĚŝǀŝĚƵĂůƐƚĞƉƐǁŝƚŚŝŶĂƉĂĐŬĞƚĂůƐŽĂůůŽǁ ĨŽƌƐLJƐƚĞŵĂƚŝĐƌĞǀŝĞǁĂŶĚĂƉƉƌŽǀĂůĂƐǁĞůůĂƐƐƵƐƉĞŶƐŝŽŶŽĨƚƌĂŶƐĂĐƚŝŽŶƐ͘ŶĂƵĚŝƚĨŽŽƚƉƌŝŶƚŝƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚ ĞĂĐŚƉƌŽĐĞƐƐŝŶŐƐƚĞƉ;ŝŶƉƵƚ͕ůĂƐƚĞĚŝƚ͕ĂƉƉƌŽǀĞ͕ƵƉĚĂƚĞ͕ĞƚĐ͘Ϳ͕ǁŚŝĐŚŝŶĐůƵĚĞƐƵƐĞƌŝĚĞŶƚŝĨŝĐĂƚŝŽŶ͕ĚĂƚĞ͕ĂŶĚ ƚŝŵĞ͘ hƐĞƌ/ŶƚĞƌĨĂĐĞ dLJůĞƌ͛Ɛ/ŶĐŽĚĞƐŽĨƚǁĂƌĞŽĨĨĞƌƐĂƚƌƵĞǁŝŶĚŽǁƐƐŽůƵƚŝŽŶƚĂŬŝŶŐĂĚǀĂŶƚĂŐĞŽĨƚŚĞůĂƚĞƐƚƚŽŽůƐƚĞĐŚŶŽůŽŐLJŚĂƐƚŽ ŽĨĨĞƌ͘'ůŽďĂůŽƉƚŝŽŶƐŝŶĐůƵĚĞĐŽŵŵƵŶŝĐĂƚŝŽŶĂůĞƌƚƐ͕ƉƌŽĐĞƐƐĞƐ͕ĂŶĚƌĞƉŽƌƚƐĂĐƌŽƐƐŵƵůƚŝƉůĞĂƉƉůŝĐĂƚŝŽŶƐ͘ džƚĞŶƐŝǀĞĨŝůƚĞƌĂŶĚƋƵĞƌLJĐĂƉĂďŝůŝƚŝĞƐĂƌĞĂǀĂŝůĂďůĞƚŚƌŽƵŐŚŽƵƚƚŚĞƐŽĨƚǁĂƌĞĂůůŽǁŝŶŐƵƐĞƌƐƚŽƌĞƚƌŝĞǀĞƌĞĐŽƌĚƐ ĂŶĚƚƌĂŶƐĂĐƚŝŽŶƐďĂƐĞĚŽŶƉĂƌƚŝĂůĞŶƚƌLJĂŶĚǀŝĞǁĞĚƉƌŝŽƌƚŽƐĞůĞĐƚŝŽŶ͘tŝƚŚĂĐŽŶĐĞƉƚŽĨ͞ĨŝŶĚĨŝƌƐƚ͕ĞĚŝƚ ƐĞĐŽŶĚ͕͟ƌĞƚƌŝĞǀĞĚƌĞĐŽƌĚƐŵĂLJďĞĞĚŝƚĞĚĐŽŶƚŝŶŐĞŶƚƵƉŽŶƵƐĞƌƐĞĐƵƌŝƚLJ͘LJŶĂŵŝĐŐƌŝĚĐŽŶƚƌŽůƐŐŝǀĞƵƐĞƌƐ ŐƌĞĂƚĞƌĨůĞdžŝďŝůŝƚLJŝŶƐŽƌƚŝŶŐ͕ǀŝĞǁŝŶŐĂŶĚŐƌŽƵƉŝŶŐŝŶĨŽƌŵĂƚŝŽŶ͘hƐĞƌͲĚĞĨŝŶĞĚĐŽŶĨŝŐƵƌĂƚŝŽŶƐĐĂŶďĞƐĂǀĞĚĂŶĚ ĂƌĞƐƉĞĐŝĨŝĐƚŽƚŚĞƵƐĞƌ͘'ƌŝĚĐŽŶƚĞŶƚƐĐĂŶĂůƐŽďĞƉƌŝŶƚĞĚĂŶĚĞdžƉŽƌƚĞĚƚŽDŝĐƌŽƐŽĨƚdžĐĞů͕,dD>ŽƌyD> ĨŽƌŵĂƚƐ͘ ĂƚĂǀĂůŝĚĂƚŝŽŶŝƐĂůƐŽĞdžƚĞŶƐŝǀĞƚŚƌŽƵŐŚŽƵƚƚŚĞ/ŶĐŽĚĞƐŽůƵƚŝŽŶĂŶĚŝŶĐůƵĚĞƐƌĞĐŽƌĚĐŚĞĐŬŝŶŐĂƐǁĞůůĂƐ ŶƵŵĞƌŝĐĂŶĚĚĞĐŝŵĂůĞŶĨŽƌĐĞŵĞŶƚ͘ĂůĞŶĚĂƌďƵƚƚŽŶƐŽĨĨĞƌĂĨƵůůLJĂƵƚŽŵĂƚĞĚǁĂLJƚŽƐĞůĞĐƚĚĂƚĞƐďLJǀŝĞǁŝŶŐ ĂŶĚƐĞůĞĐƚŝŶŐĂĚĂLJ͕ŵŽŶƚŚ͕ĂŶĚLJĞĂƌŽŶĂĐĂůĞŶĚĂƌƉĂĚ͘hƐĞƌƐĂůƐŽŚĂǀĞƚŚĞĂďŝůŝƚLJƚŽĞdžƉŽƌƚŐƌŝĚĐŽŶƚĞŶƚƐƚŽ DŝĐƌŽƐŽĨƚdžĐĞů͕,dD>ŽƌyD>ĨŽƌŵĂƚƐ͘ tŽƌŬƐƉĂĐĞƐ dŚĞ/ŶĐŽĚĞǁŽƌŬƐƉĂĐĞŝƐƚŚĞƵƐĞƌŝŶƚĞƌĨĂĐĞƚŚĂƚƌƵŶƐŝŶƚŚĞƉƌŽŐƌĂŵƐŚĞůů͘tŝƚŚŝŶƚŚĞǁŽƌŬƐƉĂĐĞ͕ĂŶ ƵŶůŝŵŝƚĞĚŶƵŵďĞƌŽĨĐƵƐƚŽŵŝnjĞĚ͕ƌŽůĞͲďĂƐĞĚǁŽƌŬƐƚĂƚŝŽŶƐĐĂŶďĞĐƌĞĂƚĞĚ͘tŽƌŬƐƚĂƚŝŽŶƐĐĂŶŝŶĐůƵĚĞĚĂƚĂ ƉƌŽĐĞƐƐŝŶŐƐĐƌĞĞŶƐ͕ĐƵƐƚŽŵǁŝĚŐĞƚƐƉĂĐĞƐ͕ƐĞĂƌĐŚƌĞƐƵůƚƐ͕ĞdžƚĞƌŶĂůǁĞďƉĂŐĞƐ͕ĂŶĚŵŽƌĞ͘ tŝĚŐĞƚƐ tŽƌŬƐƚĂƚŝŽŶƐĂƌĞĐƵƐƚŽŵŝnjĞĚďLJŝŶĐůƵĚŝŶŐƵƐĞƌͲĚĞĨŝŶĞĚǁŝĚŐĞƚƐŝŶƚŚĞƐƉĂĐĞ͘dLJƉĞƐĂŶĚĐŽŶƚĞŶƚŽĨǁŝĚŐĞƚƐ ĂƌĞŽŶůLJůŝŵŝƚĞĚďLJƚŚĞƵƐĞƌ͛ƐŝŵĂŐŝŶĂƚŝŽŶ͘tŝĚŐĞƚƐĐĂŶŝŶĐůƵĚĞĂƉƉůŝĐĂƚŝŽŶƐŚŽƌƚĐƵƚƐŽƌĨĂǀŽƌŝƚĞƐŵĞŶƵƐ͕ ĐŽŵŵŽŶůLJƐĞĂƌĐŚĞĚƚĞƌŵƐ͕ƐLJƐƚĞŵŶŽƚŝĨŝĐĂƚŝŽŶƐ͕ƉŝŶŶĞĚŽƌƐĐŚĞĚƵůĞĚƌĞƉŽƌƚƐ͕ŽƌĂŶLJƐĞƚƐŽĨĚĂƚĂǁŝƚŚŝŶƚŚĞ ĂƉƉůŝĐĂƚŝŽŶ͘tŝƚŚƵƐŝŶĞƐƐ/ŶƚĞůůŝŐĞŶĐĞ^ĞƌǀŝĐĞƐ͕ƚŚĞĐůŝĞŶƚĐĂŶƵƐĞdLJůĞƌ͛ƐƌĞƐŽƵƌĐĞƐƚŽďƵŝůĚĐƵƐƚŽŵǁŝĚŐĞƚƐ ƐƉĞĐŝĨŝĐĨŽƌƚŚĂƚĐůŝĞŶƚŽĨĨŝĐĞ͘ <ĞLJWĞƌĨŽƌŵĂŶĐĞ/ŶĚŝĐĂƚŽƌƐ;<W/Ϳ KŶĞŽĨƚŚĞƐƚƌĞŶŐƚŚƐŽĨƌŽůĞͲďĂƐĞĚǁŽƌŬƐƚĂƚŝŽŶƐŝƐƚŚĞĂďŝůŝƚLJƚŽĂĚĚĐƵƐƚŽŵŝnjĞĚ<W/ƐƌĞůĞǀĂŶƚƚŽƚŚĞƵƐĞƌ͛Ɛ ǁŽƌŬƉƌŽĐĞƐƐĞƐ͘tŚĞƚŚĞƌƚŚĂƚ͛ƐĂůŝƐƚŽĨŽƵƚƐƚĂŶĚŝŶŐŝŶǀŽŝĐĞƐƚŽƉƌŽĐĞƐƐ͕ŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚƚŚĞďƵĚŐĞƚ ƐƚĂƚƵƐ͕ŽƌŶƵŵďĞƌŽĨĞŵƉůŽLJĞĞƐŽŶWdKĂƚĂŶLJŐŝǀĞŶƚŝŵĞ͕<W/ƐĂƌĞĂŶŝŶƐƚƌƵŵĞŶƚĂůƉĂƌƚŽĨĚĞǀĞůŽƉŝŶŐĂŵŽƌĞ ĞĨĨŝĐŝĞŶƚǁŽƌŬƉƌŽĐĞƐƐ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵ ƌŝůůͲŽǁŶ&ƵŶĐƚŝŽŶĂůŝƚLJ ůůĚĂƚĂƵƐĞĚĨƌŽŵƚŚĞĂƉƉůŝĐĂƚŝŽŶƚŽĐƌĞĂƚĞǁŝĚŐĞƚƐŝŶĐůƵĚĞĨƵůůĐĂƉĂďŝůŝƚLJƚŽĚƌŝůůĚŽǁŶ ŝŶƚŽƚŚĞĚĂƚĂĂŶĚũƵŵƉƚŽĂĐƚŝǀĞƉƌŽĐĞƐƐŝŶŐƐĐƌĞĞŶƐĚŝƌĞĐƚůLJĨƌŽŵĂǁŽƌŬƐƉĂĐĞ͘ůůĚĂƚĂ ŝƐĂƵƚŽŵĂƚŝĐĂůůLJƵƉĚĂƚĞĚďĂĐŬŝŶƚŽƚŚĞǁŝĚŐĞƚĚŝƐƉůĂLJŝŶŐƚŚĞĚĂƚĂ͘ůůůŝƐƚƐƐŚŽǁŶŝŶƚŚĞ ĂƉƉůŝĐĂƚŝŽŶĂƌĞĨƵůůLJŝŶƚĞƌĂĐƚŝǀĞĂŶĚĨĞĂƚƵƌĞĂďŝůŝƚŝĞƐĨŽƌĐƵƐƚŽŵŝnjĞĚƋƵĞƌŝĞƐ͕ĐŽůƵŵŶ ŽƌĚĞƌƐ͕ŐƌŽƵƉŝŶŐƐĂŶĚŵŽƌĞ͘ tŽƌŬƐƉĂĐĞDĂŶĂŐĞŵĞŶƚ hƐĞƌǁŽƌŬƐƉĂĐĞĐƵƐƚŽŵŝnjĂƚŝŽŶŝƐĐůŝĞŶƚͲĚĞĨŝŶĞĚ͘hƐĞƌƐĐĂŶďĞƌĞƐƚƌŝĐƚĞĚƚŽƉƌĞͲĚĞĨŝŶĞĚ ƚĞŵƉůĂƚĞƐĨŽƌƚŚĞŝƌǁŽƌŬƐƉĂĐĞƐ͕ĐƌĞĂƚŝŶŐĂĐŽŶƚƌŽůůĞĚǁŽƌŬĞŶǀŝƌŽŶŵĞŶƚ͘LJĚĞĨĂƵůƚ͕ ŝŶĚŝǀŝĚƵĂůǁŽƌŬƐƚĂƚŝŽŶƐĂƌĞĚŝƐƉůĂLJĞĚĂƐƚĂďƐǁŝƚŚŝŶƚŚĞ/ŶĐŽĚĞƐŚĞůů͖ŚŽǁĞǀĞƌ͕ƚŚĞLJĐĂŶ ĂůƐŽďĞƵŶĚŽĐŬĞĚĂŶĚƵƐĞĚĂƐƐƚĂŶĚͲĂůŽŶĞƐĐƌĞĞŶƐ͕ƉĞƌĨĞĐƚĨŽƌĚƵĂůŵŽŶŝƚŽƌƐĂŶĚƉŽǁĞƌ ƵƐĞƌƐ͘ ZĞƉŽƌƚŝŶŐĂŶĚŶĂůLJƐŝƐdŽŽůƐ ĞLJŽŶĚƚŚĞĞdžƚĞŶƐŝǀĞƋƵĞƌLJĐĂƉĂďŝůŝƚŝĞƐĂǀĂŝůĂďůĞ͕/ŶĐŽĚĞƐŽĨƚǁĂƌĞĂůƐŽŝŶĐůƵĚĞƐ ƐƚĂŶĚĂƌĚƌĞƉŽƌƚŝŶŐĂŶĚĂŶĂůLJƐŝƐƚŽŽůƐĂŶĚĂŶŝŶƚĞŐƌĂƚĞĚZĞƉŽƌƚtƌŝƚĞƌĨŽƌĐƌĞĂƚŝŶŐĂĚͲ ŚŽĐƌĞƉŽƌƚƐ͘ůůƌĞƉŽƌƚƐŝŶ/ŶĐŽĚĞƐŽĨƚǁĂƌĞĐĂŶďĞƉƌĞǀŝĞǁĞĚƚŚƌŽƵŐŚĂǀŝĞǁĞƌǁŝƚŚ ƵƐĞƌͲĚĞĨŝŶĞĚĚŝƐƉůĂLJƉĂƌĂŵĞƚĞƌƐ͕ůĂLJŽƵƚƐ͕ĨŽƌŵĂƚƐ͕ĂŶĚƉƌŝŶƚĞƌŽƉƚŝŽŶƐ͘dŚĞǀŝĞǁĞƌ ƉƌŽǀŝĚĞƐƐĞĂƌĐŚĂŶĚŐŽƚŽĨƵŶĐƚŝŽŶĂůŝƚLJĂƐǁĞůůĂƐĚƌŝůůͲĚŽǁŶŽƉƚŝŽŶƐĚŝƌĞĐƚůLJƚŽƚŚĞ ƌĞůĂƚĞĚĚĂƚĂǁŝƚŚŝŶƚŚĞƐŽĨƚǁĂƌĞ͘ ZĞƉŽƌƚƐĐĂŶďĞƉƌŝŶƚĞĚĨƌŽŵƚŚĞǀŝĞǁĞƌĂƚĂŶLJƚŝŵĞŽƌĞdžƉŽƌƚĞĚƚŽĂǀĂƌŝĞƚLJŽĨĨŽƌŵĂƚƐŝŶĐůƵĚŝŶŐDŝĐƌŽƐŽĨƚ tŽƌĚĂŶĚdžĐĞů͕,dD>͕^sĂŶĚyD>ĨŽƌŵĂƚƐ͘ZĞƉŽƌƚƐĐĂŶďĞƐĐŚĞĚƵůĞĚƚŽƌƵŶĂƵƚŽŵĂƚŝĐĂůůLJĂƚƵƐĞƌͲ ƐƉĞĐŝĨŝĞĚƚŝŵĞƐŝŶĂĚĚŝƚŝŽŶƚŽĂƵƚŽŵĂƚŝĐĚĞůŝǀĞƌLJƚŽĚĞƐŝŐŶĂƚĞĚƉĞƌƐŽŶŶĞů͘dŚĞZĞƉŽƌƚtƌŝƚĞƌĂůƐŽĂůůŽǁƐ ƵƐĞƌƐƚŽŵŽĚŝĨLJĞdžŝƐƚŝŶŐƌĞƉŽƌƚƐĂƐŶĞĞĚĞĚĂŶĚĚĞƐŝŐŶŶĞǁƌĞƉŽƌƚƐŵŽƌĞƵŶŝƋƵĞƚŽƚŚĞŝƌŽƌŐĂŶŝnjĂƚŝŽŶ͘ tĞďĂƉĂďŝůŝƚŝĞƐ /ŶĐŽĚĞ͛ƐǁĞďƐŽůƵƚŝŽŶƐĂůůŽǁŽƌŐĂŶŝnjĂƚŝŽŶƐƚŽŝŶƚĞƌĂĐƚǁŝƚŚƚŚĞƉƵďůŝĐĂŶĚŽĨĨĞƌĂĐĐĞƐƐƚŽƌĞĂůͲƚŝŵĞ ŝŶĨŽƌŵĂƚŝŽŶƚŚƌŽƵŐŚǁĞďƐŝƚĞŝŶƚĞŐƌĂƚŝŽŶŽĨ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐ͘dŚĞƐĞǁĞďĂƉƉůŝĐĂƚŝŽŶƐĂƌĞƐƵƉƉŽƌƚĞĚďLJ /ŶĐŽĚĞƚŚƌŽƵŐŚ/Ŷ^ŝƚĞ͕ĂǁĞďƉŽƌƚĂůĂĐĐĞƐƐĞĚƚŚƌŽƵŐŚĂůŝŶŬŽŶĂŶĞdžŝƐƚŝŶŐǁĞďƐŝƚĞĨŽƌƚŚĞĞdžƉƌĞƐƐƉƵƌƉŽƐĞŽĨ ƐĞƌǀŝŶŐƚŚĞŽŶůŝŶĞĐŽŵƉŽŶĞŶƚƐǁŝƚŚŝŶƚŚĞƐŽĨƚǁĂƌĞ͘dLJůĞƌĂůƐŽŽĨĨĞƌƐƐĞƌǀŝĐĞƐĚĞƐŝŐŶĞĚƚŽĨĂĐŝůŝƚĂƚĞƚŚĞ ƵƉůŽĂĚŽĨƉĂLJŵĞŶƚŝŶĨŽƌŵĂƚŝŽŶƚŽƚŚĞ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐ͘ ^LJƐƚĞŵ^ĞĐƵƌŝƚLJ dLJůĞƌ͛Ɛ/ŶĐŽĚĞƐŽůƵƚŝŽŶƵƐĞƐƚŚĞdƌƵƐƚĞĚ^ĞĐƵƌŝƚLJDŽĚĞůďĂƐĞĚŽŶDŝĐƌŽƐŽĨƚtŝŶĚŽǁƐΠƉŚŝůŽƐŽƉŚLJ͘dŚŝƐ ŵĞĂŶƐŽŶĐĞĂƵƐĞƌůŽŐƐŝŶƚŽŚŝƐͰŚĞƌŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵ͕/ŶĐŽĚĞ͛ƐƐLJƐƚĞŵƐĞĐƵƌŝƚLJǁŝůůĂƵƚŽŵĂƚŝĐĂůůLJƌĞĐŽŐŶŝnjĞ ƚŚĞŝŶĚŝǀŝĚƵĂů͘ ^ĞĐƵƌŝƚLJǁŝƚŚŝŶƚŚĞƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚƐďŽƚŚŝŶĚŝǀŝĚƵĂůĂŶĚŐƌŽƵƉƉĞƌŵŝƐƐŝŽŶƐƐŝŵƵůƚĂŶĞŽƵƐůLJ͘dŚĞƐĞ ƉĞƌŵŝƐƐŝŽŶƐĐĂŶďĞĂƐƐŝŐŶĞĚƚŽŝŶĚŝǀŝĚƵĂůĂƉƉůŝĐĂƚŝŽŶƐĂŶĚƉƌŽŐƌĂŵƐǁŝƚŚŝŶĂƉƉůŝĐĂƚŝŽŶƐ͘dŚĞƐŽĨƚǁĂƌĞĂůƐŽ ƚƌĂĐŬƐǁŚŝĐŚƉƌŽŐƌĂŵƐĂƌĞĞdžĞĐƵƚĞĚĂŶĚďLJǁŚŽŵ͘dŚĞƐLJƐƚĞŵůŽŐƐŝŶĨŽƌŵĂƚŝŽŶƐƵĐŚĂƐĚĂƚĞ͕ƚŝŵĞ͕ƵƐĞƌ͕ ƉƌŽŐƌĂŵŶĂŵĞ͕ĂŶĚƐLJƐƚĞŵŵĞƐƐĂŐĞĨŽƌĞĂĐŚĞŶƚƌLJ͘KƚŚĞƌƐĞĐƵƌŝƚLJŽƉƚŝŽŶƐĂǀĂŝůĂďůĞŝŶĂŶƵŵďĞƌŽĨ/ŶĐŽĚĞ ĂƉƉůŝĐĂƚŝŽŶƐŝŶĐůƵĚĞĨƵŶĚ͕ĚĞƉĂƌƚŵĞŶƚ͕ƌĞĐŽƌĚ͕ƚĂď͕ĂŶĚĨŝĞůĚ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬ ƵĚŝƚdƌĂŝů&ĞĂƚƵƌĞƐ dƌĂŶƐĂĐƚŝŽŶƐĂƌĞƉƌŽĐĞƐƐĞĚŝŶ/ŶĐŽĚĞƵƐŝŶŐĂƉĂĐŬĞƚĐŽŶĐĞƉƚ;ƵƐĞƌͲĚĞĨŝŶĞĚŐƌŽƵƉƐŽĨƚƌĂŶƐĂĐƚŝŽŶƐͿĐƌĞĂƚŝŶŐĂ ƐLJƐƚĞŵůĞǀĞůĂƵĚŝƚƚƌĂŝůŽĨŝŶƉƵƚ͕ĞĚŝƚ͕ƌĞŐŝƐƚĞƌƐ͕ĂƉƉƌŽǀĂů͕ĂŶĚƵƉĚĂƚĞŽĨĚĂƚĂ͘ĨŽŽƚƉƌŝŶƚŝƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚ ĞĂĐŚƉĂĐŬĞƚĂŶĚƐƚĞƉƌĞĨůĞĐƚŝŶŐƚŚĞŽƉĞƌĂƚŽƌŝĚĞŶƚŝĨŝĐĂƚŝŽŶ͕ĚĂƚĞ͕ĂŶĚƚŝŵĞ͘dƌĂŶƐĂĐƚŝŽŶZĞŐŝƐƚĞƌƐƉƌŽǀŝĚĞ ĚĞƚĂŝůĞĚŝŶĨŽƌŵĂƚŝŽŶŝŶĐůƵĚŝŶŐĚĂƚĞƐ͕ŐĞŶĞƌĂůůĞĚŐĞƌĂĐĐŽƵŶƚŶĂŵĞƐĂŶĚŶƵŵďĞƌƐ͕ƚƌĂŶƐĂĐƚŝŽŶĂŵŽƵŶƚƐ͕ ĚĞƐĐƌŝƉƚŝŽŶƐ͕ĂŶĚƌĞĨĞƌĞŶĐĞƐ͘ůůƚƌĂŶƐĂĐƚŝŽŶƐĂƌĞĂůƐŽďƌĂŶĚĞĚǁŝƚŚĂŶŝĚĞŶƚŝĨŝĐĂƚŝŽŶƚŚĂƚŝŶĐŽƌƉŽƌĂƚĞƐƚŚĞ ƐŽƵƌĐĞŵŽĚƵůĞĨƌŽŵǁŚŝĐŚƚŚĞLJŽƌŝŐŝŶĂƚĞĚ͘ dƌĂŶƐĂĐƚŝŽŶĂƵĚŝƚƌĞƉŽƌƚƐĂƌĞĂŶĂĚĚŝƚŝŽŶĂůĂƵĚŝƚƐŽƵƌĐĞĂŶĚĂƌĞŽďƚĂŝŶĂďůĞĨŽƌƐƉĞĐŝĨŝĞĚĚĂƚĞĂŶĚĂĐĐŽƵŶƚ ƌĂŶŐĞƐ͘^LJƐƚĞŵͲŐĞŶĞƌĂƚĞĚĂƵĚŝƚůŽŐƐĂƌĞĂůƐŽĂĐĐĞƐƐŝďůĞƚŚĂƚƚƌĂĐŬƵƐĞƌĂĐĐĞƐƐƚŽĂůůƉƌŽŐƌĂŵƐǁŝƚŚŝŶƚŚĞ ƐLJƐƚĞŵ͘ĚĚŝƚŝŽŶĂůůLJ͕ƚŚĞƐLJƐƚĞŵĐƌĞĂƚĞƐĂƵĚŝƚĨŝůĞƐǁŝƚŚŝŶĂŶƵŵďĞƌŽĨƚŚĞŝŶĚŝǀŝĚƵĂůĂƉƉůŝĐĂƚŝŽŶƐƚŚĂƚůŽŐĂŶLJ ĐŚĂŶŐĞƐƚŽĐƌŝƚŝĐĂůĨŝĞůĚƐ͘ƵĚŝƚZĞƉŽƌƚƐĐĂŶďĞŐĞŶĞƌĂƚĞĚƚŚĂƚƌĞĨůĞĐƚƚŚĞƚLJƉĞŽĨĐŚĂŶŐĞ;ĂĚĚ͕ĐŚĂŶŐĞŽƌ ĚĞůĞƚĞͿ͕ĚĂƚĞ͕ƚŝŵĞ͕ŽƉĞƌĂƚŽƌ/͕ĚĂƚĂĨŝůĞ͕ĨŝĞůĚ/͕ŽůĚĚĂƚĂĂŶĚŶĞǁĚĂƚĂ͘ ĞƐƚƵƐŝŶĞƐƐWƌĂĐƚŝĐĞƐĂŶĚWƌŽĐĞƐƐ/ŵƉƌŽǀĞŵĞŶƚ dŚĞƵƐĞƌͲĚĞĨŝŶĞĚĐƵƐƚŽŵŝnjĂƚŝŽŶŝŶĐŽƌƉŽƌĂƚĞĚŝŶƚŽƚŚĞ/ŶĐŽĚĞƐŽůƵƚŝŽŶƉƌŽǀŝĚĞƐƵƐĞƌƐǁŝƚŚƚŚĞĂďŝůŝƚLJƚŽĚĞĨŝŶĞ ƚŚĞƐƚƌƵĐƚƵƌĞĂŶĚĐŽŶƚĞŶƚŽĨƚŚĞƐŽĨƚǁĂƌĞĂĐĐŽƌĚŝŶŐƚŽƚŚĞďĞƐƚďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐĂƉƉůŝĐĂďůĞƚŽƚŚĞŝƌƐƉĞĐŝĨŝĐ ĞŶǀŝƌŽŶŵĞŶƚ͘dŽĐŽŵƉůĞŵĞŶƚƚŚĂƚĨůĞdžŝďŝůŝƚLJ͕ŽƵƌŝŵƉůĞŵĞŶƚĂƚŝŽŶĂƉƉƌŽĂĐŚƉƌŽǀŝĚĞƐƚŚĞŽƉƉŽƌƚƵŶŝƚLJƚŽ ƌĞǀŝĞǁĐƵƌƌĞŶƚďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐĂŶĚƉƌŽĐĞƐƐĞƐ͘dLJůĞƌ͛ƐƐƚĂĨĨĐĂŶŵĞĞƚǁŝƚŚƉĞƌƐŽŶŶĞůƚŽŝĚĞŶƚŝĨLJĂƌĞĂƐĨŽƌ ŝŵƉƌŽǀĞŵĞŶƚĂŶĚĚĞƚĞƌŵŝŶĞƚŚĞŵŽƐƚĞĨĨŝĐŝĞŶƚǁŽƌŬĨůŽǁĞŶǀŝƌŽŶŵĞŶƚŝŶĂůůĂƌĞĂƐŽĨ/ŶĐŽĚĞƐŽĨƚǁĂƌĞ͘ YƵĂůŝƚLJƐƐƵƌĂŶĐĞ dLJůĞƌŝŶĐŽƌƉŽƌĂƚĞƐĂŶĞdžƚĞŶƐŝǀĞYƵĂůŝƚLJƐƐƵƌĂŶĐĞƉƌŽĐĞƐƐŝŶƚŚĞĚĞǀĞůŽƉŵĞŶƚŽĨŽƵƌƐŽĨƚǁĂƌĞƉƌŽĚƵĐƚƐ͘ DĞŵďĞƌƐŽĨƚŚĞ/ŶĐŽĚĞYƵĂůŝƚLJƐƐƵƌĂŶĐĞƚĞĂŵƐƉĞĐŝĂůŝnjĞŝŶƐƉĞĐŝĨŝĐĂƌĞĂƐŽĨƚŚĞƉƌŽĚƵĐƚůŝŶĞĐŽŶƐŝƐƚĞŶƚůLJ ĞdžƉĂŶĚŝŶŐƚŚĞŝƌĞdžƉĞƌƚŝƐĞŝŶƚŚĂƚƐƉĞĐŝĂůƚLJ͘dŚĞĂƉƉƌŽƉƌŝĂƚĞƚĞĂŵŵĞŵďĞƌŝƐĂƐƐŝŐŶĞĚƚŽƚĞƐƚƚŚĞĨŽƌŵĂŶĚ ĨƵŶĐƚŝŽŶŽĨĞĂĐŚĐŽŵƉŽŶĞŶƚŽĨĂŶĞǁĂƉƉůŝĐĂƚŝŽŶĂƐǁĞůůĂƐŝŶƚĞŐƌĂƚŝŽŶǁŝƚŚŽƚŚĞƌ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐ͘ dŚĞĂƉƉůŝĐĂďůĞƚĞĂŵŵĞŵďĞƌĂůƐŽĞŶƐƵƌĞƐƚŚĂƚĂŶLJƐŽĨƚǁĂƌĞĞŶŚĂŶĐĞŵĞŶƚƐƉĞƌĨŽƌŵĂƐĞdžƉĞĐƚĞĚĂŶĚ ǀĂůŝĚĂƚĞƐƚŚĂƚĂŶLJĐŚĂŶŐĞƐŵĂĚĞĚŽŶŽƚŚĂǀĞĂŶĂĚǀĞƌƐĞĞĨĨĞĐƚŽŶƌĞůĂƚĞĚƉƌŽŐƌĂŵƐĂŶĚƐLJƐƚĞŵƐ͘/ŶĂĚĚŝƚŝŽŶ ƚŽƚŚŝƐŝŶͲŚŽƵƐĞƚĞƐƚŝŶŐ͕ĞĂĐŚŶĞǁƌĞůĞĂƐĞŽĨ/ŶĐŽĚĞƐŽĨƚǁĂƌĞƵŶĚĞƌŐŽĞƐĞdžƚĞŶƐŝǀĞĞƚĂƚĞƐƚŝŶŐĂƚƐĞǀĞƌĂů ĐƵƐƚŽŵĞƌƐŝƚĞƐƚŽĞŶƐƵƌĞŝƚƐƌĞůŝĂďŝůŝƚLJŝŶƚŚĞĨŝĞůĚ͘ /ŶĐŽĚĞ&ŝŶĂŶĐŝĂůƐ^ƵŝƚĞ ǀĞƌLJƚŚŝŶŐLJŽƵŶĞĞĚĨŽƌĐŽŵƉůĞƚĞĨŝŶĂŶĐŝĂůŵĂŶĂŐĞŵĞŶƚ͕ƉŽǁĞƌĞĚďLJƚŚĞŵŽƐƚĐƵƌƌĞŶƚ͕ƉƌŽǀĞŶƚĞĐŚŶŽůŽŐLJ͕ŝƐ ĂǀĂŝůĂďůĞĨƌŽŵƚŚĞŶĂŵĞLJŽƵĐĂŶƚƌƵƐƚ͘dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͛/ŶĐŽĚĞ&ŝŶĂŶĐŝĂůDĂŶĂŐĞŵĞŶƚ^ŽĨƚǁĂƌĞ ƚƌĂŶƐĨŽƌŵƐĐŽŵƉůĞdžĨŝŶĂŶĐŝĂůƚĂƐŬƐĂŶĚƉƌŽĐĞƐƐĞƐŝŶƚŽĂĐĞŶƚƌĂůŝnjĞĚǁŽƌŬĨůŽǁĨŽƌĞĨĨŝĐŝĞŶĐLJ͕ƉƌŽĚƵĐƚŝǀŝƚLJĂŶĚ ĂĐĐƵƌĂĐLJ͕ǁŝƚŚŽƵƚƐĂĐƌŝĨŝĐŝŶŐĚĂƚĂŝŶƚĞŐƌŝƚLJ͘ 'ĞŶĞƌĂů>ĞĚŐĞƌ dLJůĞƌ͛Ɛ/ŶĐŽĚĞ'ĞŶĞƌĂů>ĞĚŐĞƌŝƐƚŚĞŚĞĂƌƚŽĨƚŚĞĨŝŶĂŶĐŝĂůĂƉƉůŝĐĂƚŝŽŶƐƐƵŝƚĞ͕ƉƌŽǀŝĚŝŶŐĐŽŵƉƌĞŚĞŶƐŝǀĞ ĨůĞdžŝďŝůŝƚLJĂŶĚĐŽŶƚƌŽůŽĨĨŝŶĂŶĐŝĂůƚƌĂŶƐĂĐƚŝŽŶƐ͘dŚŝƐĨĞĂƚƵƌĞͲƌŝĐŚĨƵŶĚĂĐĐŽƵŶƚŝŶŐĂƉƉůŝĐĂƚŝŽŶĂƵƚŽŵĂƚĞƐ ƌŽƵƚŝŶĞĨƵŶĐƚŝŽŶƐĂŶĚƉƌŽǀŝĚĞƐĂĐĐĞƐƐƚŽƚŚĞƐŽƵƌĐĞĚŽĐƵŵĞŶƚĨŽƌŵĂŶLJƚƌĂŶƐĂĐƚŝŽŶƐŝŶƚŚĞŐĞŶĞƌĂůůĞĚŐĞƌ͘ hƐĞƌƐĐĂŶŝŶƐƚĂŶƚůLJƌĞǀŝĞǁĂŶĚƌĞƉŽƌƚŽŶƌĞůĞǀĂŶƚĨŝŶĂŶĐŝĂůŝŶĨŽƌŵĂƚŝŽŶ͘ƵƚŽŵĂƚŝĐďĂůĂŶĐŝŶŐƚŽŽůƐŵĂŝŶƚĂŝŶ ĂĐĐƵƌĂƚĞĚĂƚĂǁŝƚŚŽƵƚĞdžĐĞƐƐŝǀĞĚĂƚĂĞŶƚƌLJǁŚŝůĞĞŶƐƵƌŝŶŐĐŽŵƉůŝĂŶĐĞǁŝƚŚƐƚĂŶĚĂƌĚĂĐĐŽƵŶƚŝŶŐƉƌŽĐĞĚƵƌĞƐ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭ 'ĞŶĞƌĂů>ĞĚŐĞƌŝŶƚĞŐƌĂƚĞƐǁŝƚŚŽƚŚĞƌ/ŶĐŽĚĞ&ŝŶĂŶĐŝĂů͕WĞƌƐŽŶŶĞů͕ĂƐŚŝĞƌŝŶŐ͕hƚŝůŝƚLJŝůůŝŶŐ͕ƵƐƚŽŵĞƌ ZĞůĂƚŝŽŶƐŚŝƉDĂŶĂŐĞŵĞŶƚ͕ĂŶĚŽƵƌƚŵŽĚƵůĞƐ͘ /ŶĨŽƌŵĂƚŝŽŶΘZĞƉŽƌƚƐ xdžƉŽƌƚƐƌĞƉŽƌƚƌĞƐƵůƚƐƚŽĚŽďĞW&͕DŝĐƌŽƐŽĨƚΠdžĐĞůĂŶĚtŽƌĚ͕ĂŶĚdĞdžƚ͘ xWƌŽĚƵĐĞƐƉƌĞĚĞĨŝŶĞĚƌĞƉŽƌƚƐŝŶĐůƵĚŝŶŐ͗ o'ĞŶĞƌĂů>ĞĚŐĞƌĞƚĂŝůZĞƉŽƌƚ oŚĂƌƚŽĨĐĐŽƵŶƚƐ͕dƌĂŶƐĂĐƚŝŽŶZĞƉŽƌƚ oƵĚŐĞƚZĞƉŽƌƚ oƵĚŐĞƚŽŵƉĂƌŝƐŽŶZĞƉŽƌƚ oĂƐŚŶĂůLJƐŝƐZĞƉŽƌƚ͘ x'ĞŶĞƌĂƚĞƐĨŝŶĂŶĐŝĂůƐƚĂƚĞŵĞŶƚƐ͘&ŝŶĂŶĐŝĂů^ƚĂƚĞŵĞŶƚƐŵĂLJďĞƉƌŽĚƵĐĞĚŝŶƉŝǀŽƚĞĚĂŶĚĐŽŵƉĂƌŝƐŽŶ ĨŽƌŵĂƚƐ͘ xƌĞĂƚĞƐƵŶŝƋƵĞ&ŝŶĂŶĐŝĂů^ƚĂƚĞŵĞŶƚƐƵƐŝŶŐƚŚĞŝŶƚĞŐƌĂƚĞĚ&ŝŶĂŶĐŝĂů^ƚĂƚĞŵĞŶƚĞƐŝŐŶĞƌ͘ x'ƌŽƵƉƐĂĐĐŽƵŶƚƐƚŽƉƌŽǀŝĚĞƋƵŝĐŬƐĞůĞĐƚŝŽŶǁŚĞŶŐĞŶĞƌĂƚŝŶŐƌĞƉŽƌƚƐ͘ x^ĐŚĞĚƵůĞƐƌĞƉŽƌƚƐƚŽďĞĚĞůŝǀĞƌĞĚƚŽƵƐĞƌƐĂƚĂƐƉĞĐŝĨŝĐĚĂƚĞͬƚŝŵĞ͘ xDĂŝŶƚĂŝŶƐĂĐŽŵƉůĞƚĞĂƵĚŝƚƚƌĂŝůĨŽƌũŽƵƌŶĂůĞŶƚƌLJƌĞǀĞƌƐĂůĂŶĚƌĞƉŽƐƚŝŶŐ͘ xĞůŝǀĞƌƐƉŽǁĞƌĨƵůĨŝŶĂŶĐŝĂůŵĂŶĂŐĞŵĞŶƚƚŽŽůƐĂƚƚŚĞŝŶĚŝǀŝĚƵĂůĂĐĐŽƵŶƚůĞǀĞůƐƵĐŚĂƐ͗ĐĐŽƵŶƚƐƚĂƚƵƐ͕ ĞƚĂŝůƚƌĂŶƐĂĐƚŝŽŶƐ͕ĂůĂŶĐĞƚƌĂĐŬŝŶŐĨŽƌĂĐƚƵĂů͕ďƵĚŐĞƚ͕ĂŶĚĞŶĐƵŵďƌĂŶĐĞĂĐƚŝǀŝƚLJ͘ xŝƐƉůĂLJƐĂďƵĚŐĞƚĂŶĂůLJƐŝƐŐƌĂƉŚĨŽƌĞĂĐŚďƵĚŐĞƚĞĚůŝŶĞŝƚĞŵƚŽĐŽŵƉĂƌĞĞŶĐƵŵďĞƌĞĚĂŶĚĂĐƚƵĂů ĚŽůůĂƌƐĂŐĂŝŶƐƚďƵĚŐĞƚĞĚĚŽůůĂƌƐĨŽƌƚŚĞĨŝƐĐĂůLJĞĂƌ͘ x'ŝǀĞƐƵƐĞƌƐƐĞĂƌĐŚŐƌŝĚƐǁŝƚŚƉƌŝŶƚŝŶŐĂŶĚĞdžƉŽƌƚŝŶŐĐĂƉĂďŝůŝƚŝĞƐ͕ŝŶĐůƵĚŝŶŐĂĚĞƚĂŝůĞĚƚƌĂŶƐĂĐƚŝŽŶ ŚŝƐƚŽƌLJŐƌŝĚĂŶĚďƵĚŐĞƚƐƵŵŵĂƌLJŐƌŝĚ͘ dƌĂŶƐĂĐƚŝŽŶĨĨŝĐŝĞŶĐLJ xĂůĐƵůĂƚĞƐĂŶĚƚƌĂĐŬƐĂůůŽĐĂƚŝŽŶƐ͕ĂŶĚƐƵƉƉŽƌƚƐŵƵůƚŝƉůĞĂůůŽĐĂƚŝŽŶŵĞƚŚŽĚƐ͘ xŽŶĨŝŐƵƌĞƐĂĐĐŽƵŶƚƐƚƌƵĐƚƵƌĞƐďLJĞĂĐŚĂĐĐŽƵŶƚƚLJƉĞ xůůŽǁƐĂĐĐŽƵŶƚƐƚŽďĞŝŶĐůƵĚĞĚŝŶŵƵůƚŝƉůĞĐŚĂƌƚŽĨĂĐĐŽƵŶƚƐ͘ xWƌŽǀŝĚĞƐŵƵůƚŝƉůĞƚŝŵĞͲƐĂǀŝŶŐĨĞĂƚƵƌĞƐĨŽƌũŽƵƌŶĂůĞŶƚƌLJƉƌŽĐĞƐƐŝŶŐ xƵƚŽŵĂƚŝĐĂůůLJĐƌĞĂƚĞƐĂůůŝŶƚĞƌͲĨƵŶĚďĂůĂŶĐŝŶŐĞŶƚƌŝĞƐǁŚĞŶƉŽƐƚŝŶŐƚƌĂŶƐĂĐƚŝŽŶƐĂĐƌŽƐƐŵƵůƚŝƉůĞ ĨƵŶĚƐ͘ x^ƵƉƉŽƌƚƐĐŽŶĐƵƌƌĞŶƚůLJŽƉĞŶĨŝƐĐĂůLJĞĂƌƐ͘WĞƌŝŽĚƐǁŝƚŚŝŶŽƉĞŶĨŝƐĐĂůLJĞĂƌƐŵĂLJďĞĐůŽƐĞĚĂƐŶĞĞĚĞĚ͘ x:ŽƵƌŶĂůĞŶƚƌŝĞƐŵĂLJďĞƉŽƐƚĞĚƚŽĂĐůŽƐĞĚĨŝƐĐĂůLJĞĂƌĂƐŶĞĞĚĞĚĨŽƌĂĚŚĞƌĞŶĐĞǁŝƚŚĂƵĚŝƚĂĚũƵƐƚŵĞŶƚƐ͘ xWƌŽǀŝĚĞƐƚŽŽůƐƚŽĞĂƐŝůLJĞdžƚƌĂĐƚĨŝŶĂŶĐŝĂůŝŶĨŽƌŵĂƚŝŽŶŝŶƚŽĂŶĞdžŝƐƚŝŶŐDŝĐƌŽƐŽĨƚdžĐĞů^ƉƌĞĂĚƐŚĞĞƚ͘ hƐĞƌ&ƌŝĞŶĚůLJ xŽŵƉůĞƚĞĂƵĚŝƚĨƵŶĐƚŝŽŶƐŝŶĐůƵĚĞĨŽŽƚƉƌŝŶƚƐĂŶĚĂƵĚŝƚůŽŐƐĨŽƌƚƌĂĐŬŝŶŐĐŚĂŶŐĞƐƚŽĚĂƚĂ͘ xŽŵƉƌĞŚĞŶƐŝǀĞĂĐĐŽƵŶƚŝŶŐƐĞĐƵƌŝƚLJĂƚƚŚĞĂĐĐŽƵŶƚĂŶĚďƵĚŐĞƚůĞǀĞů͘ x'>ĂĐĐŽƵŶƚƐŽĨĨĞƌƐĞĐƵƌĞĚĂĚĚͬĞĚŝƚĨƵŶĐƚŝŽŶĂůŝƚLJĨƌŽŵĂŶLJǁŚĞƌĞŝŶƚŚĞƐLJƐƚĞŵ͘ xŽĐƵŵĞŶƚĂƚƚĂĐŚŵĞŶƚĨĞĂƚƵƌĞĂƚƚŚĞĂĐĐŽƵŶƚůĞǀĞů͘ xdŝŵĞͲƐĂǀŝŶŐŵĂƐƐĂĚĚĂĐĐŽƵŶƚĨĞĂƚƵƌĞƚŚĂƚƋƵŝĐŬůLJĐƌĞĂƚĞƐŶĞǁĂĐĐŽƵŶƚƐďĂƐĞĚŽŶĞdžŝƐƚŝŶŐĂĐĐŽƵŶƚƐ͘ ĂŶŬZĞĐŽŶĐŝůŝĂƚŝŽŶ dLJůĞƌ͛Ɛ/ŶĐŽĚĞĂŶŬZĞĐŽŶĐŝůŝĂƚŝŽŶŝƐĂŶŝŶƚĞƌĂĐƚŝǀĞŵŽĚƵůĞƚŚĂƚƌĞĐŽŶĐŝůĞƐŵŽŶƚŚůLJďĂŶŬƐƚĂƚĞŵĞŶƚƐƚŽ ŐĞŶĞƌĂůůĞĚŐĞƌĐĂƐŚĂĐĐŽƵŶƚƐ͘^LJƐƚĞŵͲǁŝĚĞŝŶƚĞŐƌĂƚŝŽŶĂƵƚŽŵĂƚĞƐƚŚĞŵŽŶƚŚͲĞŶĚƌĞĐŽŶĐŝůŝĂƚŝŽŶƉƌŽĐĞƐƐ͕ĂŶĚ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮ ƉŽƐƚŝŶŐƐƚŚƌŽƵŐŚƚŚĞ'ĞŶĞƌĂů>ĞĚŐĞƌĂƌĞƌĞĐŽŐŶŝnjĞĚĨŽƌŝƚĞŵƐƐƵĐŚĂƐďĂŶŬĚĞƉŽƐŝƚƐ͕ƐĞƌǀŝĐĞƐĐŚĂƌŐĞƐ͕ ŝŶƚĞƌĞƐƚŝŶĐŽŵĞ͕ĂŶĚƌĞƚƵƌŶĞĚĂŶĚĐůĞĂƌĞĚĐŚĞĐŬƐ͘ĂŶŬZĞĐŽŶĐŝůŝĂƚŝŽŶŝŶƚĞƌĨĂĐĞƐǁŝƚŚ/ŶĐŽĚĞ'ĞŶĞƌĂů>ĞĚŐĞƌ͕ ĐĐŽƵŶƚƐWĂLJĂďůĞ͕WĂLJƌŽůů͕&ŝdžĞĚƐƐĞƚƐ͕hƚŝůŝƚLJŝůůŝŶŐ͕ĂŶĚĂƐŚŝĞƌŝŶŐ͘ /ŶĨŽƌŵĂƚŝŽŶΘZĞƉŽƌƚƐ xZĞĐŽŶĐŝůĞƐŵŽŶƚŚůLJďĂŶŬƐƚĂƚĞŵĞŶƚƐƚŽŐĞŶĞƌĂůůĞĚŐĞƌĐĂƐŚĂĐĐŽƵŶƚƐǁŝƚŚƚŚĞ/ŶĐŽĚĞZĞĐŽŶĐŝůŝĂƚŝŽŶ ^ƚĂƚĞŵĞŶƚ͘ xWƌŽĚƵĐĞƐŵŽŶƚŚůLJƌĞĐŽŶĐŝůŝĂƚŝŽŶƐƚĂƚĞŵĞŶƚƐƌĞĨůĞĐƚŝŶŐĂƐƵŵŵĂƌLJŽĨďĂůĂŶĐĞƐĂŶĚƉĞƌŝŽĚĂĐƚŝǀŝƚLJĨŽƌ ďŽƚŚďĂŶŬĂĐĐŽƵŶƚĂŶĚŐĞŶĞƌĂůůĞĚŐĞƌĨŽƌĞĂƐLJĐŽŵƉĂƌŝƐŽŶ͘ x/ĚĞŶƚŝĨŝĞƐŽƵƚƐƚĂŶĚŝŶŐŝƚĞŵƐƚŽĐůĞĂƌĚƵƌŝŶŐƚŚĞĐƵƌƌĞŶƚŵŽŶƚŚ͛ƐƌĞĐŽŶĐŝůŝĂƚŝŽŶ͕ŽĨĨĞƌŝŶŐĂĚĞĨĂƵůƚ ĐůĞĂƌŝŶŐĚĂƚĞƚŽƐƉĞĞĚƵƉƚŚĞƌĞĐŽŶĐŝůŝĂƚŝŽŶƉƌŽĐĞƐƐ͘ xWƌŽĚƵĐĞƐĂĂŶŬdƌĂŶƐĂĐƚŝŽŶZĞƉŽƌƚŽĨĨĞƌŝŶŐŵĂŶLJĨŝůƚĞƌƐƐƵĐŚĂƐ͗ďĂŶŬĂĐĐŽƵŶƚ͕ƚƌĂŶƐĂĐƚŝŽŶƚLJƉĞ͕ ĐůĞĂƌĞĚĚĂƚĞ͕ŝƐƐƵĞĚĚĂƚĞ͕ĐŚĞĐŬŶƵŵďĞƌƌĂŶŐĞ͕ĂŶĚŽƌŝŐŝŶĂƚŝŽŶ͘/ŶĚŝĐĂƚĞƐǀŽŝĚĞĚĐŚĞĐŬƐŽŶƚŚĞ ƌĞĐŽŶĐŝůŝĂƚŝŽŶƌĞŐŝƐƚĞƌ͘ xdƌĂĐŬƐƚŚĞƐLJƐƚĞŵǁŚĞƌĞĂŶŝƚĞŵŽƌŝŐŝŶĂƚĞĚ͕ƚŚĞĂĐĐŽƵŶƚŶƵŵďĞƌĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞŝƚĞŵ;ƐŽƵƌĐĞͿ͕ ĨŽŽƚƉƌŝŶƚĚĞƚĂŝůƐ͕ĂŶĚĐŚĂŶŐĞŚŝƐƚŽƌLJ͘ x'ŝǀĞƐƵƐĞƌƐƐĞĂƌĐŚŐƌŝĚƐǁŝƚŚƉƌŝŶƚŝŶŐĂŶĚĞdžƉŽƌƚŝŶŐĐĂƉĂďŝůŝƚŝĞƐ͕ŝŶĐůƵĚŝŶŐĂďĂŶŬƚƌĂŶƐĂĐƚŝŽŶŚŝƐƚŽƌLJ ŐƌŝĚ͘ hƐĞƌ&ƌŝĞŶĚůLJ x/ŶĚŝĐĂƚĞƐƋƵŝĐŬŝƚĞŵůŽŽŬƵƉĨĞĂƚƵƌĞƐďĂƐĞĚŽŶĂŵŽƵŶƚƌĂŶŐĞ͕ƚLJƉĞ͕ƐƚĂƚƵƐ͕ŽƌŝŐŝŶĂƚŝŶŐƐLJƐƚĞŵ͕ĂŶĚ ŵŽƌĞ͘ xEŽƚĞƐĨĞĂƚƵƌĞĨŽƌĂŶŬĐĐŽƵŶƚƐĂŶĚĂŶŬ^ƚĂƚĞŵĞŶƚƐĐĂƉƚƵƌĞƐŝŵƉŽƌƚĂŶƚŝŶĨŽƌŵĂƚŝŽŶ͘ dƌĂŶƐĂĐƚŝŽŶĨĨŝĐŝĞŶĐLJ xůůŽǁƐŵƵůƚŝƉůĞďĂŶŬĂĐĐŽƵŶƚƐ͘ xWƌŽĐĞƐƐĞƐĂŶƵŶůŝŵŝƚĞĚŶƵŵďĞƌŽĨĐĂƐŚĂĐĐŽƵŶƚƐƉĞƌĨƵŶĚ͘ x,ĂŶĚůĞƐ͞ƉŽŽůĞĚĐĂƐŚ͟ĨƵŶĐƚŝŽŶǁŝƚŚĂĐŽŶƐŽůŝĚĂƚĞĚƌĞĐŽŶĐŝůŝĂƚŝŽŶƉƌŽĐĞƐƐǁŚĞŶĂƐŝŶŐůĞďĂŶŬ ĂĐĐŽƵŶƚŝƐŵĂŝŶƚĂŝŶĞĚĨŽƌŵƵůƚŝƉůĞƐĞĐŽŶĚĂƌLJĐĂƐŚĂĐĐŽƵŶƚƐŝŶǀĂƌŝŽƵƐĨƵŶĚƐ͘ xůĞĂƌƐŽƵƚƐƚĂŶĚŝŶŐƚƌĂŶƐĂĐƚŝŽŶƐŝŶĚŝǀŝĚƵĂůůLJ͕ŝŶŐƌŽƵƉƐ͕ŽƌĞůĞĐƚƌŽŶŝĐĂůůLJďLJĚŽǁŶůŽĂĚŝŶŐƚŚĞďĂŶŬ ƐƚĂƚĞŵĞŶƚǀŝĂƚŚĞ/ŶƚĞƌŶĞƚĨƌŽŵLJŽƵƌĨŝŶĂŶĐŝĂůŝŶƐƚŝƚƵƚŝŽŶ͘;ĂŶŬ&ŝůĞ/ŵƉŽƌƚ͍Ϳ xĐĐĞƉƚƐĂĚũƵƐƚŵĞŶƚƐƋƵŝĐŬůLJĂŶĚĞĂƐŝůLJĨŽƌƚƌĂŶƐĂĐƚŝŽŶƐƐƵĐŚĂƐƐĞƌǀŝĐĞĐŚĂƌŐĞƐ͕ŝŶƚĞƌĞƐƚ͕ĂŶĚ ŵŝƐĐĞůůĂŶĞŽƵƐŝƚĞŵƐ͘ xdƌĂĐŬƐƚŚĞďĞŐŝŶŶŝŶŐĚĂƚĞŽĨƚŚĞŶĞdžƚďĂŶŬƐƚĂƚĞŵĞŶƚ͕ŶŽƚĞƐƚŚŝƐĚĂƚĞĚƵƌŝŶŐŝŶŝƚŝĂůƐĞƚƵƉĨŽƌ ƌĞĐŽŶĐŝůŝĂƚŝŽŶĂĐĐŽƵŶƚ͕ĂŶĚƚŚĞƌĞĂĨƚĞƌŵĂŝŶƚĂŝŶƐƚŚŝƐĚĂƚĞǁŚĞŶĞǀĞƌLJŽƵƵƉĚĂƚĞƚŚĞĂĐĐŽƵŶƚŝŶƚŚĞ ĂŶŬZĞĐŽŶĐŝůŝĂƚŝŽŶWƌŽĐĞƐƐ͘ ĐĐŽƵŶƚƐWĂLJĂďůĞ dLJůĞƌ͛Ɛ/ŶĐŽĚĞĐĐŽƵŶƚƐWĂLJĂďůĞĨĂĐŝůŝƚĂƚĞƐĐĂƐŚ͕ĂĐĐƌƵĂů͕ĂŶĚŵŽĚŝĨŝĞĚĂĐĐƌƵĂůďĂƐŝƐĂĐĐŽƵŶƚŝŶŐ͘ĐĐŽƵŶƚƐ WĂLJĂďůĞŵĂŬĞƐŝƚĞĂƐLJƚŽŵŽŶŝƚŽƌĐĂƐŚĨůŽǁ͕ŵĂŶĂŐĞĚŝƐďƵƌƐĞŵĞŶƚƐ͕ĂŶĚƌĞĚƵĐĞĚĂƚĂĞŶƚƌLJĚƵƉůŝĐĂƚŝŽŶ͘/ƚƐ ĨůĞdžŝďŝůŝƚLJĂůůŽǁƐƵƐĞƌƐƚŽƉƌŽĐĞƐƐŝŶǀŽŝĐĞƐĂƐǁĞůůĂƐĚĞďŝƚĂŶĚĐƌĞĚŝƚŵĞŵŽƐǁŚŝůĞŵĂŝŶƚĂŝŶŝŶŐĂƵĚŝƚƚƌĂŝůƐĨŽƌ ĚĂƚĂŝŶƉƵƚŝŶƚĞŐƌŝƚLJ͘/ƚƐŵƵůƚŝƉůĞǀĞŶĚŽƌĨĞĂƚƵƌĞƐĂůůŽǁƵƐĞƌƐƚŽƐĞĂƌĐŚďLJǀĞŶĚŽƌŶĂŵĞ͕ǀĞŶĚŽƌŶƵŵďĞƌŽƌ EĂŵĞ͕ŵĂŝŶƚĂŝŶŵƵůƚŝƉůĞĂĚĚƌĞƐƐĞƐ͕ƐĞƚƉĂLJŵĞŶƚƚĞƌŵƐ͕ǀŝĞǁĂĐŽŵƉƌĞŚĞŶƐŝǀĞƚƌĂŶƐĂĐƚŝŽŶŚŝƐƚŽƌLJ͕ĂŶĚ ĞĂƐŝůLJŵĂŶĂŐĞϭϬϵϵƌĞƉŽƌƚŝŶŐ͘dŚŝƐĂƉƉůŝĐĂƚŝŽŶŝŶƚĞŐƌĂƚĞƐƐĞĂŵůĞƐƐůLJǁŝƚŚŽƚŚĞƌ/ŶĐŽĚĞŵŽĚƵůĞƐŝŶĐůƵĚŝŶŐ 'ĞŶĞƌĂů>ĞĚŐĞƌ͕WƵƌĐŚĂƐĞKƌĚĞƌƐ͕WĂLJƌŽůů͕ĂŶŬZĞĐŽŶĐŝůŝĂƚŝŽŶ͕&ŝdžĞĚƐƐĞƚƐ͕WƌŽũĞĐƚĐĐŽƵŶƚŝŶŐĂŶĚtŽƌŬ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯ KƌĚĞƌƐĂƐǁĞůůĂƐǁŝƚŚƵƐŝŶĞƐƐ>ŝĐĞŶƐĞ͕ƵŝůĚŝŶŐWƌŽũĞĐƚƐ͕^ĂůĞƐdĂdžĂŶĚ^ƉĞĐŝĂůƐƐĞƐƐŵĞŶƚƐĨŽƌƌĞĨƵŶĚĐŚĞĐŬ ƉƌŽĐĞƐƐŝŶŐ͘ /ŶĨŽƌŵĂƚŝŽŶΘZĞƉŽƌƚƐ xKĨĨĞƌƐĂǀĂƌŝĞƚLJŽĨƌĞƉŽƌƚŝŶŐŽƉƚŝŽŶƐŝŶĐůƵĚŝŶŐŽƉĞŶƉĂLJĂďůĞƐ͕ĐĂƐŚƌĞƋƵŝƌĞŵĞŶƚƐ͕ĂŶĚƉĂLJŵĞŶƚ ƌĞŐŝƐƚĞƌƐ͘ x/ŶĐůƵĚĞƐƚŚĞKƉĞŶWĂLJĂďůĞZĞƉŽƌƚǁŚŝĐŚƐŚŽǁƐƉĂLJĂďůĞƐĨŽƌƵƐĞƌƐƉĞĐŝĨŝĞĚĨƵŶĚƐĂŶĚĨŝůƚĞƌƐƚŚĞ ƉĂLJĂďůĞƐŽŶƚŚĞƌĞƉŽƌƚďLJĂƌĂŶŐĞŽĨĚĂƚĞƐ͘ xdƌĂĐŬƐϭϬϵϵͲD/^ĂŶĚϭϬϵϵͲ^ƌĞƉŽƌƚĂďůĞƚƌĂŶƐĂĐƚŝŽŶƐ͕ƉƌŝŶƚƐϭϬϵϵĂŶĚϭϬϵϲĨŽƌŵƐ͕ĂƐǁĞůůĂƐ ƉƌŽĚƵĐĞƐĞůĞĐƚƌŽŶŝĐĨŝůĞƐĨŽƌĨĞĚĞƌĂůĂŶĚƐƚĂƚĞƌĞƉŽƌƚŝŶŐ͘ xWƌŽǀŝĚĞƐĂďŝůŝƚLJƚŽƚƌĂĐŬƐĂůĞƐĂŶĚƵƐĞƚĂdžĞƐ͘ xdžƉŽƌƚƐƌĞƉŽƌƚƌĞƐƵůƚƐƚŽŽƚŚĞƌĚĂƚĂĨŽƌŵĂƚƐŝŶĐůƵĚŝŶŐĚŽďĞW&͕DŝĐƌŽƐŽĨƚΠdžĐĞůĂŶĚtŽƌĚ͕ĂŶĚ dĞdžƚ͘ xƌĞĂƚĞƐĂǀŝƌƚƵĂů͞ƉĂƉĞƌůĞƐƐŽĨĨŝĐĞ͟ƵƐŝŶŐŝŶƚĞŐƌĂƚĞĚŽĐƵŵĞŶƚDĂŶĂŐĞŵĞŶƚĨƵŶĐƚŝŽŶĂůŝƚLJ͘ xWƌŽǀŝĚĞƐŝŶƋƵŝƌLJĂŶĚŵĂŶĂŐĞŵĞŶƚƚŽŽůƐĨŽƌŬĞLJǀĞŶĚŽƌŝŶĨŽƌŵĂƚŝŽŶŝŶĐůƵĚŝŶŐƚŚĞĂďŝůŝƚLJƚŽĞŵĂŝů&d ĂŶĚWKŶŽƚŝĐĞƐƚŽǀĞŶĚŽƌƐĚŝƌĞĐƚůLJĨƌŽŵǁŝƚŚŝŶƚŚĞĂƉƉůŝĐĂƚŝŽŶ͘ xWƌĞƐĞŶƚƐǀĞŶĚŽƌƚƌĂŶƐĂĐƚŝŽŶŚŝƐƚŽƌLJŝŶĚLJŶĂŵŝĐ͕ĐŽŶĨŝŐƵƌĂďůĞŐƌŝĚƐǁŝƚŚƉŽǁĞƌĨƵůƋƵĞƌLJƚŽŽůƐƚŚĂƚ ƉƌŽǀŝĚĞĞĂƐLJƉƌŝŶƚŝŶŐĂŶĚĚĂƚĂĞdžƉŽƌƚĨƵŶĐƚŝŽŶƐ͘ xĞůŝǀĞƌƐĐŽŵƉƌĞŚĞŶƐŝǀĞĐŽŶƚƌŽůŽĨƚŚĞƉĂLJŵĞŶƚƉƌŽĐĞƐƐĂŶĚĐĂƐŚƌĞƋƵŝƌĞŵĞŶƚƐ͘ xWƌŽĚƵĐĞƐƌĞŐŝƐƚĞƌƐĂŶĚĂƵĚŝƚƌĞƉŽƌƚƐŶĞĐĞƐƐĂƌLJĨŽƌĂĐŽŵƉůĞƚĞĂƵĚŝƚƚƌĂŝů͘ hƐĞƌ&ƌŝĞŶĚůLJ xWƌĞǀĞŶƚƐĚƵƉůŝĐĂƚĞƉĂLJĂďůĞŶƵŵďĞƌƐ͘ xůůŽǁƐƵŶůŝŵŝƚĞĚƵƐĞƌͲĚĞĨŝŶĞĚĨŝĞůĚƐƚŽďĞĂĚĚĞĚĂƚƚŚĞǀĞŶĚŽƌůĞǀĞůƚŽĐĂƉƚƵƌĞƵŶŝƋƵĞŝŶĨŽƌŵĂƚŝŽŶ ƚƌĂĐŬŝŶŐŶĞĞĚƐ͘ xWƌŽǀŝĚĞƐƚŽŽůƚŽĐŚĂŶŐĞƚŚĞƐƚĂƚƵƐŽĨŵƵůƚŝƉůĞǀĞŶĚŽƌƐĂƚŽŶĞƚŝŵĞďĂƐĞĚŽŶůĂƐƚĂĐƚŝǀŝƚLJĚĂƚĞ͘ dƌĂŶƐĂĐƚŝŽŶĨĨŝĐŝĞŶĐLJ xWƌŽǀŝĚĞƐĞĨĨŝĐŝĞŶĐŝĞƐĨŽƌĐƌĞĂƚŝŶŐǀĞŶĚŽƌƉĂLJĂďůĞƐďĂƐĞĚŽŶĂĚĞĨŝŶĞĚƉĂLJŵĞŶƚƐĐŚĞĚƵůĞŽƌƚĞŵƉůĂƚĞ͘ xůůŽǁƐĨŽƌŽŶͲĚĞŵĂŶĚĐŚĞĐŬǁƌŝƚŝŶŐ͘ xŝƐƉůĂLJƐŽƵƚƐƚĂŶĚŝŶŐƉƵƌĐŚĂƐĞŽƌĚĞƌƐĨŽƌĂǀĞŶĚŽƌĚƵƌŝŶŐƉĂLJĂďůĞĞŶƚƌLJ͘ xŽŵƉƌĞŚĞŶƐŝǀĞƚƌĂŶƐĂĐƚŝŽŶŚŝƐƚŽƌLJĂǀĂŝůĂďůĞŽŶsĞŶĚŽƌƐŝŶĐůƵĚŝŶŐƉĂLJŵĞŶƚƐ͕ŽƵƚƐƚĂŶĚŝŶŐƉĂLJĂďůĞƐ͕ ƉƵƌĐŚĂƐĞƐ͕ĂŶĚƉƵƌĐŚĂƐĞŽƌĚĞƌƐ͘ xůůŽǁƐŝƚĞŵƐƚŽďĞĞdžƉĞŶƐĞĚƚŽĂǀŝƌƚƵĂůůLJƵŶůŝŵŝƚĞĚŶƵŵďĞƌŽĨĂĐĐŽƵŶƚƐĂŶĚĨƵŶĚƐ͘ x^ƵƉƉŽƌƚƐĐŚĞĐŬǁƌŝƚŝŶŐĨƌŽŵƐĞƉĂƌĂƚĞĨƵŶĚƐ͕ĂĚŝƐďƵƌƐĞŵĞŶƚĨƵŶĚ͕ŽƌĂƉŽŽůĞĚĐĂƐŚĨƵŶĚ͘ xůůŽǁƐĂƵƚŽŵĂƚŝĐƉĂLJŵĞŶƚƐĞůĞĐƚŝŽŶďLJǀĞŶĚŽƌ͕ĚƵĞĚĂƚĞŽƌŵĂŶƵĂůƉĂLJŵĞŶƚƐĞůĞĐƚŝŽŶ͘ x^ƵƉƉŽƌƚƐŵƵůƚŝƉůĞƉĂLJŵĞŶƚŵĞƚŚŽĚƐ͕ŽǀĞƌďƵĚŐĞƚĐŚĞĐŬŝŶŐĂŶĚĚŽĐŬĞƚͬĐůĂŝŵŶƵŵďĞƌŝŶŐ͘ xWƌŽǀŝĚĞƐĂĚĚͬĞĚŝƚĨƵŶĐƚŝŽŶĂůŝƚLJĨŽƌ'>ĂĐĐŽƵŶƚƐĂŶĚǀĞŶĚŽƌƐĚƵƌŝŶŐƉĂLJĂďůĞƉƌŽĐĞƐƐŝŶŐ͘ xWƌŽǀŝĚĞƐĂďŝůŝƚLJƚŽŝŵƉŽƌƚƉĂLJĂďůĞƐǀŝĂĨůĂƚͬƚĞdžƚĨŝůĞ͘ x^ƵƉƉŽƌƚƐƉĂLJŵĞŶƚƚŽƉƵƌĐŚĂƐĞĐĂƌĚǀĞŶĚŽƌǁŚŝůĞƚƌĂĐŬŝŶŐƉƵƌĐŚĂƐĞĚĨƌŽŵǀĞŶĚŽƌĚĞƚĂŝů͘ WŝǀŽƚWůƵƐ xĐĐĞƐƐƚŚĞĚĂƚĂLJŽƵŶĞĞĚŽƵƚŽĨƚŚĞƐLJƐƚĞŵǁŝƚŚŽƵƚƌĞůLJŝŶŐŽŶĂƉƌŽŐƌĂŵŵĞƌƚŽĞdžƚƌĂĐƚŽƌǁƌŝƚĞĂ ĐƵƐƚŽŵƌĞƉŽƌƚ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰ xŶŚĂŶĐĞLJŽƵƌƌĞƉŽƌƚŝŶŐĂŶĚĚĂƚĂĂŶĂůLJƐŝƐĐĂƉĂďŝůŝƚŝĞƐďLJĞdžƚĞŶĚŝŶŐĂĐĐĞƐƐŝďŝůŝƚLJŽĨLJŽƵƌĚĂƚĂƚŽD^ džĐĞů xdƵƌŶLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶ͛ƐĚĂƚĂŝŶƚŽŵĞĂŶŝŶŐĨƵůŝŶƐŝŐŚƚƐĨŽƌďĞƚƚĞƌĚĞĐŝƐŝŽŶŵĂŬŝŶŐ xĂƐLJƚŽƵƐĞƚŽŽůƐĞdžƚƌĂĐƚĚĂƚĂƚŽD^džĐĞůŝŶĂŵĂŶŶĞƌƚŚĂƚƐƵƉƉŽƌƚƐLJŽƵƌĞdžŝƐƚŝŶŐƐƉƌĞĂĚƐŚĞĞƚƐ xhƐŝŶŐ/ŶĐŽĚĞϭϬĚĂƚĂ͕ĐƌĞĂƚĞƉŝǀŽƚƚĂďůĞƐ͕ĐŚĂƌƚƐ͕ŐƌĂƉŚƐĂŶĚŽƚŚĞƌdžĐĞůďĂƐĞĚĂŶĂůLJƚŝĐƐĂŶĚƚŚĞŶ ƌĞĨƌĞƐŚƚŚĞĚĂƚĂĂƐŶĞĞĚĞĚ ƵĚŐĞƚDĂŶĂŐĞƌ dLJůĞƌ͛Ɛ/ŶĐŽĚĞƵĚŐĞƚWƌĞƉĂƌĂƚŝŽŶĐƌĞĂƚĞƐĂŶĚŵĂŝŶƚĂŝŶƐďƵĚŐĞƚƐĨŽƌĐƵƌƌĞŶƚĂŶĚĨƵƚƵƌĞĨŝƐĐĂůLJĞĂƌƐ͘hƐĞƌƐ ĐĂŶǀŝĞǁƉƌĞǀŝŽƵƐLJĞĂƌďƵĚŐĞƚƐĂŶĚĐƌĞĂƚĞŵŽĚĞůƐĨŽƌĨƵƚƵƌĞĨŝƐĐĂůLJĞĂƌďƵĚŐĞƚƐ͘ǀĂƌŝĞƚLJŽĨƌĞƉŽƌƚŝŶŐ ŽƉƚŝŽŶƐŐŝǀĞƐƵƐĞƌƐƚŚĞĨƌĞĞĚŽŵƚŽĐƵƐƚŽŵŝnjĞďƵĚŐĞƚƐƉƌĞĂĚƐŚĞĞƚƐƚŽĨŝƚƚŚĞŝƌŶĞĞĚƐ͘dŚŝƐŵŽĚƵůĞĐĂŶ ĂĐĐŽŵŵŽĚĂƚĞƵƉƚŽϵϵǀĞƌƐŝŽŶƐƉĞƌĨƵŶĚ͕ĂůůŽǁŝŶŐŵƵůƚŝƉůĞĐŚĂŶŐĞƐĂŶĚƵƐĞƌͲĚĞĨŝŶĞĚƐĐĞŶĂƌŝŽƐ͘ƵĚŐĞƚ WƌĞƉĂƌĂƚŝŽŶŝŶƚĞŐƌĂƚĞƐǁŝƚŚ/ŶĐŽĚĞ'ĞŶĞƌĂů>ĞĚŐĞƌĂŶĚZĞƉŽƌƚ'ĞŶĞƌĂƚŽƌ͘ĚĚŝƚŝŽŶĂůůLJ͕ƉĞƌƐŽŶŶĞůďƵĚŐĞƚƐ ĂƵƚŽŵĂƚŝĐĂůůLJƚƌĂŶƐĨĞƌĨƌŽŵŽƵƌŝŶƚĞŐƌĂƚĞĚ,ƵŵĂŶZĞƐŽƵƌĐĞƐWŽƐŝƚŝŽŶŽŶƚƌŽůƵĚŐĞƚŝŶŐŵŽĚƵůĞ͘ /ŶĨŽƌŵĂƚŝŽŶΘZĞƉŽƌƚƐ xŽŶƐŽůŝĚĂƚĞƐďƵĚŐĞƚƉƌĞƉĂŶĚĂŶĂůLJƐŝƐĨƵŶĐƚŝŽŶƐŝŶŽŶĞƉůĂĐĞ xĞĨŝŶĞƐďƵĚŐĞƚŝŶĨŽƌŵĂƚŝŽŶǀŝĞǁƐďLJĨƵŶĚ͕ĚĞƉĂƌƚŵĞŶƚ͕ƚLJƉĞ͕ŽƌĂĐĐŽƵŶƚƐ xŽŶƚƌŽůƐĂĐĐĞƐƐƚŽďƵĚŐĞƚŝŶĨŽƌŵĂƚŝŽŶƐŽƚŚĂƚĚĞƉĂƌƚŵĞŶƚŚĞĂĚƐĐĂŶďĞůŝŵŝƚĞĚƚŽĚĞƉĂƌƚŵĞŶƚĂů ďƵĚŐĞƚƐƵŶĚĞƌƚŚĞŝƌĐŽŶƚƌŽů xůůŽǁƐƵƐĞƌƐƚŽĞĚŝƚďƵĚŐĞƚŝŶĨŽƌŵĂƚŝŽŶĂƚƚŚĞŝŶĚŝǀŝĚƵĂůĂĐĐŽƵŶƚůĞǀĞůŽƌĨŽƌĂůůĂĐĐŽƵŶƚƐ xZĞƉŽƌƚƐďƵĚŐĞƚƉƌŽũĞĐƚŝŽŶƐƚŚƌŽƵŐŚƵƐĞƌͲĚĞĮŶĞĚĮŶĂŶĐŝĂůƐƚĂƚĞŵĞŶƚĨŽƌŵĂƚƐ xWƌŽǀŝĚĞƐĚƌŝůůͲĚŽǁŶƚŽƐƵƉƉŽƌƚŝŶŐĚĞƚĂŝůƐ͕ŶŽƚĞƐ͕ĂŶĚĚŝƐƚƌŝďƵƚŝŽŶŽĨĚŽůůĂƌƐĨƌŽŵďƵĚŐĞƚǁŽƌŬƐŚĞĞƚ ǀŝĞǁƐ hƐĞƌ&ƌŝĞŶĚůLJ xhƐĞƌͲĚĞĮŶĞĚƐLJƐƚĞŵƐĞĐƵƌŝƚLJƚŚĂƚĐŽŶƚƌŽůƐĂĐĐĞƐƐƚŽƚŚĞďƵĚŐĞƚŝŶŐĨŝůĞƐ xĐĐĞƐƐŝďŝůŝƚLJƚŽĂůůƌĞǀĞŶƵĞĂŶĚĞdžƉĞŶĚŝƚƵƌĞůŝŶĞŝƚĞŵƐ͕ŝŶĐůƵĚŝŶŐĨƵƚƵƌĞƐƚĂƚƵƐůŝŶĞŝƚĞŵƐŝŶƚĞŶĚĞĚĨŽƌ ĨƵƚƵƌĞďƵĚŐĞƚƉĞƌŝŽĚƐ xĂƐLJůŝŶĞŝƚĞŵŐƌŽƵƉŝŶŐĨŽƌďƵĚŐĞƚĐŽŶƚƌŽůƉƵƌƉŽƐĞƐ x&ůĞdžŝďůĞďƵĚŐĞƚŶŽƚĞƐĨĞĂƚƵƌĞƐŝŶĐůƵĚŝŶŐƉĞƌŵĂŶĞŶƚ͕ĐƵƌƌĞŶƚ͕ĂŶĚŶĞdžƚLJĞĂƌŶŽƚĞƐĂƚƚŚĞůŝŶĞŝƚĞŵ͕ ĚĞƉĂƌƚŵĞŶƚ͕ĂŶĚĨƵŶĚůĞǀĞů x^ƵƉƉŽƌƚĨŽƌďŽƚŚĞdžƉŽƌƚĂŶĚŝŵƉŽƌƚŽĨďƵĚŐĞƚƐǁŝƚŚDŝĐƌŽƐŽĨƚdžĐĞů dƌĂŶƐĂĐƚŝŽŶĨĨŝĐŝĞŶĐLJ xDĂŝŶƚĂŝŶƐKŝŶƚĞƌĨĂĐĞĐŽŵƉůŝĂŶĐĞ xĂůĐƵůĂƚĞƐƉƌŽũĞĐƚŝŽŶƐďĂƐĞĚŽŶŽƚŚĞƌďƵĚŐĞƚƐŽƌzdďĂůĂŶĐĞƐǁŝƚŚƵƐĞƌͲĚĞĮŶĞĚŵƵůƚŝƉůŝĞƌƐĂŶĚ ĨŝůƚĞƌƐŽŶĐŽƐƚĐĞŶƚĞƌƐĂŶĚĂĐĐŽƵŶƚƐĞŐŵĞŶƚƐ x/ŵƉŽƌƚƐƉĞƌƐŽŶŶĞůďƵĚŐĞƚƐĨƌŽŵƚŚĞ,ZWŽƐŝƚŝŽŶŽŶƚƌŽůƵĚŐĞƚŝŶŐŵŽĚƵůĞ xƵƚŽŵĂƚŝĐĂůůLJĚŝƐƚƌŝďƵƚĞƐďƵĚŐĞƚĂŵŽƵŶƚƐĞǀĞŶůLJƚŽĂůůŵŽŶƚŚƐŽƌƚŽĞĂĐŚŵŽŶƚŚŝŶƉƌŽƉŽƌƚŝŽŶƚŽƚŚĞ ĂĐƚƵĂůĂŵŽƵŶƚƐĨƌŽŵĂŚŝƐƚŽƌŝĐĂůLJĞĂƌ x/ŶƐƚĂůůƐƚŚĞĂĚŽƉƚĞĚďƵĚŐĞƚŝŶĂƋƵŝĐŬĂŶĚƐŝŵƉůĞƉƌŽĐĞƐƐ xdƌĂĐŬƐĂůůĐŚĂŶŐĞƐƚŽƚŚĞĨŝŶĂůĂƉƉƌŽǀĞĚďƵĚŐĞƚĂƐĂŵĞŶĚŵĞŶƚƐǁŝƚŚĂĐŽŵƉůĞƚĞĂƵĚŝƚƚƌĂŝůĂŶĚ ŵĂŝŶƚĂŝŶƐƚŚĞŵŝŶĂŶĞĂƐŝůLJƵƉĚĂƚĞĚďƵĚŐĞƚĂĚũƵƐƚŵĞŶƚĮůĞ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱ xůůŽǁƐLJŽƵƚŽĐŚĂŶŐĞƚŚĞƐƚĂƚƵƐ͕ĂŵŽƵŶƚ͕ŽƌĚĞƐĐƌŝƉƚŝŽŶŽĨĂŶLJŝƚĞŵĂŶĚƉƌŽǀŝĚĞƐĨŽŽƚƉƌŝŶƚĂŶĚ ĐŚĂŶŐĞŚŝƐƚŽƌLJĨĞĂƚƵƌĞƐƚŽĐƌĞĂƚĞĂŶĂƵĚŝƚƚƌĂŝůŽĨƚŚĞĐŚĂŶŐĞ ^ŵĂƌƚĞƌdžĐĞůZĞƉŽƌƚŝŶŐǁŝƚŚĞůů^ĞŶƐĞ ƌĞLJŽƵĐŽŶƐƚĂŶƚůLJƵƉĚĂƚŝŶŐDŝĐƌŽƐŽĨƚΠdžĐĞůΠƐƉƌĞĂĚƐŚĞĞƚƐǁŝƚŚLJŽƵƌĨŝŶĂŶĐŝĂůĚĂƚĂĞĂĐŚŵŽŶƚŚ͍/ŶĂŵĂƚƚĞƌ ŽĨƐĞĐŽŶĚƐ͕Ğůů^ĞŶƐĞĐĂŶĞĂƐŝůLJƚĂŬĞĐĂƌĞŽĨƚŚĂƚĨŽƌLJŽƵ͘^ŝŵƉůLJŵĂƉLJŽƵƌ'ĞŶĞƌĂů>ĞĚŐĞƌĚĂƚĂƚŽĂŶdžĐĞů ƐƉƌĞĂĚƐŚĞĞƚ͕ĂŶĚƚŚĞŶƌƵŶĞůů^ĞŶƐĞƚŽƉŽƉƵůĂƚĞƚŚĞǁŽƌŬƐŚĞĞƚ͘ƐĨŝŐƵƌĞƐĐŚĂŶŐĞ͕ĂĨĞǁĐůŝĐŬƐƉƌŽĚƵĐĞLJŽƵƌ ůĂƚĞƐƚŶƵŵďĞƌƐ͘>ŝƚƚůĞƚŽŶŽŵĂŝŶƚĞŶĂŶĐĞŝƐƌĞƋƵŝƌĞĚ͕ƐŽƐĂLJŐŽŽĚďLJĞƚŽĐƵƚƚŝŶŐ͕ƉĂƐƚŝŶŐĂŶĚŵĂŶƵĂůĚĂƚĂ ĞŶƚƌLJ͘tŝƚŚĂůŝƚƚůĞĞĨĨŽƌƚƵƉĨƌŽŶƚ͕LJŽƵĐĂŶŚĂƌŶĞƐƐƚŚĞƉŽǁĞƌŽĨ/ŶĐŽĚĞΠ&ŝŶĂŶĐŝĂůƐĂŶĚDŝĐƌŽƐŽĨƚdžĐĞůƚŽ ŵĂŬĞĂŶĞdžƉĞŶƐŝǀĞĂŶĚĚĂƵŶƚŝŶŐƚĂƐŬĞĐŽŶŽŵŝĐĂůĂŶĚĞĂƐLJƚŽƉĞƌĨŽƌŵ͘ xdžƚĞŶƐŝǀĞƚŝŵĞƐĂǀŝŶŐƐĨŽƌƚŚŽƐĞƌĞůLJŝŶŐŽŶdžĐĞůƚŽĂŶĂůLJnjĞĂŶĚƌĞƉŽƌƚŽŶĨŝŶĂŶĐŝĂůĚĂƚĂĨƌŽŵƚŚĞŝƌ 'ĞŶĞƌĂů>ĞĚŐĞƌ xůŝŵŝŶĂƚĞƐĞƌƌŽƌͲƉƌŽŶĞƚĂƐŬƐƐƵĐŚĂƐŽŶŐŽŝŶŐŵĂŶƵĂůĚĂƚĂĞŶƚƌLJĂŶĚŵĂŶŝƉƵůĂƚŝŽŶŝŶdžĐĞů xĂƐŝůLJŚĂŶĚůĞƐ'ĞŶĞƌĂů>ĞĚŐĞƌĂĐĐŽƵŶƚŐƌŽƵƉŝŶŐƐŵĂƉƉĞĚƚŽĂƐŝŶŐůĞĐĞůůĨŽƌƌŽůůŝŶŐƵƉĚĞƚĂŝůƚŽ ƐƵŵŵĂƌŝnjĞĚůĞǀĞůƐ xďŝůŝƚLJƚŽǀĂůŝĚĂƚĞƚŚĞĂĐĐƵƌĂĐLJŽĨƐƉƌĞĂĚƐŚĞĞƚĚĂƚĂƵƐŝŶŐĂŶĂƵĚŝƚƌĞƉŽƌƚƚŽĞůŝŵŝŶĂƚĞƐĞĂƌĐŚŝŶŐĨŽƌ ŝŶĐŽƌƌĞĐƚĨŽƌŵƵůĂƐ x^ĞĐƵƌĞƐĂĐĐĞƐƐƚŽĨŝŶĂŶĐŝĂůĚĂƚĂĨŽƌŵĂƉƉŝŶŐƚŽdžĐĞůƵƐŝŶŐ/ŶĐŽĚĞ'ĞŶĞƌĂů>ĞĚŐĞƌƐĞĐƵƌŝƚLJƐĞƚƚŝŶŐƐ xƌĞĂƚĞĂĞůů^ĞŶƐĞĞĨŝŶŝƚŝŽŶƚŽůŝŶŬLJŽƵƌ/ŶĐŽĚĞĨŝŶĂŶĐŝĂůŝŶĨŽƌŵĂƚŝŽŶ;ďƵĚŐĞƚĂƌLJĨŝŐƵƌĞƐ͕ĂĐƚƵĂů ƚƌĂŶƐĂĐƚŝŽŶƐ͕ĞŶĐƵŵďƌĂŶĐĞƐ͕ĞƚĐ͘ͿƚŽĂŶdžĐĞůǁŽƌŬŬ xDĂƉ'ĞŶĞƌĂů>ĞĚŐĞƌĂĐĐŽƵŶƚǀĂůƵĞƐ;ŵŽŶƚŚͲƚŽͲĚĂƚĞ͕LJĞĂƌͲƚŽͲĚĂƚĞĂŶĚƚŽƚĂůƐͿƚŽŝŶĚŝǀŝĚƵĂůǁŽƌŬƐŚĞĞƚƐ ĂŶĚĐĞůůƐŝŶdžĐĞů xhƐĞĂĐĐŽƵŶƚŽǀĞƌůĂLJƐƚŽĚĞĨŝŶĞĨŝůƚĞƌƐĂŶĚǁŝůĚĐĂƌĚƐĨŽƌĂĐĐŽƵŶƚŐƌŽƵƉŝŶŐƐŵĂƉƉĞĚƚŽĂƐƉĞĐŝĨŝĐĐĞůů ĂĚĚƌĞƐƐ /ŶĐŽĚĞĐĐŽƵŶƚƐZĞĐĞŝǀĂďůĞ zŽƵŵĂŶĂŐĞŚƵŶĚƌĞĚƐŽĨƚƌĂŶƐĂĐƚŝŽŶƐĂĚĂLJ͘zŽƵŶĞĞĚƚŽŽůƐƚŚĂƚĐĂŶŚĞůƉ LJŽƵĂĐĐƵƌĂƚĞůLJĂŶĚƋƵŝĐŬůLJŵĂŶĂŐĞLJŽƵƌĂŐĞŶĐLJ͛ƐĨŝŶĂŶĐĞƐ͕ĐŽůůĞĐƚŝŽŶƐ͕ ĐƵƐƚŽŵĞƌŝŶĨŽƌŵĂƚŝŽŶĂŶĚƌĞƉŽƌƚŝŶŐ͘dLJůĞƌ͛Ɛ/ŶĐŽĚĞΠĐĐŽƵŶƚƐZĞĐĞŝǀĂďůĞ ŵŽĚƵůĞŚĞůƉƐLJŽƵĂĐĐŽŵƉůŝƐŚŵŽƌĞǁŝƚŚĂŶŝŶƚĞŐƌĂƚĞĚƐLJƐƚĞŵƚŚĂƚƌĞĚƵĐĞƐ ĚĂƚĂĞŶƚƌLJ͕ŝŶĐƌĞĂƐĞƐĂĐĐƵƌĂĐLJĂŶĚĂŐĞŶĐLJͲǁŝĚĞĂĐĐĞƐƐƚŽŝŶĨŽƌŵĂƚŝŽŶ͕ĂŶĚ ƉƵƚƐLJŽƵŝŶĐŽŶƚƌŽůŽĨĨŽƌŵƐĂŶĚƌĞƉŽƌƚƐƚŚĂƚŚĞůƉLJŽƵĐůĞĂƌůLJĐŽŵŵƵŶŝĐĂƚĞ ǁŝƚŚĐƵƐƚŽŵĞƌƐĂŶĚǀĞŶĚŽƌƐ͘ŽŶƐŝĚĞƌŚŽǁƚŚŝƐdLJůĞƌƐŽůƵƚŝŽŶĐĂŶŚĞůƉLJŽƵ ǁŽƌŬƐŵĂƌƚĞƌǁŚĞŶŝƚĐŽŵĞƐƚŽŵĂŝŶƚĂŝŶŝŶŐLJŽƵƌĂŐĞŶĐLJ͛ƐĨŝŶĂŶĐĞƐ͘ ĂƐŝůLJŵĂŝŶƚĂŝŶǀĞŶĚŽƌĂŶĚĐƵƐƚŽŵĞƌŝŶĨŽƌŵĂƚŝŽŶ ŽŵƉƌĞŚĞŶƐŝǀĞĐƵƐƚŽŵĞƌŝŶĨŽƌŵĂƚŝŽŶƌĞĐŽƌĚƐ͕ŝŶĐůƵĚŝŶŐĨƵůůƚƌĂŶƐĂĐƚŝŽŶĂů ĂŶĚƉƵƌĐŚĂƐĞŚŝƐƚŽƌLJ͕ĂĨŝŶĂŶĐŝĂůƌĞĐĂƉĂŶĚƵƐĞƌͲĚĞĨŝŶĞĚĂƚƚƌŝďƵƚĞƐĂƌĞƐƚŽƌĞĚ ĐĞŶƚƌĂůůLJĂŶĚĐĂŶďĞƐŚĂƌĞĚĂĐƌŽƐƐŽƚŚĞƌ/ŶĐŽĚĞŵŽĚƵůĞƐ͘/ŶĐŽĚĞĐĐŽƵŶƚƐ ZĞĐĞŝǀĂďůĞĐĂŶĂůƐŽƵƐĞƚŚĂƚŝŶĨŽƌŵĂƚŝŽŶƚŽĞŵĂŝůŝŶǀŽŝĐĞƐ͕ĐƌĞĂƚĞĂŶĞdžƚƌĂĐƚ ĨŝůĞĨŽƌƚŚŝƌĚͲƉĂƌƚLJƉƌŝŶƚŝŶŐĂŶĚĐĞƌƚŝĨLJĂĚĚƌĞƐƐĞƐĨŽƌŵĂŝůŝŶŐŝŶǀŽŝĐĞƐŽƌ ĐŽƌƌĞƐƉŽŶĚĞŶĐĞ͘ ^ĞǀĞŶƌĞĂƐŽŶƐƚŽĐŽŶƐŝĚĞƌ /ŶĐŽĚĞĐĐŽƵŶƚƐZĞĐĞŝǀĂďůĞ ϭ͘ŐĞŶĐLJͲǁŝĚĞŝŶƚĞŐƌĂƚŝŽŶ Ϯ͘/ŶĐƌĞĂƐĞĚĂĐĐĞƐƐƚŽ ĐĞŶƚƌĂůůLJƐƚŽƌĞĚŝŶĨŽƌŵĂƚŝŽŶ ϯ͘>ĞƐƐĚĂƚĂĞŶƚƌLJĂŶĚ ƉŽƚĞŶƚŝĂůĞƌƌŽƌƐ ϰ͘ĨĨŝĐŝĞŶƚ͕ƉĞƌƐŽŶĂůŝnjĞĚ ĐŽŵŵƵŶŝĐĂƚŝŽŶǁŝƚŚ ĐƵƐƚŽŵĞƌƐĂŶĚǀĞŶĚŽƌƐ ϱ͘>ĞƐƐŝŶǀŽŝĐĞƉƌŽĐĞƐƐŝŶŐ ƚŝŵĞ ϲ͘ĞƚĂŝůĞĚĂŶĚƐƉĞĐŝĂůŝnjĞĚ ƌĞƉŽƌƚŝŶŐ ϳ͘ĞĐƌĞĂƐĞĚďƵƌĚĞŶŽĨĐĂƐŚ ĐŽůůĞĐƚŝŽŶƐ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲ ^ƚƌĞĂŵůŝŶĞŝŶǀŽŝĐĞƉƌŽĐĞƐƐŝŶŐ /ŶĐŽĚĞĐĐŽƵŶƚƐZĞĐĞŝǀĂďůĞŝƐĨƵůůŽĨĨƵŶĐƚŝŽŶĂůŝƚLJƚŚĂƚĐĂŶĚƌĂƐƚŝĐĂůůLJĐƵƚLJŽƵƌŝŶǀŽŝĐĞƉƌŽĐĞƐƐŝŶŐƚŝŵĞ͘ xŽŵďŝŶĞŵƵůƚŝƉůĞŝŶǀŽŝĐĞƐĂŶĚĞĂƐŝůLJĂĚũƵƐƚƉŽƐƚĞĚŝŶǀŽŝĐĞƐ xƌĞĂƚĞĂŶĚŵĂŶĂŐĞƌĞĐƵƌƌŝŶŐŝŶǀŽŝĐĞƐĨŽƌŝƚĞŵƐƐƵĐŚĂƐŵŽŶƚŚůLJƌĞŶƚŽƌĂŶŶƵĂůĐŚĂƌŐĞƐ xĐĐĞƐƐĂŶĚŵŽĚŝĨLJŵƵůƚŝƉůĞĂĐĐŽƵŶƚĚĞƚĂŝůƐĨƌŽŵƚŚĞĐĐŽƵŶƚDĂŶĂŐĞƌǀŝĞǁ dŽŽůƐƚŽŬĞĞƉĐĂƐŚĨůŽǁŝŶŐŝŶ tŚLJƐƚƌƵŐŐůĞǁŝƚŚĐĂƐŚŝĞƌŝŶŐǁŚĞŶƵƐĞƌͲĨƌŝĞŶĚůLJĨƵŶĐƚŝŽŶƐůŝŬĞƚŚĞƐĞĐĂŶĚŽƚŚĞǁŽƌŬĨŽƌLJŽƵ͍ xŶƐƵƌĞƉĂLJŵĞŶƚĐŽůůĞĐƚŝŽŶďLJƐĞƚƚŝŶŐĂůĞƌƚƐŽŶĂĐĐŽƵŶƚƐ xĐĐĞƉƚďĂŶŬĚƌĂĨƚƐĨŽƌĨĂƐƚĞƌƉĂLJŵĞŶƚƉƌŽĐĞƐƐŝŶŐ xƌĞĂƚĞĂŶĚƐĞŶĚŝŶǀŽŝĐĞƐĂŶĚůĞƚƚĞƌƐĞůĞĐƚƌŽŶŝĐĂůůLJĨŽƌŵŽƌĞĞĨĨŝĐŝĞŶƚĐŽůůĞĐƚŝŽŶƐ ŽŵƉƌĞŚĞŶƐŝǀĞƌĞƉŽƌƚŝŶŐƚĂŝůŽƌĞĚƚŽLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶ /ŶĐŽĚĞĐĐŽƵŶƚƐZĞĐĞŝǀĂďůĞŐŝǀĞƐLJŽƵĂĐĐĞƐƐƚŽĂůŝďƌĂƌLJŽĨƉƌĞĚĞƐŝŐŶĞĚĨŽƌŵƐŽƌLJŽƵĐĂŶĚĞƐŝŐŶLJŽƵƌŽǁŶ͕ ŝŶĐůƵĚŝŶŐŝŶǀŽŝĐĞƐ͕ƐƚĂƚĞŵĞŶƚƐŽƌůĞƚƚĞƌƐ͘ĞĐĂƵƐĞŝƚ͛ƐŝŶƚĞŐƌĂƚĞĚǁŝƚŚ/ŶĐŽĚĞ'ĞŶĞƌĂů>ĞĚŐĞƌ͕LJŽƵĐĂŶĂůƐŽ ĐƌĞĂƚĞĐŽŵƉƌĞŚĞŶƐŝǀĞƌĞƉŽƌƚƐƐƵĐŚĂƐĚĞƚĂŝůĞĚƌĞƉŽƌƚƐĨŽƌĂŐŝŶŐ͕ŐĞŶĞƌĂůůĞĚŐĞƌƌĞĐŽŶĐŝůŝĂƚŝŽŶŽƌƐƉĞĐŝĂůŝnjĞĚ ƌĞƉŽƌƚƐƵƐŝŶŐLJŽƵƌŽǁŶĐƌŝƚĞƌŝĂ͘ &ŝdžĞĚƐƐĞƚƐ dLJůĞƌ͛Ɛ/ŶĐŽĚĞ&ŝdžĞĚƐƐĞƚƐŝƐĂĐŽŵƉƌĞŚĞŶƐŝǀĞĂƐƐĞƚŵĂŶĂŐĞŵĞŶƚƐŽůƵƚŝŽŶĚĞƐŝŐŶĞĚƐƉĞĐŝĨŝĐĂůůLJĨŽƌƚŚĞƉƵďůŝĐ ƐĞĐƚŽƌ͘/ƚƉƌŽǀŝĚĞƐŽƌŐĂŶŝnjĂƚŝŽŶƐĂƉŽǁĞƌĨƵůƚŽŽůĨŽƌƚƌĂĐŬŝŶŐĂŶĚƌĞƉŽƌƚŝŶŐŽŶĂůůĨŝdžĞĚĂƐƐĞƚƐƚŚƌŽƵŐŚŽƵƚƚŚĞ ůŝĨĞĐLJĐůĞ͘ƐĂŶĂĚĚĞĚĐŽŶǀĞŶŝĞŶĐĞ͕ĂƐƐĞƚƐĂĐƋƵŝƌĞĚƚŚƌŽƵŐŚŽƚŚĞƌŝŶƚĞŐƌĂƚĞĚ/ŶĐŽĚĞ&ŝŶĂŶĐŝĂůŵŽĚƵůĞƐĐĂŶ ďĞĂƵƚŽŵĂƚŝĐĂůůLJƉŽƐƚĞĚƚŽ&ŝdžĞĚƐƐĞƚƐ͘dŚŝƐŵŽĚƵůĞƌĞĚƵĐĞƐĚƵƉůŝĐĂƚĞĚĂƚĂĞŶƚƌLJĂŶĚƐĞƚƐƚŚĞƐƚĂŶĚĂƌĚĨŽƌ ĐŽŵƉůĞƚĞĨŝŶĂŶĐŝĂůŝŶƚĞŐƌĂƚŝŽŶǁŝƚŚĂƵƚŽŵĂƚĞĚƚƌĂĐŬŝŶŐ͕ŵĂŶĂŐĞŵĞŶƚ͕ĂĐĐŽƵŶƚŝŶŐ͕ĂŶĚƌĞƉŽƌƚŝŶŐŽĨĂƐƐĞƚƐ͘ /ŶĨŽƌŵĂƚŝŽŶΘZĞƉŽƌƚƐ xdƌĂĐŬƐĂƐƐĞƚƐĨŽƌŵƵůƚŝƉůĞĨƵŶĚƐ͕ĚĞƉĂƌƚŵĞŶƚƐ͕ĂŶĚůŽĐĂƚŝŽŶƐ͘ xdƌĂĐŬƐĚĞƚĂŝůĞĚŝŶĨŽƌŵĂƚŝŽŶĨŽƌĂŶĂƐƐĞƚƐƵĐŚĂƐŝŶƐƵƌĂŶĐĞƉŽůŝĐŝĞƐ͕ĂĐƋƵŝƐŝƚŝŽŶĂŶĚĚŝƐƉŽƐŝƚŝŽŶĚĞƚĂŝůƐ͕ ĂŶĚŵĂŝŶƚĞŶĂŶĐĞͲƌĞůĂƚĞĚĚĞƚĂŝůƐƐƵĐŚĂƐĂƐƐĞƚĐŽŶĚŝƚŝŽŶ͕ǁĂƌƌĂŶƚLJ͕ƌĞƉĂŝƌƐ͕ĂŶĚŵĂŝŶƚĞŶĂŶĐĞ ĐŽŶƚƌĂĐƚƐ͘ xdƌĂĐŬƐŝŵƉƌŽǀĞŵĞŶƚƐŽƌĂĚĚŝƚŝŽŶƐƚŽĞdžŝƐƚŝŶŐĂƐƐĞƚƐ͘ xKĨĨĞƌƐ^ƚƌĂŝŐŚƚ>ŝŶĞŵĞƚŚŽĚĨŽƌĚĞƉƌĞĐŝĂƚŝŽŶƌĞƉŽƌƚŝŶŐ͘ x>ŝŶŬƐƐƉĞĐŝĨŝĞĚĂƐƐĞƚƐƚŽ/ŶĐŽĚĞtŽƌŬKƌĚĞƌƐĨŽƌƉƌĞǀĞŶƚĂƚŝǀĞŵĂŝŶƚĞŶĂŶĐĞ͘ xWƌŽǀŝĚĞƐĐŽŵƉƌĞŚĞŶƐŝǀĞĂƵĚŝƚĚĞƚĂŝůƌĞĐŽƌĚƐ͘ x'ĞŶĞƌĂƚĞƐĂƌĂŶŐĞŽĨŵĂƐƚĞƌĨŝůĞƌĞƉŽƌƚƐƚŚƌŽƵŐŚĨůĞdžŝďůĞƌĞƉŽƌƚŝŶŐ͘ xdžƉŽƌƚƐƌĞƉŽƌƚƌĞƐƵůƚƐƚŽŽƚŚĞƌĚĂƚĂĨŽƌŵĂƚƐŝŶĐůƵĚŝŶŐĚŽďĞW&͕DŝĐƌŽƐŽĨƚΠdžĐĞůĂŶĚtŽƌĚ͕ĂŶĚ dĞdžƚ͘ hƐĞƌ&ƌŝĞŶĚůLJ xWƌŽǀŝĚĞƐĞĨĨŝĐŝĞŶƚ͕ĐŽŵƉƌĞŚĞŶƐŝǀĞƐLJƐƚĞŵŝŶƚĞŐƌĂƚŝŽŶ͘ x'ŝǀĞƐƵƐĞƌƐƚŚĞĂďŝůŝƚLJƚŽƌĞǀŝĞǁĂŶĚĞǀĂůƵĂƚĞŝƚĞŵƐƉŽƐƚĞĚƚŽ&ŝdžĞĚƐƐĞƚ'ͬ>ĂĐĐŽƵŶƚƐŝŶĂ ƉƌĞůŝŵŝŶĂƌLJĂƐƐĞƚĨŝůĞƚŽĚĞƚĞƌŵŝŶĞƉƌŽƉĞƌĂĐĐŽƵŶƚŝŶŐƚƌĞĂƚŵĞŶƚ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳ xĞůŝǀĞƌƐĐŽĚĞͲĚƌŝǀĞŶŝŶĨŽƌŵĂƚŝŽŶƚƌĂĐŬŝŶŐĐĂƉĂďŝůŝƚŝĞƐ͕ĨŽƐƚĞƌŝŶŐĐŽŶƐŝƐƚĞŶĐLJŝŶĚĂƚĂĞŶƚƌLJĂŶĚŐƌĞĂƚĞƌ ĨůĞdžŝďŝůŝƚLJŝŶƌĞƉŽƌƚŐĞŶĞƌĂƚŝŽŶ͘ xĂƉƚƵƌĞƐŵƵůƚŝƉůĞƵƐĞƌͲĚĞĨŝŶĞĚĚĂƚĂĞůĞŵĞŶƚƐƚŚƌŽƵŐŚƵƐĞŽĨĐŽŵŵĞŶƚĐŽĚĞƐ͘ dƌĂŶƐĂĐƚŝŽŶĨĨŝĐŝĞŶĐLJ xDĂŶĂŐĞƐĂƐƐĞƚƐďLJƚŚĞŝƌŽƌŝŐŝŶĂůƐĞƌŝĂůŶƵŵďĞƌŽƌƵƐŝŶŐĂĚĞĨŝŶĞĚƚĂŐŶƵŵďĞƌ͘ xdƌĂĐŬƐŵƵůƚŝƉůĞƵƐĞƌͲĚĞĨŝŶĞĚĂƐƐĞƚĐůĂƐƐĞƐĂƵƚŽŵĂƚŝĐĂůůLJ͘ xƐƚĂďůŝƐŚĞƐƌĞůĂƚŝŽŶƐŚŝƉƐďĞƚǁĞĞŶŝŶĚŝǀŝĚƵĂůĂƐƐĞƚƌĞĐŽƌĚƐƵƐŝŶŐĂƐƐĞƚƚLJƉĞƐ͘ xƌĞĂƚĞƐĂŶĞǁĂƐƐĞƚďĂƐĞĚŽŶĂŶĞdžŝƐƚŝŶŐƌĞĐŽƌĚƵƐŝŶŐƚŚĞďƵŝůƚͲŝŶĐŽƉLJĨƵŶĐƚŝŽŶ͘ x'ŝǀĞƐƵƐĞƌƐŵƵůƚŝƉůĞŽƉƚŝŽŶƐĨŽƌƐĞůĞĐƚŝŶŐĂƐƐĞƚƐĨŽƌĚĞƉƌĞĐŝĂƚŝŽŶĐĂůĐƵůĂƚŝŽŶ͘ xZĞĐŽƌĚƐƚŚĞƚƌĂŶƐĨĞƌŽĨĂƐƐĞƚƐ͘dŚŝƐƉƌŽĐĞƐƐĂƵƚŽŵĂƚĞƐƚŚĞƚƌĂŶƐĨĞƌŽĨĂƐƐĞƚƐĨƌŽŵŽŶĞĨƵŶĚƚŽ ĂŶŽƚŚĞƌ͕ŝŶĐůƵĚŝŶŐƚŚĞĂƉƉƌŽƉƌŝĂƚĞƚƌĂŶƐĨĞƌŽĨ/ŶĐŽĚĞ'ĞŶĞƌĂů>ĞĚŐĞƌŝŶĨŽƌŵĂƚŝŽŶ͘ xƵƚŽŵĂƚĞƐƚŚĞĂƐƐĞƚĚŝƐƉŽƐĂůƉƌŽĐĞƐƐ͕ŝŶĐůƵĚŝŶŐĐĂůĐƵůĂƚŝŽŶŽĨŐĂŝŶŽƌůŽƐƐŽŶĂƐƐĞƚƐĂůĞƐ͕ĂŶĚĐƌĞĂƚĞƐ ĂůůŶĞĐĞƐƐĂƌLJƚƌĂŶƐĂĐƚŝŽŶƐƚŽƉƌŽƉĞƌůLJƌĞĐŽƌĚĂƐƐĞƚĚŝƐƉŽƐĂůŝŶƚŚĞ/ŶĐŽĚĞ'ĞŶĞƌĂů>ĞĚŐĞƌ͘ WƌŽũĞĐƚĐĐŽƵŶƚŝŶŐ dLJůĞƌ͛Ɛ/ŶĐŽĚĞWƌŽũĞĐƚĐĐŽƵŶƚŝŶŐĐĂŶďĞƵƐĞĚĨŽƌƚƌĂĐŬŝŶŐƉƌŽũĞĐƚƐ͕ũŽďƐ͕ĂŶĚŐƌĂŶƚƐ͕ŝŶĐůƵĚŝŶŐĂĐƚƵĂůĂĐƚŝǀŝƚLJ ĂŶĚďƵĚŐĞƚƚƌĂĐŬŝŶŐĂĐƌŽƐƐƵŶůŝŵŝƚĞĚĨŝƐĐĂůLJĞĂƌƐ͘dŚŝƐŵŽĚƵůĞŵĂŝŶƚĂŝŶƐŬĞLJƉƌŽũĞĐƚĚĞƚĂŝůƐƐƵĐŚĂƐƐƚĂƌƚ ĚĂƚĞ͕ĞŶĚĚĂƚĞ͕ƉĞƌĐĞŶƚĐŽŵƉůĞƚĞĚ͕ƉƌŽũĞĐƚĚĞƐĐƌŝƉƚŝŽŶ͕ĂŶĚŶŽƚĞƐ͘ĂĐŚƉƌŽũĞĐƚĐĂŶŚĂǀĞĂŶƵŶůŝŵŝƚĞĚ ŶƵŵďĞƌŽĨƉƌŽũĞĐƚĂĐĐŽƵŶƚƐƚŚĂƚĂůůŽǁƐĞĂĐŚƉƌŽũĞĐƚƚŽďĞƚĂŝůŽƌĞĚƚŽƐƉĞĐŝĨŝĐƉƌŽũĞĐƚƚƌĂĐŬŝŶŐĂŶĚƌĞƉŽƌƚŝŶŐ ƌĞƋƵŝƌĞŵĞŶƚƐ͘LJƉƌŽũĞĐƚ͕ƚŚĞďƵĚŐĞƚŝŶĨŽƌŵĂƚŝŽŶĐĂŶďĞĞŶƚĞƌĞĚĂƚƚŚĞƉƌŽũĞĐƚůĞǀĞůŽƌƚŚĞƉƌŽũĞĐƚĂĐĐŽƵŶƚ ůĞǀĞů͘ƵĚŐĞƚĐŚĞĐŬŝŶŐĐĂŶďĞĚĞĨŝŶĞĚĂƚƚŚĞƉƌŽũĞĐƚŽƌƉƌŽũĞĐƚĂĐĐŽƵŶƚůĞǀĞůĂƐŶĞĞĚĞĚ͘WƌŽũĞĐƚĐĐŽƵŶƚŝŶŐ ŽĨĨĞƌƐĐƌŽƐƐͲƐLJƐƚĞŵĨƵŶĐƚŝŽŶĂůŝƚLJǁŚĞŶŝŶƚĞŐƌĂƚĞĚǁŝƚŚ'ĞŶĞƌĂů>ĞĚŐĞƌ͕WƵƌĐŚĂƐŝŶŐ͕ĐĐŽƵŶƚƐWĂLJĂďůĞ͕ /ŶǀĞŶƚŽƌLJ͕WĂLJƌŽůů͕tŽƌŬKƌĚĞƌƐĂŶĚĂƐŚŝĞƌŝŶŐ͘ĐƚŝǀŝƚLJŝƐĂƵƚŽŵĂƚŝĐĂůůLJƉŽƐƚĞĚƚŽƉƌŽũĞĐƚĂĐĐŽƵŶƚƐĨƌŽŵ ƚŚĞƐĞŝŶƚĞŐƌĂƚĞĚŵŽĚƵůĞƐ͘ /ŶĨŽƌŵĂƚŝŽŶΘZĞƉŽƌƚƐ xƐƚĂďůŝƐŚĞƐƵƐĞƌͲĚĞĨŝŶĞĚůŝŶĞŝƚĞŵƐĂŶĚĐĂƚĞŐŽƌŝĞƐĨŽƌĞĂĐŚƉƌŽũĞĐƚĂŶĚĂƐƐŽĐŝĂƚĞƐŵƵůƚŝƉůĞƉƌŽũĞĐƚƐ ǁŝƚŚĂŵĂƐƚĞƌƉƌŽũĞĐƚ͕ƚŚĞƌĞďLJƉƌŽǀŝĚŝŶŐŵĂŶLJůĞǀĞůƐĨŽƌƚƌĂĐŬŝŶŐĂŶĚƌĞƉŽƌƚŝŶŐ͘ xWƌŽǀŝĚĞƐƋƵŝĐŬĂĐĐĞƐƐƚŽĚĞƚĂŝůĞĚŚŝƐƚŽƌŝĐĂůŝŶĨŽƌŵĂƚŝŽŶĂŶĚŽĨĨĞƌƐĚLJŶĂŵŝĐƐĐƌĞĞŶĐŽŶĨŝŐƵƌĂƚŝŽŶƐǁŝƚŚ ƉƌŝŶƚŝŶŐĂŶĚĞdžƉŽƌƚŝŶŐĐĂƉĂďŝůŝƚŝĞƐ͘ xWƌŽĚƵĐĞƐƉƌŽũĞĐƚƌĞƉŽƌƚƐǁŝƚŚŐĞŶĞƌĂůŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚĞĂĐŚƉƌŽũĞĐƚƐƵĐŚĂƐĨŝƐĐĂůLJĞĂƌ͕ƐƚĂƌƚͬƐƚŽƉ ĚĂƚĞƐ͕ƉƌŽũĞĐƚƐƚĂƚƵƐ͕ĂŶĚďƵĚŐĞƚƐĨŽƌĞĂĐŚƉƌŽũĞĐƚůŝŶĞŝƚĞŵ͘ x'ĞŶĞƌĂƚĞƐďƵĚŐĞƚĐŽŵƉĂƌŝƐŽŶƌĞƉŽƌƚƐƚŚĂƚƐƵŵŵĂƌŝnjĞďƵĚŐĞƚĂŶĚĂĐƚƵĂůĞdžƉĞŶĚŝƚƵƌĞƐďLJůŝŶĞŝƚĞŵ ĨŽƌĞĂĐŚĨŝƐĐĂůLJĞĂƌ͘ xWƌŝŶƚƐĚĞƚĂŝůƌĞƉŽƌƚƐŽĨĞĂĐŚƚƌĂŶƐĂĐƚŝŽŶƉŽƐƚĞĚǁŝƚŚŝŶĂƐĞůĞĐƚĞĚƌĂŶŐĞŽĨĚĂƚĞƐ͕ŝŶĐůƵĚŝŶŐďŽƚŚĂĐƚƵĂů ĂŶĚĞŶĐƵŵďĞƌĞĚĂŵŽƵŶƚƐ͘ xWƌŽǀŝĚĞƐƐŝŵƉůĞƵĚŐĞƚ^ƵŵŵĂƌLJŝŶĨŽƌŵĂƚŝŽŶƐƵĐŚĂƐĐƚƵĂůƵĚŐĞƚ͕ƵĚŐĞƚZĞŵĂŝŶŝŶŐĂŶĚƉŽƐƚĞĚ ĂĐƚŝǀŝƚLJ͕ĞŶĐƵŵďƌĂŶĐĞƐĂŶĚƌĞƐĞƌǀĞƐ͘ hƐĞƌ&ƌŝĞŶĚůLJ xĂƐŝůLJŵĂŶĂŐĞďƵĚŐĞƚĂŶĚƚƌĂĐŬďƵĚŐĞƚĂĚũƵƐƚŵĞŶƚƐŽŶƉƌŽũĞĐƚĂĐĐŽƵŶƚƐ͘ xYƵŝĐŬƉƌŽũĞĐƚůŽŽŬƵƉǁŝƚŚĨŝůƚĞƌƐŽŶŵĂƐƚĞƌƉƌŽũĞĐƚĂŶĚƉƌŽũĞĐƚƐƚĂƚƵƐ͘ x&ůĞdžŝďůĞĚĞƐŝŐŶĞŶĂďůĞƐƵƐĞƌƐƚŽĚĞĨŝŶĞƉƌŽũĞĐƚƐƚƌƵĐƚƵƌĞƉĞƌƐƉĞĐŝĨŝĐƉƌŽũĞĐƚƚƌĂĐŬŝŶŐĂŶĚƌĞƉŽƌƚŝŶŐ ƌĞƋƵŝƌĞŵĞŶƚƐ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴ xhƐĞƌƐĐĂŶĂĐĐĞƐƐƚŚĞƐƵƉƉŽƌƚtĞďƐŝƚĞĞĂƐŝůLJƚŽůŽŐƐƵƉƉŽƌƚƌĞƋƵĞƐƚƐ͕ƋƵĞƌLJƚŚĞŬŶŽǁůĞĚŐĞďĂƐĞ͕ ƉĂƌƚŝĐŝƉĂƚĞŝŶƵƐĞƌŐƌŽƵƉĚŝƐĐƵƐƐŝŽŶƐ͕ĂŶĚĚŽǁŶůŽĂĚƵƉĚĂƚĞƐǀŝĂƐĞĐƵƌĞĐŽŶŶĞĐƚŝŽŶƐ͘ dƌĂŶƐĂĐƚŝŽŶĨĨŝĐŝĞŶĐLJ x'>ĐĐŽƵŶƚƐĐĂŶďĞƐĞƚƵƉƚŽĂůƐŽƉŽƐƚĚŝƌĞĐƚůLJƚŽWƌŽũĞĐƚĐĐŽƵŶƚƐ͕ĞůŝŵŝŶĂƚŝŶŐƚŚĞŶĞĞĚĨŽƌĂĚĚŝŶŐ ƉƌŽũĞĐƚĨŽƌŵĂƚƚŝŶŐƚŽƚŚĞ'>ĂĐĐŽƵŶƚƐƚƌƵĐƚƵƌĞ͘ xWƌŽũĞĐƚKǀĞƌǀŝĞǁĚŝƐƉůĂLJƐĂƵĚŐĞƚ^ƵŵŵĂƌLJǁŝƚŚƉŽƐƚĞĚƚŽƚĂůZĞǀĞŶƵĞƐĂŶĚdžƉĞŶƐĞƐĂƉƉůŝĞĚƚŽƚŚĞ ƉƌŽũĞĐƚ͕ĂŶĚƐŚŽǁƐƚŚĞĐƚƵĂůƵĚŐĞƚǁŝƚŚĂďƌĞĂŬĚŽǁŶŽĨĂĐƚŝǀŝƚLJ͕ĞŶĐƵŵďƌĂŶĐĞƐĂŶĚƌĞƐĞƌǀĞƐ͕ĂŶĚ ĚŝƐƉůĂLJƐƚŚĞƵĚŐĞƚZĞŵĂŝŶŝŶŐŝŶĚŽůůĂƌƐĂŶĚƉĞƌĐĞŶƚ͘ xWƌŽǀŝĚĞƐĚĞƚĂŝůĞĚƚƌĂŶƐĂĐƚŝŽŶŚŝƐƚŽƌLJŽŶďŽƚŚƚŚĞWƌŽũĞĐƚĂŶĚWƌŽũĞĐƚĐĐŽƵŶƚůĞǀĞůƐ͘ xWƌŽǀŝĚĞƐĂƋƵŝĐŬͲǀŝĞǁŽĨĂůůƉĞŶĚŝŶŐĂĐƚŝǀŝƚLJŽŶĂWƌŽũĞĐƚ͘ xdƌĂĐŬƐƉƌŽũĞĐƚƉƌŽŐƌĞƐƐďLJƉĞƌĐĞŶƚŽĨƉƌŽũĞĐƚĐŽŵƉůĞƚŝŽŶ͘ xůůŽǁƐĞĂƐLJĞŶƚƌLJŽĨŶŽƚĞƐŽŶƉƌŽũĞĐƚƐĂŶĚƉƌŽũĞĐƚĂĐĐŽƵŶƚƐ͘ xWƌŽǀŝĚĞƐĂĐĐĞƐƐƚŽĚĞƚĂŝůĞĚŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚĨƵŶĚŝŶŐĨŽƌƉƌŽũĞĐƚƐ;Ğ͘Ő͕͘ĨƵŶĚŝŶŐƐŽƵƌĐĞƐ͕ĐŽŶƚƌĂĐƚƐ͕ ŐƌĂŶƚƐͿ͘ xWƌŽǀŝĚĞƐKǀĞƌŚĞĂĚƵƌĚĞŶĐĂůĐƵůĂƚŝŽŶ͘ xWƌŽǀŝĚĞƐWƌŽũĞĐƚůĞǀĞůŽƌWƌŽũĞĐƚĐĐŽƵŶƚůĞǀĞůďƵĚŐĞƚĐŚĞĐŬŝŶŐ͘ WƵƌĐŚĂƐŝŶŐ dLJůĞƌ͛Ɛ/ŶĐŽĚĞϭϬWƵƌĐŚĂƐŝŶŐŵĂŶĂŐĞƐƌĞƋƵĞƐƚŝŶŐ͕ŽƌĚĞƌŝŶŐ͕ĂƉƉƌŽǀŝŶŐ͕ŝŶǀŽŝĐŝŶŐĂŶĚƌĞƉŽƌƚŝŶŐŽĨŐŽŽĚƐĂŶĚ ƐĞƌǀŝĐĞƐ͘/ƚƐĨůĞdžŝďŝůŝƚLJĂůůŽǁƐĂƉƉƌŽǀĂůǁŽƌŬĨůŽǁƐƚŚĂƚŵĞĞƚƚŚĞŶĞĞĚƐŽĨLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶ͘/ƚƉƌŽǀŝĚĞƐĞĂƐLJ ĂĐĐĞƐƐƚŽǀĞŶĚŽƌĚĂƚĂĂŶĚŝŶǀŽŝĐĞŚŝƐƚŽƌLJĂŶĚƉƌŽǀŝĚĞƐƚŚĞĂďŝůŝƚLJƚŽĚŝƌĞĐƚůLJĞŵĂŝůƉƵƌĐŚĂƐĞŽƌĚĞƌƐƚŽǀĞŶĚŽƌƐ ĂŶĚŝŶƚĞƌŶĂůƐƚĂĨĨ͘WƵƌĐŚĂƐŝŶŐŝŶƚĞƌĨĂĐĞƐǁŝƚŚ/ŶĐŽĚĞϭϬ'ĞŶĞƌĂů>ĞĚŐĞƌ͕ĐĐŽƵŶƚƐWĂLJĂďůĞ͕WƌŽũĞĐƚ ĐĐŽƵŶƚŝŶŐĂŶĚ/ŶǀĞŶƚŽƌLJ͘ /ŶĨŽƌŵĂƚŝŽŶΘZĞƉŽƌƚƐ xďŝůŝƚLJƚŽƚƌĂŶƐĨĞƌŝƚĞŵƐŽŶĂƐŝŶŐůĞZĞƋƵŝƐŝƚŝŽŶƚŽĂŶŽƚŚĞƌŶĞǁ͕ƐĞƉĂƌĂƚĞƌĞƋƵŝƐŝƚŝŽŶĨŽƌĐƌĞĂƚŝŶŐĂ ƐĞƉĂƌĂƚĞƉƵƌĐŚĂƐĞŽƌĚĞƌĨŽƌƚŚŽƐĞŝƚĞŵƐƚŚĂƚŵĂLJďĞƉƵƌĐŚĂƐĞĚĨƌŽŵĂƐĞƉĂƌĂƚĞǀĞŶĚŽƌ͘ x/ŶƚĞŐƌĂƚĞƐĐŽŵŵŽĚŝƚLJĐŽĚĞƐǁŝƚŚĞĂĐŚŝƚĞŵ͘ x'ĞŶĞƌĂƚĞƐŵƵůƚŝƉůĞƐƚĂŶĚĂƌĚƌĞƉŽƌƚƐďĂƐĞĚŽŶƵƐĞƌͲĚĞĨŝŶĞĚƉĂƌĂŵĞƚĞƌƐ͗ZĞƋƵŝƐŝƚŝŽŶ^ƵŵŵĂƌLJ ZĞƉŽƌƚ͕ZĞƋƵŝƐŝƚŝŽŶƵĚŝƚ͕ZĞƋƵŝƐŝƚŝŽŶƉƉƌŽǀĂůZĞƉŽƌƚ͕WK^ƚĂƚƵƐZĞƉŽƌƚƐKĨ͕WKZĞĐĞŝƉƚZĞŐŝƐƚĞƌ͕ WKŐŝŶŐZĞƉŽƌƚ͕WKĐƚŝǀŝƚLJZĞƉŽƌƚĂŶĚŶĐƵŵďƌĂŶĐĞΘZĞƐĞƌǀĞZĞƉŽƌƚƐ͘ xĂůĐƵůĂƚĞƐ͕ƚƌĂĐŬƐĂŶĚƌĞƉŽƌƚƐƐĂůĞƐƚĂdžŽŶƚĂdžĂďůĞŐŽŽĚƐĂŶĚƐĞƌǀŝĐĞƐ͕ǁŝƚŚƚŚĞŽƉƚŝŽŶƚŽŝŶĐůƵĚĞ ƐŚŝƉƉŝŶŐĐŽƐƚƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞƉƵƌĐŚĂƐĞ͘ xKĨĨĞƌƐĚƌŝůůͲĚŽǁŶŽŶŝŶǀĞŶƚŽƌLJƉĂƌƚƐĚƵƌŝŶŐƚŚĞƌĞƋƵŝƐŝƚŝŽŶƉƌŽĐĞƐƐƐŽŝŶǀĞŶƚŽƌLJƋƵĂŶƚŝƚŝĞƐŽŶŽƌĚĞƌ ĂŶĚĂůƌĞĂĚLJƌĞƋƵŝƐŝƚŝŽŶĞĚĐĂŶďĞǀŝĞǁĞĚ͘ xWƌŽǀŝĚĞƐďƵĚŐĞƚĐŚĞĐŬŝŶŐĂƚƚŚĞŝŶĚŝǀŝĚƵĂůĂĐĐŽƵŶƚŽƌŐƌŽƵƉďƵĚŐĞƚƐĞŐŵĞŶƚůĞǀĞůĚƵƌŝŶŐƌĞƋƵŝƐŝƚŝŽŶ ŝŶƉƵƚǁŝƚŚŽǀĞƌƌŝĚĞĐĂƉĂďŝůŝƚŝĞƐ͘ xdžƉŽƌƚƐƌĞƉŽƌƚƌĞƐƵůƚƐƚŽŽƚŚĞƌĚĂƚĂĨŽƌŵĂƚƐŝŶĐůƵĚŝŶŐĚŽďĞW&͕DŝĐƌŽƐŽĨƚΠdžĐĞůĂŶĚtŽƌĚ͕ĂŶĚ dĞdžƚ͘ xWƌŽǀŝĚĞƐƚŚĞĂďŝůŝƚLJƚŽǀŝĞǁŝĚͬYƵŽƚĞƐĂƐƐŽĐŝĂƚĞĚƚŽĂZĞƋƵŝƐŝƚŝŽŶŽŶƚŚĞZĞƋƵŝƐŝƚŝŽŶ^ƵŵŵĂƌLJ ZĞƉŽƌƚ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵ hƐĞƌ&ƌŝĞŶĚůLJ xĐĐŽŵŵŽĚĂƚĞƐĐŚĂŶŐĞƐĂĨƚĞƌĐƌĞĂƚŝŽŶŽĨĂƉƵƌĐŚĂƐĞŽƌĚĞƌǁŝƚŚƚŚĞWƵƌĐŚĂƐĞKƌĚĞƌĐŚĂŶŐĞƉƌŽĐĞƐƐ ĂŶĚĐĂƉƚƵƌĞƐĐŽŵƉůĞƚĞĂƵĚŝƚƚƌĂŝůŽĨĐŚĂŶŐĞƐ͘ x^LJƐƚĞŵƐĞĐƵƌŝƚLJŝƐĨůĞdžŝďůĞ͕ĂůůŽǁŝŶŐĨŽƌƵƐĞƌͲĚĞĨŝŶĞĚƌĞƐƚƌŝĐƚŝŽŶƐƚŽǀĂƌŝŽƵƐĨĞĂƚƵƌĞƐƐƵĐŚĂƐĂĚĚ͕ĞĚŝƚ͕ ǀŝĞǁ͕ĚĞůĞƚĞĐĂƉĂďŝůŝƚŝĞƐ͕ĚĞƉĂƌƚŵĞŶƚůĞǀĞůƐĞĐƵƌŝƚLJ͕ƌĞƋƵŝƐŝƚŝŽŶĂƉƉƌŽǀĂůƐ͕ĞƚĂů͘ xhƐĞƌƐĐĂŶƐĞĂƌĐŚƌĞƋƵŝƐŝƚŝŽŶƐĂŶĚƉƵƌĐŚĂƐĞŽƌĚĞƌƐƚŽŝŶƋƵŝƌĞŽĨƚŚĞŝƌƐƚĂƚƵƐ͘ xdŚĞƌĞƋƵŝƐŝƚŝŽŶƐLJƐƚĞŵŝŶƚĞƌĨĂĐĞƐǁŝƚŚDŝĐƌŽƐŽĨƚdžĐŚĂŶŐĞĨŽƌĞŵĂŝůŶŽƚŝĨŝĐĂƚŝŽŶĚƵƌŝŶŐƚŚĞ ƌĞƋƵŝƐŝƚŝŽŶĂƉƉƌŽǀĂůƉƌŽĐĞƐƐ͘ xƚƚĂĐŚĞƐĂŶĚŽƌŐĂŶŝnjĞƐĚŽĐƵŵĞŶƚƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞƉƌŽĐƵƌĞŵĞŶƚĨƵŶĐƚŝŽŶĨŽƌƋƵŝĐŬƌĞƚƌŝĞǀĂů ƚŚƌŽƵŐŚŝŶƚĞŐƌĂƚŝŽŶǁŝƚŚĚŽĐƵŵĞŶƚŵĂŶĂŐĞŵĞŶƚƐŽĨƚǁĂƌĞ͘ dƌĂŶƐĂĐƚŝŽŶĨĨŝĐŝĞŶĐLJ xhƚŝůŝnjĞƐǀĞŶĚŽƌƚĞŵƉůĂƚĞƐĨŽƌƌĞĐƵƌƌŝŶŐŽƌĚĞƌƐƚŽƋƵŝĐŬůLJůŽĂĚĚĞƚĂŝůƐĚƵƌŝŶŐƌĞƋƵŝƐŝƚŝŽŶŝŶƉƵƚ͘ xƉƉƌŽǀĂůǁŽƌŬĨůŽǁƐĐĂŶďĞĐŽŶĨŝŐƵƌĞĚŽŶǀĂƌŝŽƵƐĂƐƉĞĐƚƐŽĨƚŚĞƌĞƋƵŝƐŝƚŝŽŶ͕ŝŶĐůƵĚŝŶŐĚĞƉĂƌƚŵĞŶƚ͕'> ĂĐĐŽƵŶƚ͕ĐŽŵŵŽĚŝƚLJĐŽĚĞĂŶĚƉƌŽũĞĐƚĂĐĐŽƵŶƚ͘ x/ŶƚĞŐƌĂƚĞƐǁŝƚŚ/ŶĐŽĚĞϭϬ/ŶǀĞŶƚŽƌLJƚŽĂƵƚŽŵĂƚŝĐĂůůLJƵƉĚĂƚĞŝƚĞŵƐŽŶŽƌĚĞƌ͕ŽŶͲŚĂŶĚĐŚĂŶŐĞƐŝŶƚŚĞ ƵŶŝƚ͛ƐƋƵĂŶƚŝƚLJ͕ĂŶĚƉƌŝĐĞŝŶĨŽƌŵĂƚŝŽŶĂƚƚŚĞĂƉƉƌŽƉƌŝĂƚĞƐƚĞƉƐŝŶƚŚĞŽƌĚĞƌŝŶŐĂŶĚƌĞĐĞŝƉƚƉƌŽĐĞƐƐĞƐ͘ xdƌĂĐŬƐƉƌŽũĞĐƚĞdžƉĞŶƐĞƐƌĞůĂƚĞĚƚŽƉƵƌĐŚĂƐĞƐƚŚƌŽƵŐŚŝŶƚĞŐƌĂƚŝŽŶǁŝƚŚƚŚĞWƌŽũĞĐƚĐĐŽƵŶƚŝŶŐ ŵŽĚƵůĞ͘ xĞƚĞƌŵŝŶĞƐĂŶĚĂĐĐŽƵŶƚƐĨŽƌǀĂƌŝĂŶĐĞƐďĞƚǁĞĞŶƉƵƌĐŚĂƐĞŽƌĚĞƌƐĂŶĚŝŶǀŽŝĐĞƐƌĞĐĞŝǀĞĚ͘ x^ƵƉƉŽƌƚƐŵƵůƚŝƉůĞǀĞŶĚŽƌƐĞƚƐĨŽƌƐĞƉĂƌĂƚĞƚĂdžƉĂLJĞƌ/ŶƵŵďĞƌƐ͘ xWƌŽǀŝĚĞƐĐŽŵƉůĞƚĞĞŶĐƵŵďƌĂŶĐĞĂĐĐŽƵŶƚŝŶŐŝŶĐůƵĚŝŶŐƉĂƌƚŝĂůŽƌĨƵůůůŝƋƵŝĚĂƚŝŽŶŽĨĞŶĐƵŵďƌĂŶĐĞƐ͘ xZĞƋƵŝƐŝƚŝŽŶƐŐĞŶĞƌĂƚĞƉƌĞͲĞŶĐƵŵďƌĂŶĐĞƐƚŽďĞƵƐĞĚĂƐƉĂƌƚŽĨƚŚĞďƵĚŐĞƚĐŚĞĐŬŝŶŐĨĞĂƚƵƌĞ͘ xWƌŽǀŝĚĞƐƐĂůĞƐƚĂdžƐƉůŝƚĚŝƐƚƌŝďƵƚŝŽŶƐƚŽŵƵůƚŝƉůĞƐĞƉĂƌĂƚĞ'ĞŶĞƌĂů>ĞĚŐĞƌĂŶĚͬŽƌWƌŽũĞĐƚĂĐĐŽƵŶƚƐ͘ xWƌŽǀŝĚĞƐĂďŝůŝƚLJƚŽƚƌĂĐŬĂŶĚŵĂŶĂŐĞŝĚƐĂŶĚYƵŽƚĞƐĨƌŽŵŵƵůƚŝƉůĞǀĞŶĚŽƌƐŽŶZĞƋƵŝƐŝƚŝŽŶƐĂŶĚ ŝĚĞŶƚŝĨLJǁŚŝĐŚďŝĚǁĂƐĂǁĂƌĚĞĚƚŚĞƉƵƌĐŚĂƐĞ͘ xWƌŽǀŝĚĞƐĂŶĂůLJƐŝƐŽĨŽƉĞŶ͕ĐůŽƐĞĚ͕ŽƌǀŽŝĚĞĚWKƐĂƐǁĞůůĂƐƉƌŝŶƚŝŶŐŽƌƌĞƉƌŝŶƚŝŶŐŽĨWKĨŽƌŵƐ͘ xWƌŽǀŝĚĞƐĂďŝůŝƚLJƚŽƌŽůůƉƵƌĐŚĂƐĞŽƌĚĞƌƐĨŽƌǁĂƌĚƚŽƚŚĞŶĞdžƚĨŝƐĐĂůLJĞĂƌĂŶĚƌĞĚŝƐƚƌŝďƵƚĞĞŶĐƵŵďƌĂŶĐĞƐ ĂĐĐŽƌĚŝŶŐůLJ͘ ĞŶƚƌĂůŝnjĞĚĂƐŚŽůůĞĐƚŝŽŶƐ dLJůĞƌ͛Ɛ/ŶĐŽĚĞĞŶƚƌĂůĂƐŚŽůůĞĐƚŝŽŶƐŽĨĨĞƌƐĨƵůůĐĂƐŚŝĞƌŝŶŐĨƵŶĐƚŝŽŶĂůŝƚLJǁŝƚŚĐŽŶŶĞĐƚĞĚĐĂƐŚŝĞƌǁŽƌŬƐƚĂƚŝŽŶƐ ĞƋƵŝƉƉĞĚǁŝƚŚĂĚĞĚŝĐĂƚĞĚƌĞĐĞŝƉƚͬǀĂůŝĚĂƚŝŽŶƉƌŝŶƚĞƌ͕ĂƵƚŽŵĂƚĞĚĐĂƐŚĚƌĂǁĞƌ͕ĂŶĚĂŶŽƉƚŝŽŶĂůďĂƌĐŽĚĞ ƐĐĂŶŶĞƌ͘ĞŶƚƌĂůĂƐŚŽůůĞĐƚŝŽŶƐŝŶƚĞƌĨĂĐĞƐǁŝƚŚĂůůŽĨƚŚĞŽƚŚĞƌ/ŶĐŽĚĞƵƐƚŽŵĞƌZĞůĂƚŝŽŶƐŚŝƉDĂŶĂŐĞŵĞŶƚ ĂƉƉůŝĐĂƚŝŽŶƐ͕hƚŝůŝƚLJ/^͕ŽƵƌƚĂƐĞDĂŶĂŐĞŵĞŶƚ͕ĂŶĚƚŚĞ'ĞŶĞƌĂů>ĞĚŐĞƌ͘dŚŝƐĂƉƉůŝĐĂƚŝŽŶƉƌŽǀŝĚĞƐĂ ƐĞĂŵůĞƐƐĂŶĚƵŶŝĨŽƌŵŝŶƚĞƌĨĂĐĞƌĞŐĂƌĚůĞƐƐŽĨƚŚĞƚLJƉĞŽĨƉĂLJŵĞŶƚƚŚĂƚŝƐƌĞĐĞŝǀĞĚ͘/ŶĂĚĚŝƚŝŽŶ͕ŝƚƉƌŽǀŝĚĞƐĨŽƌ ĞĂƐLJůŽŽŬƵƉĂŶĚǀĂůŝĚĂƚŝŽŶŽĨĐƵƐƚŽŵĞƌĂĐĐŽƵŶƚŶĂŵĞĂŶĚŶƵŵďĞƌ͘DŝƐĐĞůůĂŶĞŽƵƐƉĂLJŵĞŶƚƐŶŽƚĂƐƐŽĐŝĂƚĞĚ ǁŝƚŚĂĐĐŽƵŶƚƐŝŶŝŶƚĞŐƌĂƚĞĚƐLJƐƚĞŵƐƉŽƐƚĚŝƌĞĐƚůLJƚŽƚŚĞ'ĞŶĞƌĂů>ĞĚŐĞƌ͘ ĂƐŚŽůůĞĐƚŝŽŶƐƐƵƉƉŽƌƚƐƉĂLJŵĞŶƚƐŵĂĚĞďLJĐƌĞĚŝƚĐĂƌĚƐǁŝƚŚŽŶůŝŶĞĐƌĞĚŝƚĐĂƌĚƉƌŽĐĞƐƐŝŶŐ͘dLJůĞƌƉƌŽǀŝĚĞƐ ƚŚŝƐĨƵŶĐƚŝŽŶĂůŝƚLJƚŚƌŽƵŐŚĂŶŝŶƚĞƌĨĂĐĞǁŝƚŚůĞĐƚƌŽŶŝĐdƌĂŶƐĂĐƚŝŽŶ^LJƐƚĞŵƐŽƌƉŽƌĂƚŝŽŶ;d^Ϳ͘ƌĞĚŝƚĐĂƌĚ ƌĞĂĚŝŶŐĞƋƵŝƉŵĞŶƚŝƐĐŽŶŶĞĐƚĞĚƚŽƚŚĞĂƐŚŽůůĞĐƚŝŽŶǁŽƌŬƐƚĂƚŝŽŶƐŽƚŚĂƚĚĂƚĂĐĂƉƚƵƌĞĚĨƌŽŵĐĂƌĚƐǁŝƉĞƐ ŵĂLJďĞƚƌĂŶƐŵŝƚƚĞĚƚŽd^ƚŚƌŽƵŐŚĂŶ/ŶƚĞƌŶĞƚĐŽŶŶĞĐƚŝŽŶ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬ hƐĞƌƐĂůƐŽŚĂǀĞƚŚĞŽƉƚŝŽŶƚŽĞŶƚĞƌĐƌĞĚŝƚĐĂƌĚŝŶĨŽƌŵĂƚŝŽŶŝŶƚŽƚŚĞĂƐŚŽůůĞĐƚŝŽŶŵŽĚƵůĞďĞĨŽƌĞƚŚĞ ƚƌĂŶƐĂĐƚŝŽŶŝƐƐƵďŵŝƚƚĞĚƚŽd^ĨŽƌĂƵƚŚŽƌŝnjĂƚŝŽŶĂŶĚƉƌŽĐĞƐƐŝŶŐ͘dŚĞƵƐƚŽŵĞƌǁŽƵůĚŶĞĞĚƚŽĞƐƚĂďůŝƐŚĂ ŵĞƌĐŚĂŶƚĂĐĐŽƵŶƚǁŝƚŚd^ĂŶĚƉƌŽǀŝĚĞƚŚĞŵǁŝƚŚďĂŶŬĂĐĐŽƵŶƚŝŶĨŽƌŵĂƚŝŽŶĨŽƌƚƌĂŶƐĂĐƚŝŽŶƐƚŽĨůŽǁ ƚŚƌŽƵŐŚ͘ /ŶĨŽƌŵĂƚŝŽŶΘZĞƉŽƌƚƐ xWƌŽǀŝĚĞƐĂƵƚŽŵĂƚŝĐƌĞĂůͲƚŝŵĞŝŶƋƵŝƌLJŽŶƐLJƐƚĞŵ͕ŽƉĞƌĂƚŽƌ͕ĂŶĚƚĞƌŵŝŶĂůƐƚĂƚƵƐĞƐ xůůŽǁƐƵƐĞƌͲĚĞĨŝŶĞĚƉĂLJŵĞŶƚƚLJƉĞƐŝŶĐůƵĚŝŶŐ͕ďƵƚŶŽƚůŝŵŝƚĞĚƚŽ͕ĐĂƐŚ͕ĐŚĞĐŬƐ͕ĂŶĚĂŶLJƚLJƉĞŽĨĐƌĞĚŝƚ ĐĂƌĚ x&ĂĐŝůŝƚĂƚĞƐďĂŶŬĂĐĐŽƵŶƚďĂůĂŶĐŝŶŐƵƐŝŶŐƌĞĐŽŶĐŝůŝĂƚŝŽŶŐƌŽƵƉƐ x'ĞŶĞƌĂƚĞƐĂƐƵŵŵĂƌLJŽĨĂůůƌĞĐĞŝƉƚƐƉƌŽĐĞƐƐĞĚĂƚĂŶLJƚŝŵĞ x^ĂǀĞƐĨŽƌŵĂƚƐĞƚƚŝŶŐƐĂƐƵƐĞƌͲĚĞĨŝŶĞĚƌĞƉŽƌƚŝŶŐƉƌŽĨŝůĞƐ xWƌŽĚƵĐĞƐŽŶͲĚĞŵĂŶĚŵĂŶĂŐĞŵĞŶƚƌĞƉŽƌƚƐƐƵĐŚĂƐũŽƵƌŶĂů͕ŚŝƐƚŽƌLJƚƌĂŶƐĂĐƚŝŽŶ͕ĂŶĚƉĂLJŵĞŶƚƚLJƉĞ ƌĞƉŽƌƚƐ hƐĞƌ&ƌŝĞŶĚůLJ xůůŽǁƐŽƉĞƌĂƚŽƌƐŽƉĞŶĂŶĚĐůŽƐĞďĂƚĐŚĞƐƋƵŝĐŬůLJĂŶĚĞĂƐŝůLJƐŚŽǁƐďĂƚĐŚŝŶĨŽƌŵĂƚŝŽŶĨŽƌĂƐĞůĞĐƚĞĚ ŽƉĞƌĂƚŽƌ xWƌŝŶƚƐĂŶĚǀŽŝĚƐƌĞĐĞŝƉƚƐĨƌŽŵKƉĞƌĂƚŽƌWƌŽĐĞƐƐǁŝŶĚŽǁ x/ŶĐůƵĚĞƐƐƉĞĐŝĂůŝnjĞĚ͞ŵĂŝůƉƌŽĐĞƐƐŝŶŐ͟ŵŽĚƵůĞĨŽƌĞĨĨŝĐŝĞŶƚƚƌĂŶƐĂĐƚŝŽŶƉƌŽĐĞƐƐŝŶŐ xdƌĂŶƐŵŝƚƐƐƵƉƉŽƌƚƌĞƋƵĞƐƚƐďLJĞŵĂŝůŽƌĨĂdžĚŝƌĞĐƚůLJĨƌŽŵĂƉƉůŝĐĂƚŝŽŶ x/ŶƚĞŐƌĂƚĞƐƐĞĂŵůĞƐƐůLJǁŝƚŚĐĂƐŚĚƌĂǁĞƌŚĂƌĚǁĂƌĞ dƌĂŶƐĂĐƚŝŽŶĨĨŝĐŝĞŶĐLJ xWƌŽǀŝĚĞƐŽŶůŝŶĞĂĐĐŽƵŶƚŶƵŵďĞƌǀĂůŝĚĂƚŝŽŶĨŽƌŝŶƚĞŐƌĂƚĞĚƐƵďͲƐLJƐƚĞŵƐ xůůŽǁƐĨŽƌWƌŽĚƵĐƚĂŶĚͬŽƌdƌĂŶƐĂĐƚŝŽŶͲďĂƐĞĚƌĞĐĞŝƉƚŝŶŐ x^ƵƉƉŽƌƚƐƉĂLJŵĞŶƚƉƌŽĐĞƐƐŝŶŐĨŽƌŵƵůƚŝƉůĞĂĐĐŽƵŶƚƐĂĐƌŽƐƐĂůůŝŶƚĞŐƌĂƚĞĚĂƉƉůŝĐĂƚŝŽŶƐŽŶĂƐŝŶŐůĞ ƌĞĐĞŝƉƚ xůůŽǁƐƐĞůĞĐƚŝŽŶŽĨŵƵůƚŝƉůĞĂĐĐŽƵŶƚƐƚŚƌŽƵŐŚĂƐŝŵƉůĞƉŽŝŶƚͲĂŶĚͲĐůŝĐŬŝŶƚĞƌĨĂĐĞ xdƌĂŶƐŵŝƚƐĂƵƚŽŵĂƚŝĐĞŶĚŽƌƐĞŵĞŶƚŽĨĐŚĞĐŬƐƚŽƌĞĐĞŝƉƚƉƌŝŶƚĞƌ xĞĨĂƵůƚƐĂƵƚŽŵĂƚŝĐĂůůLJƚŽĐƵƌƌĞŶƚďĂůĂŶĐĞŽǁĞĚĂŶĚĂůůŽǁƐŽǀĞƌƌŝĚĞ xůůŽǁƐƵƐĞƌƚŽƌĞŝŶƐƚĂƚĞĐƵƚŽĨĨĂĐĐŽƵŶƚƐĂŶĚƌĞŵŽǀĞƉĂƐƚĚƵĞƐƚĂƚƵƐ x^ƵƉƉŽƌƚƐďĂƌĐŽĚĞƐĐĂŶŶĞƌƐĂƐǁĞůůĂƐĐƌĞĚŝƚĐĂƌĚƐĐĂŶŶŝŶŐĂŶĚǀĂůŝĚĂƚŝŽŶĞƋƵŝƉŵĞŶƚ xĐĐŽŵŵŽĚĂƚĞƐŵƵůƚŝƉůĞŵĞƌĐŚĂŶƚĂĐĐŽƵŶƚƐĨŽƌŽŶůŝŶĞĐƌĞĚŝƚĐĂƌĚƉƌŽĐĞƐƐŝŶŐ xůůŽǁƐĂƵƚŽͲƉŽƐƚŝŶŐŽĨƚƌĂŶƐĂĐƚŝŽŶƐĨƌŽŵĂůůŝŶƚĞŐƌĂƚĞĚƐLJƐƚĞŵƐǁŝƚŚ͞ƐŝŶŐůĞĐůŝĐŬ͟ƵƉĚĂƚĞ 'ůŽďĂůZĞƉŽƌƚŝŶŐdŽŽů hƐĞƚĞĐŚŶŽůŽŐLJƚŽLJŽƵƌĂĚǀĂŶƚĂŐĞ͗ƐĐŚĞĚƵůĞƌĞƉŽƌƚƐĂŚĞĂĚŽĨƚŝŵĞĂŶĚŚĂǀĞƚŚĞŵĂƵƚŽŵĂƚŝĐĂůůLJƐĞŶƚŽƵƚƚŽ ƌĞůŝĞǀĞLJŽƵĨƌŽŵŚĂǀŝŶŐƚŽŵĂŶƵĂůůLJƌƵŶ͕ƉƌŝŶƚĂŶĚŚĂŶĚͲĚĞůŝǀĞƌƌĞƉŽƌƚƐ͘&ƌĞĞƵƉLJŽƵƌƐĐŚĞĚƵůĞĂŶĚĞŶŚĂŶĐĞ ŝŶƚĞƌͲĚĞƉĂƌƚŵĞŶƚĂůĐŽŵŵƵŶŝĐĂƚŝŽŶƚŚƌŽƵŐŚĂƵƚŽŵĂƚĞĚƌĞƉŽƌƚŶŽƚŝĨŝĐĂƚŝŽŶƐĂŶĚĚĞůŝǀĞƌŝĞƐ͘/ŵƉƌŽǀĞ ĐŽůůĂďŽƌĂƚŝŽŶĞĨĨŽƌƚƐďLJƐŚĂƌŝŶŐƌĞƉŽƌƚƐǁŝƚŚŽƚŚĞƌƵƐĞƌƐĨŽƌƌĞĂůͲƚŝŵĞĂŶĂůLJƐŝƐĂŶĚĚƌŝůůͲĚŽǁŶĨƌŽŵƌĞƉŽƌƚƐĨŽƌ ƋƵŝĐŬĂĐĐĞƐƐƚŽƐƵƉƉŽƌƚŝŶŐĚĞƚĂŝůƐ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϭ ZĞƉŽƌƚŝŶŐ&ĞĂƚƵƌĞƐ ^ƚĂŶĚĂƌĚƌĞƉŽƌƚŝŶŐƚŽŽůƐǁŝƚŚŝŶƚŚĞ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐƉƌŽǀŝĚĞŵƵůƚŝƉůĞƵƐĞƌͲĚƌŝǀĞŶĨŝůƚĞƌƉĂƌĂŵĞƚĞƌƐƚŽ ĐŽŶƚŽƵƌƌĞƉŽƌƚƐƚŽƐƉĞĐŝĨŝĐƵƐĞƌŶĞĞĚƐ͘džĂŵƉůĞƐŽĨƐĞůĞĐƚŝŽŶĐƌŝƚĞƌŝĂĂƌĞƌĂŶŐĞŽĨĚĂƚĞƐ͕ƌĂŶŐĞŽĨƌĞĐŽƌĚ ŶƵŵďĞƌƐ͕ƌĂŶŐĞŽĨĐŽĚĞƐ͕ƐŽƌƚŝŶŐĐƌŝƚĞƌŝĂ͕ĞƚĐ͘hƐĞƌƐĐĂŶƐĂǀĞĨŝůƚĞƌŝŶŐĂŶĚĨŽƌŵĂƚƚŝŶŐƐĞƚƚŝŶŐƐƐƉĞĐŝĨŝĞĚĨŽƌĂ ƌĞƉŽƌƚǁŝƚŚĂƉƌŽĨŝůĞŶĂŵĞĨŽƌƌĞƚƌŝĞǀĂůǁŚĞŶƉƌŝŶƚŝŶŐƚŚĞƌĞƉŽƌƚŽŶĂƐƵďƐĞƋƵĞŶƚŽĐĐĂƐŝŽŶ͘ĚĚŝƚŝŽŶĂůůLJ͕ ƵƐĞƌƐĐĂŶĨůĂŐĂƉƌŽĨŝůĞĂƐƚŚĞĚĞĨĂƵůƚĨŽƌůŽĂĚŝŶŐƌĞƉŽƌƚƐĞƚƚŝŶŐƐ͘dŚĞƐĂŵĞƐĞĐƵƌŝƚLJĚĞĨŝŶŝƚŝŽŶƐĞƐƚĂďůŝƐŚĞĚĨŽƌ ƚŚĞŝŶƚĞŐƌĂƚĞĚĂƉƉůŝĐĂƚŝŽŶƐĂƉƉůLJƚŽĚĂƚĂĂĐĐĞƐƐĞĚƚŚƌŽƵŐŚŽƵƌƐƚĂŶĚĂƌĚƌĞƉŽƌƚŝŶŐĨĞĂƚƵƌĞƐ͘ dŚĞƌĞƐƵůƚƐŽĨƐƚĂŶĚĂƌĚƌĞƉŽƌƚƐĞůĞĐƚŝŽŶƐĐĂŶďĞĞdžƉŽƌƚĞĚƚŽŽƚŚĞƌĚĂƚĂĨŽƌŵĂƚƐƚŚƌŽƵŐŚĂŶdžƉŽƌƚtŝnjĂƌĚ͘ KƉƚŝŽŶƐƐŚŽƵůĚŝŶĐůƵĚĞƚŚĞĂďŝůŝƚLJƚŽŵĞƌŐĞƚŚĞĚĂƚĂǁŝƚŚDŝĐƌŽƐŽĨƚtŽƌĚ͕džĐĞů͕ĐĐĞƐƐĂŶĚDĂƉWŽŝŶƚĂƐ ǁĞůůĂƐƚŚĞĂďŝůŝƚLJƚŽŚĂǀĞƚŚĞĚĂƚĂƐĞƚĞdžƉŽƌƚĞĚĚŝƌĞĐƚůLJƚŽĂyD>Žƌ^sĨŽƌŵĂƚƚĞĚĨŝůĞ͘ ĚͲŚŽĐZĞƉŽƌƚŝŶŐdŽŽůƐ dŚĞZĞƉŽƌƚtƌŝƚĞƌĂůůŽǁƐƚŚĞƵƐĞƌƚŽŵŽĚŝĨLJƌĞƉŽƌƚƐ͕ǁŚŝĐŚĂƌĞƐƉĞĐŝĨŝĐƚŽLJŽƵƌ/ŶĐŽĚĞĚĂƚĂǁŝƚŚĚƌĂŐͲĂŶĚͲ ĚƌŽƉĨŝĞůĚƐĂƌƌĂŶŐĞĚůŽŐŝĐĂůůLJƉĞƌĂƉƉůŝĐĂƚŝŽŶĂŶĚƵƐĂŐĞ͘dŚĞĚƌĂŐͲĂŶĚͲĚƌŽƉĨŝĞůĚƐĂƌĞǁƌŝƚƚĞŶŝŶĞǀĞƌLJĚĂLJ ůĂŶŐƵĂŐĞ͕ĂŶĚƉƌŽŵƉƚĨŽƌƐƉĞĐŝĨŝĐŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚƚŚĞĨŝĞůĚǁŚĞŶĚƌŽƉƉĞĚŽŶƚŽĂƌĞƉŽƌƚ͘ZĞƉŽƌƚƐĐĂŶďĞ ĐƵƐƚŽŵĚĞƐŝŐŶĞĚďLJLJŽƵǁŝƚŚƚŝƚůĞƐ͕ůŽŐŽƐ͕ƉĂŐĞŶƵŵďĞƌƐ͕ŐƌŽƵƉŝŶŐƐ͕ĂŶĚƐƵďͲƌĞƉŽƌƚƐ͘KŶĐĞƌĞƉŽƌƚƐĂƌĞ ĐƌĞĂƚĞĚ͕ƚŚĞLJĐĂŶďĞƐĂǀĞĚŝŶdžĐĞů͕ĚŽďĞĐƌŽďĂƚ͕,dD>͕ĂŶĚŽƚŚĞƌƚĞdžƚďĂƐĞĚĨŽƌŵĂƚƐĨŽƌĞĂƐLJƌĞĨĞƌĞŶĐŝŶŐ ĂŶĚƐŚĂƌŝŶŐ͘ZĞƉŽƌƚůĂLJŽƵƚƐŵĂLJďĞĚĞƐŝŐŶĞĚǁŝƚŚƚŝƚůĞƐ͕ůŽŐŽƐ͕ƉĂŐĞŶƵŵďĞƌƐ͕ŐƌŽƵƉŝŶŐƐ͕ĂŶĚƐƵďͲƌĞƉŽƌƚƐ͘ &ĞĂƚƵƌĞƐ xƵƐƚŽŵĐŽŶƚƌŽůŽĨƌĞƉŽƌƚůĂLJŽƵƚŝŶĐůƵĚŝŶŐƚŝƚůĞƐ͕ůŽŐŽƐ͕ƉĂŐĞŶƵŵďĞƌƐ͕ƉŝĐƚƵƌĞƐ͕ďĂƌĐŽĚĞƐ͕ĐŚĞĐŬďŽdžĞƐ͕ ĐŚĂƌƚƐ͕ĐĂůĐƵůĂƚŝŽŶƐ͕ƐƵŵŵĂƌŝĞƐ͕ŚLJƉĞƌůŝŶŬƐ͕ƐŚĂƉĞƐ͕ŐƌŽƵƉŝŶŐ͕ĂŶĚƐƵďͲƌĞƉŽƌƚƐ xďŝůŝƚLJƚŽĚƌŝůůĚŽǁŶƚŽƚŚĞĚĂƚĂŝŶLJŽƵƌĞdžŝƐƚŝŶŐdLJůĞƌĂƉƉůŝĐĂƚŝŽŶƐ xdžƉŽƌƚĨĞĂƚƵƌĞƚŚĂƚƐƵƉƉŽƌƚƐdžĐĞů͕W&͕,dD>͕ĂŶĚŽƚŚĞƌƚĞdžƚͲďĂƐĞĚĨŽƌŵĂƚƐĨŽƌĞĂƐLJƌĞĨĞƌĞŶĐĞĂŶĚ ŝŶĨŽƌŵĂƚŝŽŶƐŚĂƌŝŶŐ xĂƐĞŝŶƐŚĂƌŝŶŐƌĞƉŽƌƚƐǁŝƚŚƵƐĞƌƐǁŚŽŚĂǀĞĂĐĐĞƐƐƚŽZĞƉŽƌƚsŝĞǁĞƌ͕ĞŶĂďůŝŶŐƚŚĞŵƚŽǀŝĞǁƌĞƉŽƌƚƐ ǁŝƚŚŽƵƚĚĞƐŝŐŶŝŶŐƚŚĞƌĞƉŽƌƚƐ xƵŝůƚŽŶ͘EdĚĞǀĞůŽƉŵĞŶƚĨƌĂŵĞǁŽƌŬƚĞĐŚŶŽůŽŐLJ x&ůĞdžŝďůĞĨŝůƚĞƌŝŶŐĂůůŽǁƐƵƐĞƌƐƚŽƉƌŽĚƵĐĞƌĞƉŽƌƚƐƚĂŝůŽƌĞĚƚŽƚŚĞŝƌƐƉĞĐŝĮĐŶĞĞĚƐ xZĞƉŽƌƚŝŶŐĞŶŐŝŶĞďĂƐĞĚŽŶĂƚĂLJŶĂŵŝĐƐ͛ĐƚŝǀĞZĞƉŽƌƚƐƉƌŽĚƵĐƚ hƐĞƌ&ƌŝĞŶĚůLJ xƌĂŐͲĂŶĚͲĚƌŽƉĨŝĞůĚƐůĂďĞůĞĚŝŶĞǀĞƌLJĚĂLJůĂŶŐƵĂŐĞ xWƌŽŵƉƚƐƚŽĂƐƐŝƐƚƵƐĞƌƐŝŶĐŽŶĨŝŐƵƌŝŶŐƚŚĞĨŝĞůĚƐƚŚĞLJĚƌŽƉŽŶƚŽĂƌĞƉŽƌƚ xdžƚĞŶƐŝǀĞĨŝĞůĚĐĂƉĂďŝůŝƚŝĞƐ /ŶĐŽĚĞ>ŝĐĞŶƐĞƐ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͛/ŶĐŽĚĞ>ŝĐĞŶƐĞƐΡŵŽĚƵůĞĂƵƚŽŵĂƚĞƐƚŚĞŝƐƐƵŝŶŐĂŶĚƚƌĂĐŬŝŶŐŽĨǀĂƌŝŽƵƐůŝĐĞŶƐĞƐŚĂŶĚůĞĚďLJĂŐĞŶĐŝĞƐ͘ /ƚƉƌŽǀŝĚĞƐĨůĞdžŝďůĞƐĞĂƌĐŚŝŶŐĨŽƌĞĂƐLJŝŶĨŽƌŵĂƚŝŽŶƌĞƚƌŝĞǀĂůĂŶĚĂůůŽǁƐŵƵůƚŝƉůĞůŝĐĞŶƐĞƚLJƉĞƐƚŽďĞĚĞĨŝŶĞĚ͘ĚĚŝƚŝŽŶĂů ĨůĞdžŝďŝůŝƚLJĂůůŽǁƐĨŽƌƵƐĞƌͲĚĞĨŝŶĞĚĚĂƚĂĂƚƚƌŝďƵƚĞƐƉĞƌůŝĐĞŶƐĞƚLJƉĞ͕ĂůůŽǁŝŶŐLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶƚŽŚĂŶĚůĞŵŝƐĐĞůůĂŶĞŽƵƐ ƌĞŐŝƐƚƌĂƚŝŽŶƐ͕ĂƐǁĞůůĂƐůŝĐĞŶƐĞƐ͕ĂŶĚĨůĂƚĨĞĞĂŶĚƉĂƌĂŵĞƚĞƌͲĚƌŝǀĞŶĨĞĞĐĂůĐƵůĂƚŝŽŶƐ͘ dŚŝƐŵŽĚƵůĞŝŶƚĞƌĨĂĐĞƐǁŝƚŚdLJůĞƌ͛Ɛ/ŶĐŽĚĞŽŶƚĂĐƚĂŶĚWƌŽƉĞƌƚLJDĂŶĂŐĞŵĞŶƚΡ͕/ŶĐŽĚĞWĞƌŵŝƚƐΡ͕ĂŶĚ/ŶĐŽĚĞŽĚĞ ŶĨŽƌĐĞŵĞŶƚΡŵŽĚƵůĞƐ͕ǁŚŝůĞŝŶƚĞŐƌĂƚŝŽŶǁŝƚŚ/ŶĐŽĚĞ&ŝŶĂŶĐŝĂůDĂŶĂŐĞŵĞŶƚΡĂƉƉůŝĐĂƚŝŽŶƐĂůůŽǁƐĨŽƌĞĂƐLJƉĂLJŵĞŶƚ ƉƌŽĐĞƐƐŝŶŐ͕ƌĞĨƵŶĚƚƌĂŶƐĨĞƌƐ͕ĂŶĚƐĞĂŵůĞƐƐƵƉĚĂƚĞƐƚŽƚŚĞŐĞŶĞƌĂůůĞĚŐĞƌ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϮ ƵƚŽŵĂƚĞĂŶĚ^ŝŵƉůŝĨLJ>ŝĐĞŶƐŝŶŐWƌŽĐĞƐƐĞƐ dŚĞĨĞĂƚƵƌĞƐĂŶĚĨƵŶĐƚŝŽŶĂůŝƚLJĂǀĂŝůĂďůĞŝŶ/ŶĐŽĚĞ>ŝĐĞŶƐĞƐŚĞůƉĂƵƚŽŵĂƚĞĂŶĚƐƚƌĞĂŵůŝŶĞLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶ͛ƐůŝĐĞŶƐŝŶŐ ƉƌŽĐĞƐƐĞƐ͕ĨƌŽŵĐƌĞĂƚŝŽŶĂŶĚƌĞŶĞǁĂůƚŽƌĞƉŽƌƚŝŶŐ͘ xDĂƐƐƌĞŶĞǁůŝĐĞŶƐĞƐ xĂƐŝůLJǀŝĞǁůŽĐĂƚŝŽŶŝŶĨŽƌŵĂƚŝŽŶǁŝƚŚ'ŽŽŐůĞDĂƉƐΡŝŶƚĞŐƌĂƚŝŽŶ x^ŝŵƉůŝĨLJĐĞŶƐƵƐĂŶĚĐŽƵŶĐŝůƌĞƉŽƌƚŝŶŐǁŝƚŚƌŽůĞͲďĂƐĞĚĚĂƐŚďŽĂƌĚƐ x^ĞĂƌĐŚďLJůŝĐĞŶƐĞŶƵŵďĞƌ͕ŶĂŵĞ͕ƐƚĂƚƵƐ͕ƚLJƉĞ͕ƐĞĐŽŶĚĂƌLJĐŽŶƚĂĐƚŝŶĨŽƌŵĂƚŝŽŶ͕ƵƐĞƌͲĚĞĨŝŶĞĚĚĂƚĂ͕ĂŶĚŵŽƌĞ xsŝĞǁŝŶͲĚĞƉƚŚĚĞƚĂŝůƐŽĨĂƉƌŽƉĞƌƚLJ͕ŝŶĐůƵĚŝŶŐǀŝŽůĂƚŝŽŶƐ͕ƉĞƌŵŝƚƐ͕ƵƚŝůŝƚŝĞƐ͕ůŝĞŶƐ͕ĂŶĚĐŽŶƚĂĐƚŶŽƚĞƐ xŵƉŽǁĞƌĐŽĚĞĞŶĨŽƌĐĞŵĞŶƚŽĨĨŝĐĞƌƐǁŝƚŚůŝĐĞŶƐĞĚƉƌŽƉĞƌƚLJĚĞƚĂŝůƐĂƚƚŚĞŝƌĨŝŶŐĞƌƚŝƉƐ /ŶĐŽĚĞWĞƌŵŝƚƐ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͛/ŶĐŽĚĞWĞƌŵŝƚƐΡŵŽĚƵůĞƐƚƌĞĂŵůŝŶĞƐĂŶĚƚƌĂĐŬƐƚŚĞƉĞƌŵŝƚŵĂŶĂŐĞŵĞŶƚƉƌŽĐĞƐƐĨƌŽŵ ŝŶŝƚŝĂůƉĞƌŵŝƚƐƵďŵŝƐƐŝŽŶĂŶĚĚŽĐƵŵĞŶƚƐƚŽƌĂŐĞƚŽŝŶƐƉĞĐƚŝŽŶĂŶĚƉĞƌŵŝƚĂƉƉƌŽǀĂů͘dŚŝƐŵŽĚƵůĞŝŶƚĞƌĨĂĐĞƐ ǁŝƚŚdLJůĞƌ͛Ɛ/ŶĐŽĚĞŽŶƚĂĐƚĂŶĚWƌŽƉĞƌƚLJDĂŶĂŐĞŵĞŶƚΡ͕/ŶĐŽĚĞ>ŝĐĞŶƐĞƐΡ͕ĂŶĚ/ŶĐŽĚĞŽĚĞŶĨŽƌĐĞŵĞŶƚΡ ŵŽĚƵůĞƐ͕ǁŚŝůĞŝŶƚĞŐƌĂƚŝŽŶǁŝƚŚ/ŶĐŽĚĞ&ŝŶĂŶĐŝĂůDĂŶĂŐĞŵĞŶƚΡĂƉƉůŝĐĂƚŝŽŶƐĂůůŽǁƐĨŽƌĞĂƐLJƉĂLJŵĞŶƚ ƉƌŽĐĞƐƐŝŶŐ͕ƌĞĨƵŶĚƚƌĂŶƐĨĞƌƐ͕ĂŶĚƐĞĂŵůĞƐƐƵƉĚĂƚĞƐƚŽƚŚĞŐĞŶĞƌĂůůĞĚŐĞƌ͘ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϯ /ŵƉƌŽǀĞKĨĨŝĐĞĨĨŝĐŝĞŶĐLJ dŚŝƐŽĨĨĞƌŝŶŐĨƌŽŵdLJůĞƌŝŶĐƌĞĂƐĞƐŽĨĨŝĐĞĞĨĨŝĐŝĞŶĐLJďLJĂƵƚŽŵĂƚŝŶŐƉƌŽĐĞƐƐĞƐ͕ƌĞĚƵĐŝŶŐĨŽŽƚƚƌĂĨĨŝĐĂŶĚ ƉĂƉĞƌǁŽƌŬ͕ĂŶĚƉƵƚƚŝŶŐŵŽƌĞƉŽǁĞƌŝŶƚŽƚŚĞŚĂŶĚƐŽĨĐŝƚŝnjĞŶƐĂŶĚĐŽŶƚƌĂĐƚŽƌƐ͘ xůĞĐƚƌŽŶŝĐĂůůLJƐƚŽƌĞƉůĂŶĚŽĐƵŵĞŶƚƐ xĐĐĞƉƚƉĞƌŵŝƚƐƵďŵŝƐƐŝŽŶƐĂŶĚŽŶůŝŶĞƉĂLJŵĞŶƚƐ x^ĐŚĞĚƵůĞŝŶƐƉĞĐƚŝŽŶƐƚŚƌŽƵŐŚĂǁĞďƉŽƌƚĂů xWƵůůĐŽƵŶĐŝůƌĞƉŽƌƚƐǁŝƚŚĞĂƐĞ xsŝĞǁŝŵƉŽƌƚĂŶƚŝŶĨŽƌŵĂƚŝŽŶĂƚĂŐůĂŶĐĞǁŝƚŚŝŶƚĞƌĂĐƚŝǀĞĐŚĂƌƚƐĂŶĚŐƌĂƉŚƐ ^ĞĐƚŝŽŶϮ͘ϬͲ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϰ ŽŽƐƚ&ŝĞůĚWƌŽĚƵĐƚŝǀŝƚLJ dŚĞĨĞĂƚƵƌĞƐĂŶĚĨƵŶĐƚŝŽŶĂůŝƚLJĂǀĂŝůĂďůĞŝŶ/ŶĐŽĚĞWĞƌŵŝƚƐŐŝǀĞƐŝŶƐƉĞĐƚŽƌƐƚŚĞƉŽǁĞƌƚŽĐŽŵƉůĞƚĞƚŚĞŝƌ ĂƐƐŝŐŶŵĞŶƚƐĨƌŽŵƚŚĞĨŝĞůĚ͕ŬĞĞƉŝŶŐĞǀĞƌLJŽŶĞƵƉĚĂƚĞĚŝŶƌĞĂůƚŝŵĞǁŝƚŚŽƵƚŚĂǀŝŶŐƚŽƌĞƚƵƌŶƚŽƚŚĞďĂĐŬ ŽĨĨŝĐĞ͘ x^ŶĂƉĂŶĚĂƚƚĂĐŚŝŶƐƉĞĐƚŝŽŶƉŚŽƚŽƐ xŝĐƚĂƚĞĂŶĚƐƚŽƌĞŝŶƐƉĞĐƚŝŽŶŶŽƚĞƐ xZĞĐŽƌĚĐŽŶƚƌĂĐƚŽƌƐŝŐŶĂƚƵƌĞƐ xDĂƉĂŶĚƌŽƵƚĞŝŶƐƉĞĐƚŝŽŶƐǁŝƚŚ'ŽŽŐůĞDĂƉƐΡŝŶƚĞŐƌĂƚŝŽŶ ^ĞĐƚŝŽŶϯ͘ϬͲ&ƵŶĐƚŝŽŶĂůZĞƋƵŝƌĞŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϱ ^ĞĐƚŝŽŶϯ͘ϬͲ&ƵŶĐƚŝŽŶĂůZĞƋƵŝƌĞŵĞŶƚƐ 7KLVVHFWLRQGHVFULEHVWKHVRIWZDUHDQGLPSOHPHQWDWLRQVFRSHRIWKHRYHUDOO SURMHFWDQGWKH UHTXLUHPHQWVIRUHDFKIXQFWLRQDODUHD5HVSRQVHVWRWKHIXQFWLRQDOUHTXLUHPHQWVVKRXOGEHFRPSOHWHGWR LGHQWLI\WKHFDSDELOLW\RIWKHVRIWZDUHWKHVFRSHRIWKHLPSOHPHQWDWLRQSOXVLIWKHUHTXLUHPHQWZLOOEH LQFOXGHXQGHUWKHVFRSHRIDQ\SURSRVHGVXSSRUWDJUHHPHQW 5HVSRQVHVWRWKH IXQFWLRQDOUHTXLUHPHQWV VKDOOXVHWKHIROORZLQJUHVSRQVHFRGHV )XQFWLRQDO5HTXLUHPHQWV5HVSRQVHV &ROXPQ($YDLODEOH5HVSRQVHV < 5HTXLUHPHQW0HWDQG3URSRVHG6WDQGDUGIHDWXUHVLQWKHJHQHUDOO\DYDLODEOH SURGXFW <1' 5HTXLUHPHQW0HWDQG3URSRVHG)HDWXUHVWKDWDUHQRWRIIHUHGDVDJHQHUDOO\ DYDLODEOHSURGXFWRUUHTXLUHFXVWRPGHYHORSPHQW 1 5HTXLUHPHQW1RW0HWZLWK3URSRVDO , 1HHG0RUH,QIRUPDWLRQ'LVFXVVLRQ 7\OHUKDGSURYLGHGUHVSRQVHVWRWKH)XQFWLRQDO5HTXLUHPHQWVOLVWHGEHORZLQWKLV6HFWLRQRIWKH5)3 5HVSRQVH ^ĞĐƚŝŽŶϯ͘ϬͲ&ƵŶĐƚŝŽŶĂůZĞƋƵŝƌĞŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϲ Table of Contents - General Requirements City of Corcoran BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Table of Contents Section No. Functional Area Number of Requirements 2 General and Technical 3 General Ledger, Financial Reporting, and Treasury Management 4 Budgeting 5 Purchasing 6 Accounts Payable 7 Accounts Receivable and Billing 8 Capital Assets 9 Project/Grant Management 10 Cash Management 11 Human Resources 12 Time Entry and Payroll 13 Permitting and Inspections 14 Planning 15 Current Application Environment General & Technical - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GENERAL SYSTEM CAPABILITIES: GT.1 The software must be commercial off-the-shelf that can be tailored to customer needs through configuration instead of custom software development. DESIRED Yes GT.2 Provides a one-time, single point of data entry to reduce redundant work. CRITICAL Yes GT.3 Modules should integrate to maximize operator and system efficiency where applicable. CRITICAL Yes GT.4 Provides an easy to use tool for preparing various statistical and analytical reports. DESIRED Yes GT.5 Allows searching on all application fields and includes search operators such as greater than, less than, in between, etc. DESIRED Yes GT.6 Allows for unlimited historical data to be stored and maintained in the production system. CRITICAL Yes GT.7 Performs real-time data validation and error checking at the time of data entry. DESIRED Yes GT.8 Provides identification of an individual who last entered or changed any transaction and the date of that change. DESIRED Yes GT.9 Allows for multiple users to be on the system at the same time and multiple users to be in the same program at the same time. CRITICAL Yes GT.10 The software must use a relational database. CRITICAL Yes GT.11 Provides functionality for data to be output directly from an application to multiple formats including, but limited to printer, email, Microsoft Excel, Microsoft Word and PDF. CRITICAL Yes GT.12 Allows customized access and user experience, to be maintained by role. DESIRED Yes GT.13 Provides user defined fields for the master files and input screens in applicable modules. DESIRED Yes GT.14 Provides comprehensive document management capabilities. DESIRED Yes INTEGRATE WITH LASERFICHE GT.15 Allows users to design site specific output forms for applicable modules. DESIRED Yes GT.16 Allows for reports to be scheduled for automated generation with multiple output options. CRITICAL Yes GT.17 Provides integrated checklists and/or wizards to guide users through complex processes. CRITICAL Yes General & Technical - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments VENDOR SERVICES GT.18 Provides future updates and enhancements on a regular basis. Vendor will note such provisions and identify associated costs. DESIRED Yes GT.19 Provides well defined all-inclusive migration processes for software releases. DESIRED Yes GT.20 Supports all client software modifications in a generally available release. DESIRED Yes GT.21Provides client specific software modifications available to all clients at no additional charge. DESIREDYes TECHNICAL CAPABILITIES: GT.22 Provides field level edit checks for transactions during data entry and provide immediate user feedback, including error messages and possible corrective actions (i.e., warnings when entering existing SSN, address, etc.) DESIREDYes GT.23 Provides online documentation and training materials such as context-specific help, release notes, and process overviews.DESIRED Yes GT.24 Allows authorized users to obtain/update information through self-service applications when applicable. DESIRED Yes GT.25 Supports importing and exporting standard desktop office application files to Microsoft Office suite where applicable. CRITICAL Yes GT.26 Displays all date fields with a century indicator. DESIRED Yes GT.27 Includes multiple application environments. This should include separate environments for end-user training and to install application updates without affecting production. DESIRED Yes APPLICATION ARCHITECTURE: GT.28 Allows applications to be browser-based and not require additional software or add-ons installed on end user devices. DESIRED Yes GT.29 Includes real-time RESTful APIs for third-party application integration. DESIRED Need more information on RESTful API GT.30 Processes should occur in real-time but allow for select processes to be scheduled. CRITICAL Yes Need more information on RESTful API General & Technical - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GT.31 Supports standard Windows clipboard functionality to cut/copy/paste to and from fields. CRITICAL Yes GT.32 Allows for files to be attached directly to application records and transactions. CRITICAL Yes GT.33 Allows for documents to be scanned directly and attached directly to application records and transactions. CRITICAL Yes GT.34 Supports mass changes to definable groupings of transactions, where applicable. CRITICAL Yes We would need examples GT.35 Provides effective dating for transactions and table updates, including both future and retroactive changes, where applicable. CRITICAL Yes GT.36 Allows drill down functionality to supporting records, including across application modules. CRITICAL Yes GT.37 Supports either on-premises or cloud deployment. DESIRED Yes GT.38 Supports industry standard virtualization platforms. DESIRED Yes GT.39 Supports system on Microsoft Windows Server operating systems. CRITICAL Yes GT.40 Allows for communication between end-user and application server/s to be over HTTPS. CRITICAL Yes SYSTEM ADMINISTRATION & CUSTOMIZATIONS: Provides user-defined: GT.41 Tables CRITICAL Yes GT.42 Fields CRITICAL Yes GT.43 Reports CRITICAL Yes GT.44 Menus CRITICAL Yes GT.45 Output forms CRITICAL Yes GT.46 Business rules and workflows CRITICAL Yes GT.47 Allows all application customizations to be retained following any system update. CRITICAL Yes GT.48 Allows administration tasks to be decentralized. CRITICAL Yes General & Technical - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GT.49 Supports industry standard backup solutions and practices. CRITICAL Yes GT.50 Supports database transaction log backups and point-in-time restoration. CRITICAL Yes DATABASE MANAGEMENT SYSTEM: GT.51 Allows system to be optimized for Microsoft SQL Server RDBMS. CRITICAL Yes GT.52 Provides functionality to lock database records at row and field level. DESIRED No GT.53 Includes a data dictionary. DESIRED Yes GT.54 Allows for the administrator to track user behavior as well as database utilization. DESIRED Yes GT.55 Provides documented best practices including but not limited to optimum database configuration and client maintenance. DESIRED Yes SECURITY: Allows integrated Role-based Access Control security system and includes the following features: GT.56 Unlimited number of roles to be assigned to a user CRITICAL Yes GT.57 Roles include several levels of access customization including, but not limited to application, process, record, and where applicable, field. CRITICAL Yes GT.58 Roles can be effective dated to be automatically applied or expired on future dates DESIRED No GT.59 Role administration to be decentralized per application module DESIRED Yes GT.60 Supports Microsoft Active Directory for end-user authentication. DESIRED Yes GT.61 Allows use of single login for all products from same vendor. No I answered this way due to ICD, Energov, Executime, etc having their own logins. GT.62 Provides self-service applications to allow end users to register for a new account. DESIRED Yes GT.63 Allows for end users of self-service applications to reset their own password, including "forgot password" capability. CRITICAL Yes GT.64 Allows an administrator to suspend a user ID from further use. CRITICAL Yes GT.65 Automatically log users off after defined idle time. Must be able to define idle time by user role and/or per application module. CRITICAL Yes General & Technical - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GT.66 Provides functionality to record who changed security profiles and when changes are made (user name, date and time stamp). CRITICAL Yes GT.67 Includes summarized and detailed reports on user security rights. CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments REPORTING: GT.68 Allows user to generate charts and graphs based on report data within the system. CRITICAL Yes CAFR, Pivot Plus GT.69 Provides multiple output formats for reports including printer, PDF, Word, Excel. CRITICAL Yes GT.70 Allows scheduling of applicable reports to run automatically. CRITICAL Yes GT.71 Provides reporting by exception. CRITICAL Yes GT.72 Allows print preview of all reports before printing and have print screen functionality. CRITICAL Yes GT.73 Supports industry leading ad hoc reporting tools including Microsoft SQL Server Reporting Services. CRITICAL Yes WORKFLOW: GT.74 Includes integrated workflow engine across all modules to provide automated notifications and approval requests. DESIRED Yes GT.75 Includes pre-defined business rules to include in customized workflows. DESIRED Yes GT.76 Allows for workflow design and administration to use point-and-click/drag-and-drop tools and require little technical expertise. CRITICAL Yes Not Drag and Drop GT.77 Allows for workflow administration to be decentralized per application module. CRITICAL Yes GT.78 Allows multiple approval paths based on item to be routed, where applicable. CRITICAL Yes PO Allows for the following workflow configuration: GT.79 First approver can complete workflow step for group DESIRED Yes PO GT.80 All approvers needed to complete workflow step for group DESIRED Yes PO GT.81 Ability to set a catchall rule, this rule would be activated if there are no other business rules applicable to the process. DESIRED Yes PO GT.82 Provides automated approval notification where applicable. DESIRED Yes PO General & Technical - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GT.83 Provides multiple methods of receiving and acting upon workflow notifications and approvals, including from desktop and mobile platforms. DESIRED Yes PO GT.84 Allows for a designated user to override particular workflow step. DESIRED Yes PO Req. # Description of Requirement Criticality Response from Vendors Comments GT.85 Provides functionality to set an alternate approver on a business rule so that workflow is automatically forwarded if not acted upon after a user-defined period of time. CRITICAL No Alternate approver: yes. Automatically forwarded to alternate: No GT.86 Tracks documents submitted for approval and review with a time/date stamp. CRITICAL Yes TCM GT.87 Provides functionality to migrate workflow processes between application environments. For example, workflow processes can be built and tested in a non-production environment, then migrated to a production environment. CRITICAL No Test Environment: yes. Automatically move to production: No DASHBOARDS: GT.88 Includes a centralized dashboard to access, analyze, and process data across proposed applications. DESIRED Yes GT.89Includes a comprehensive library of pre-defined content. DESIREDYesGT.90 Allows existing dashboard content to be customized and new dashboard content can be created through non-technical, point-and-click toolsets. DESIRED No Dashboards are assigned based on individual user’s job role assignment. The Dashboard components are created by Tyler Development. For certain Dashboard components, users can adjust the parameters of the content selected and displayed. GT.91 Displays dashboard data in a variety of formats including tables and charts. CRITICAL Yes GT.92 Provides customized dashboard content per role and per user. DESIRED No Dashboards are assigned based on individual user’s job role assignment. The Dashboard components are created by Tyler Development. For certain Dashboard components, users can adjust the parameters of the content selected and displayed. General & Technical - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GT.93 Provides a wizard to assist new users in setting up their dashboard for the first time. DESIRED No Dashboards are assigned based on individual user’s job role assignment. The Dashboard components are created by Tyler Development. For certain Dashboard components, users can adjust the parameters of the content selected and displayed. GT.94 Allows for dashboard content to be applied by end user or pushed to users by administrators. DESIRED No Dashboards are assigned based on individual user’s job role assignment. The Dashboard components are created by Tyler Development. For certain Dashboard components, users can adjust the parameters of the content selected and displayed. GT.95 Provides functionality for data surfaced to the dashboard to adhere to user permissions of source application. DESIRED Yes GT.96 Provides integrated help, training, and support materials for dashboard. DESIRED Yes GT.97 Dashboard data includes interactive controls to easily sort and filter data real-time. CRITICAL Yes GT.98 Provides a dashboard view of critical system statuses and key performance indicators for the organization. The organization should be able to both personalize the dashboard for each of their users, as well as customize it for their organization's specific metrics of performance. DESIRED No Dashboards are assigned based on individual user’s job role assignment. The Dashboard components are created by Tyler Development. For certain Dashboard components, users can adjust the parameters of the content selected and displayed. Req. # Description of Requirement Criticality Response from Vendors Comments GT.99 Dashboard data can be output in a variety of formats including, PDF, Excel, or CSV. CRITICAL No Dashboards are assigned based on individual user’s job role assignment. The Dashboard components are created by Tyler Development. For certain Dashboard components, users can adjust General & Technical - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE the parameters of the content selected and displayed. GT.100Dashboard data includes links to drill into source application system for detailed information. DESIRED Yes FORMS PROCESSING: GT.101Allows users to create configurable forms from a rich library of templates. CRITICAL Yes GT.102Forms output configuration options should include, but not be limited to form layout, logo, background and font colors, addresses, and signatures. CRITICAL Yes GT.103Forms processing should allow for customized output options including print, email, and archiving. CRITICAL Yes Standard system processesE-LEARNING TRAINING SOLUTION: GT.104Provides courses integrated with client application environment. DESIRED Yes GT.105Allows searching for classes by subject and to expand modules to see all of the available classes. DESIRED Yes GT.106Provides prerequisites for new users getting started using system programs. DESIRED Yes GT.107Allows submitting of a weekly report on classes taken to the manager. DESIRED Yes General Ledger, Financial Reports & Treasury Management-General RequirementsCity of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GL.1 The system has the ability to provide a General Ledger that is integrated with all other system applications so that reconciliation between applications is user friendly and efficient. CRITICALYes GL.2 The system has the ability to produce monthly, quarterly, and annual statements of revenue and expense and can be subtotaled at multiple levels. CRITICALYes GL.3 The system has the ability to allow month end closings to occur in a new fiscal year without having to close the previous fiscal year, including producing all month end financial statements. CRITICALYes GL.4 The system has the ability to provide a financial statement report writer to allow end users to create user-defined financial statement reports. DESIRED Yes GL.5 The system has the ability to budget at any level in the City's chart of accounts. DESIRED Yes GL.6 The system has the ability to support multi-year funds. CRITICALNo GL.7 The system has the ability to produce balance sheets and other financial reports from a prior closed year and period. CRITICALYes GL.8 The system has the ability to store at least 1O years of transactional data. CRITICALYes GL.9 The system has the ability to store at least 5 years of transactional data. CRITICALYes GL 1 O The system has the ability to restrict user inquiry access to a City defined group of account numbers. DESIRED Yes I GL. 11 The system has the ability to restrict user transactions to a City defined group of account numbers. DESIRED Yes GL.12 The system has the ability to carry the entire chart of accounts forward, even accounts with zero balances or accounts that have no activity to eliminate the need to manually key these accounts into the system. CRITICALYes Req. # Description of Requirement Criticality Response Comments General Ledger, Financial Reports & Treasury Management-General RequirementsCity of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE from Vendors GL.13 The system has the ability to only carry forward active accounts, even if they have zero balances. CRITICALYes GL.14 The system has the ability to not carry forward accounts with zero balances. DESIRED NoGL.15 The system has the ability to not carry forward inactive accounts. DESIRED No GL.16 The system has the ability to perform "soft closes" on periods so that a period may be opened again with proper permissions for the purposes of posting activity to that period CRITICAL Yes GL.17 The system has the ability to perform "hard closes" on periods so that a period is closed for the purposes of not posting activity to that period. CRITICAL Yes GL.18 The system has the ability to record a journal entry type (Document Type) in the general ledger forreconciliation purposes. DESIRED Yes GL.19 The system has the ability to drill down to see all account activities, to include the related accounts of the source journal. DESIRED Yes GL.20 The systemhas the ability to allow users to retrieve GL related information that is more than one year old. CRITICAL Yes GL. 21 The system provides fund accounting capability that complies with GAAP and GASB standards CRITICAL Yes GL. 22 The system has the ability to display clear and understandable reasons for rejecting general ledger transactions. CRITICAL Yes GL.23 The system has the ability to provide at least 13 periods, including one for entering annual closing entries which acts as a closing period and one for audit adjustments. DESIRED Yes GL. 24 The system has the ability to either automatically generate or copy chart of account records when creating new funds, departments, and any other reorganizations. CRITICAL Yes Req. # Description of Requirement Criticality Response Comments General Ledger, Financial Reports & Treasury Management-General RequirementsCity of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE from Vendors GL. 25 The system has the ability to change the name of any segment of the account number while leaving the historic description the same DESIRED Yes GL. 26 The system has the ability to provide security at a City-determined level in the chart accountsCRITICAL Yes GL. 27 The system has the ability to support the following fields in the chart of accounts: Please describe the account structure needs here CRITICAL *No COA structure listed GL. 28 The system has the ability to use workflow technology to automatically route journal entries to approvers prior to posting. DESIRED Yes GL. 29 The system has the ability to provide standard and recurring journal entry capabilities. DESIRED Yes GL.30 The system has the ability to maintain at least five years of detailed journal entry transactions and budget information and provides the ability to maintain greater than five years if desired. CRITICAL Yes GL.31 The system has the ability to maintain at least ten years of detailed journal entry transactions and budget information and provides the ability to maintain greater than ten years if desired. CRITICAL Yes GL.32 The system has the ability to generate date-specific reversing entries. CRITICAL Yes GL.33The system has the ability to automatically assign sequential numbers to all journal entry transactions for audit trail purposes. CRITICAL Yes General Ledger, Financial Reports & Treasury Management-General RequirementsCity of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GL.35 The system has the ability to support debt management schedules. CRITICAL No GL.36 The system has the ability to assign and track an investment that is associated with one or more funds. DESIRED Yes GL.37 The systemhas the ability to allocate investment earnings to another fund DESIRED Yes GL.38 The system has the ability to setup a fund as non-interest bearing. CRITICAL Yes GL.39 The system has the ability to provide linkage between reportable sections of the CAFR (e.g., Exhibits, Management Discussion and Analysis, Notes to the Financial Statements and Statistics). CRITICAL Yes Through CAFR reporting GL.40 T_he system has the ability to export to various formats to create a custom designed CAFR or financial reporting document. CRITICAL No The Tyler CAFR application produces the reports for a CAFR, but does not produce the entire CAFR GL.41I The system has t_he ability to generate a report across any segment or group of segments in the chart of accounts. CRITICAL Yes GL.42 The system has the ability to generate a report of all accounts within the chart of accounts by fund, department, account, sub-account, and other user defined. CRITICAL Yes GL.43 The system has the ability to distribute reports via electronic workflow. DESIRED Yes GL.44 The system has the ability to warn t e use they are about to print a large report (displays number of pages) with option to proceed. DESIRED No Users can continue working in other areas, even if a report is running in the background. GL.45 The system has the ability to print reports in a "printer-friendly" mode. DESIRED Yes Not exactly sure what “Printer Friendly” means, but the Tyler Applications will utilize any installed Printer.GL.46 The system has the ability to provide real-time reporting on all current balances. CRITICAL Yes GL.47 The system has the ability to display all reports to the screen with a DESIRED Yes *There are Print Screen options General Ledger, Financial Reports & Treasury Management-General RequirementsCity of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE user- defined option for printing, with the ability to turn this feature on or off (e.g. print screen). Throughout the system, as well as Reports automatically opening to the Screen prior to printing. GL.48 The system has the ability to provide comparison reports (e.g. between different periods, as user-defined). DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments GL.49 The system has the ability to produce monthly, quarterly, and annual financial statements without the need for a financial report writer. (Income sheet, Balance Sheet, Budget Comparisons by Department, etc.) DESIRED Yes GL.50 The system provides GAAP and GASB compliance reports CRITICALYes GL.51 Available budget by expense and revenue code; CRITICAL Yes GL.52 Cash balance (e.g., by department, fund, etc.);CRITICAL Yes Inception to date, for total expenditures for all City projects; CRITICAL Yes Expenditures relative to budget; CRITICAL Year-to-date expendi tures; CRITICAL Yes Year and month to date expenditures; CRITICAL Yes Budget to actual by all budget line items; CRITICAL Yes Open encumbrance report; CRITICAL Yes Pre-encumbrance report; CRITICAL Yes Income statement; CRITICAL Yes Cash flow; CRITICAL Yes Balance sheet; CRITICAL Yes Statement of net assets; CRITICALYes Schedule of expenditures and revenues based on type of revenue; CRITICALYes Trial balance activity (debits and credits); CRITICALYes Statement of revenues and expenditures; CRITICALYes Capital projects; CRITICALYes Detail and summary project report; CRITICALYes Multi-year grants for revenues and expenses; CRITICALYes Expense Budget at any level; CRITICALYes Cash Balance by Fund; CRITICALYes General Ledger, Financial Reports & Treasury Management-General RequirementsCity of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Cash Balance by Fund with associated detail; CRITICALYes Detailed Transaction Listing by Vendor Number; CRITICAL Yes Detailed Transaction Listing by Vendor Invoice Number; CRITICAL Yes Payable Grid General Fund Financial Statements; and CRITICALYes Other, user defined. DESIRED Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments General Requirements BD.1 The system has the ability for the Budgeting module to use the same chart of accounts as the rest of the system. CRITICAL Yes BD.2 The system has the ability to integrate with the Payroll and Human Resources CRITICAL Yes BD.3 The system has the ability to integrate with Payroll and Human Resources module enabling the inclusion of payroll information into the budget in real-time.CRITICAL Yes BD.4 The system has the ability to provide payroll and benefit information by position, for budgeting purposes. CRITICAL Yes BD.5 The system has the ability to provide payroll and benefit information by employee, for budgeting purposes. DESIRED Yes BD.6 The system has the ability to store a minimum of five years budget-to-actual at any account level. CRITICAL Yes BD.7 The system has the ability to store a minimum of ten years budget-to-actual at any account level. CRITICAL Yes BD.8 The system has the ability to provide a department user interface to maintain, monitor, and manage detailed department level budgets with workflow approval and appropriate security permissions. CRITICAL Yes BD.9 The system has the ability to provide a memo field of a minimum of 500 characters to store notes for each budgeted account. CRITICAL Yes BD.10 The system has the ability for notes to entered at each level of the workflow approval process. CRITICAL Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments BD.11 The system has the ability to calculate a total for multiple sub-entries for each budgeted account line to identify the budget line detail. DESIRED Yes BD.12 The system has the ability to display budget-to-actual with percentages of available budget for an account or group of accounts at any time.CRITICAL Yes BD.13 The system has the ability to provide real-time reporting on current balances specified line item accounts and line item account activity. CRITICAL Yes BD.14 The system has the ability to provide budgetary control at the department level to control spending based on user-defined criteria. DESIRED YesBD.15 The system has the ability to allow analysis of the current year budget by providing reports that indicate all of any combination of budget-to-actual revision, invoices, encumbrances, requisitions and available balance. CRITICAL Yes BD.16 The system has the ability to "roll" the budget through at least 6 process levels (e.g., budget entry, Administration review, etc.). CRITICAL Yes BD.17 The system has the ability to roll user-defined parts of the budget. CRITICAL Yes BD.18 The system has the ability to support web-based inquiry for account balances. CRITICAL Yes BD.19 The system has the ability to create next year's budget prior to closing the current year as well as enter transactions against next year's budget while in the current year. CRITICAL Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to provide a budget dashboard new of key indicators including but not limited to: BD.20 Budget to actual; CRITICAL Yes BD.21 Project completion;CRITICAL Yes BD.22 Fund; CRITICAL Yes BD.23 Project; CRITICAL Yes BD.24 Department CRITICAL Yes BD.25 Grant; CRITICAL Yes BD.26 Current year-to-date compared to previous Year-t-date; and CRITICAL Yes BD.27 Other, user defined. DESIRED No Dashboards are assigned based on individual user’s job role assignment. The Dashboard components are created by Tyler Development. For certain Dashboard components, users can adjust the parameters of the content selected and displayed. BD.28 The system has the ability to allow budget dashboards to be configured and saved for individual users (either by user, super-user or system administrator). DESIRED Yes Based on user Roles, but not by individual user. BD.29 The system has the ability to add attachments at the detail level of the budget such as Microsoft Word, Microsoft Excel, and Adobe PDF documents. CRITICAL Yes BD.30 The system has the ability to support roll-up codes for grouping accounts together for budgeting.DESIRED Yes BD.31 The budget preparation system should at a minimum, contain at least three previous fiscal years, and current fiscal year CRITICAL Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE BD.32 The budget preparation system should at a minimum, contain at least five future fiscal years DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments Budget Preparation BD.33 The system has the ability to produce a unified, City-wide budget that is automatically consolidated from electronic inputs of different departments. CRITICAL Yes BD.34 The system has the ability to support at least 99 versions of a budget with versioning for each. DESIRED Yes BD.35 The system has the ability to store reasons (notes/comments) for each budget version.DESIRED Yes BD.36 The system has the ability to name budget versions. DESIRED Yes The system has the ability to prepare budgets that accommodate the following: BD.37 Department budget; CRITICAL Yes BD.38 Division budget;CRITICAL Yes BD.39 Fund budget; CRITICAL Yes BD.40 Grant budget; CRITICAL Yes BD.41 Capital project budget; and CRITICAL Yes BD.42 Program budget (i.e. cross departmental budgeting); and CRITICAL Yes BD.43 Other; user defined. DESIRED Yes The system has the ability to load budget amounts based on one or more of the following: BD.44 Current year's original budget; CRITICAL Yes BD.45 Previous year's adopted budget; CRITICAL Yes BD.46 Previous year's actual (with the ability to select which years). CRITICAL Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE BD.47 Any previous year adopted budget or actual with percentage increase. CRITICAL Yes BD.48 Any previous year adapted budget or actual with percentage decrease and CRITICAL Yes BD.49 Other, user defined. DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments BD.50 The system has the ability to load budget information from third party software (e.g. Excel and Access). CRITICAL Yes BD.51 The system has the ability to allow administrators to pre-populate fields, allowing individual departments to fill in budget information easily in a template format. CRITICAL Yes BD.52 The system has the ability to allow new budgets to be created from historical financial information or past budgets. CRITICAL Yes BD.53 The system has the ability to identify and provide last fiscal year's outstanding encumbrances as adjustments to new fiscal year's adopted budget and is able to be incorporated into the general ledger based on user-defined criteria. DESIRED Yes BD.54 The system has the ability to carry all budget line accounts forward for budgeting purposes to eliminate the need to manually key these accounts into the system. CRITICAL Yes BD.55 The system has the ability to support the submission of a detailed budget, one that includes revenue sources, detailed expenditures, multi-funding sources, multi-year budget and matching funds. CRITICAL Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE BD.56 The system has the ability to support the workflow of the City's budget process, with different phases and approval processes. CRITICAL Yes BD.57 The system has the ability to support electronic workflow of notifications for reviewing the budget. CRITICAL Yes BD.58 The system has the ability to provide on-line budget review capabilities for individual departments. CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments BD.59 The system has the ability to prevent users from making changes to a proposed departmental budget without appropriate approval. DESIRED Yes Budget Maintenance BD.60 The system has the ability to track budget amounts at the line item level in the chart of accounts.DESIRED Yes BD.61 The system has the ability to track the original budget, amendments made during the year, and distinguish between the two. DESIRED Yes BD.62 The system has the ability to allow the budget to be amended during the year by authorized personnel and provides an audit trail of those amendments. DESIRED Yes The system has the ability to store the following information when a budget adjustment/amendment is made: BD.63 Type of change; DESIRED Yes BD.64 Reason for change; DESIRED YesBD.65 Original requestor of change; DESIRED Yes BD.66 Approvers of change; DESIRED Yes BD.67 User making change; DESIRED Yes BD.68 Date and time of change; DESIRED Yes BD.69 Comments/notes; DESIRED Yes BD.70 Scanned and attached documentation; and DESIRED Yes BD.71 Other, user defined. DESIRED Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE BD.72 The system has the ability to allow intrafund transfers to funding from one department to another, through workflow, with appropriate permissions and approvals. DESIRED Yes BD.73 The system has the ability to allow intrafund transfers to funding between line items within a single department to another, through workflow, with appropriate permissions and approvals. DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments BD.74 The system has the ability to lockout changes to the budget after user-defined dates. DESIRED Yes BD.75 The system has the ability to provide internal controls for making budget adjustments.CRITICAL Yes Multi-Year and Capital Improvement Budgeting BD.76 The system has the ability to accommodate multi-year projects for budget purposes, to include life-to-date appropriations, adopted budget new appropriations, and be fully integrated with the financial system and other modules.CRITICAL Yes BD.77 The system has the ability to provide a framework or model for CIP budgeting, so that once a budget model is built, changes to the budget only require entering variance amounts. DESIRED Yes BD.78 The system has the ability to view the budget for a multi-year project excluding encumbrances and carry-forward amounts of budget balances. DESIRED Yes BD.79 The system has the ability to allow for multiple funding sources for multi-year projects. DESIRED Yes BD.80 The system has the ability to track budget, expenditures, and funding sources for grants and multi-year projects. DESIRED Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE BD.81 The system has the ability to export CIP and other project data to a project management tool (e.g. MS Project). DESIRED Yes Assuming MS Projects can read an Excel Spreadsheet BD.82 The system has the ability to import CIP and other project data to a project management tool (e.g. MS Project). DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments BD.83 The system has the ability to import data from other City systems for the purposes of outcome-based budgeting. CRITICAL Yes BD.84 The system has the ability to attach CIP and other project data (e.g. MS Excel).CRITICAL Yes BD.85 The system has the ability to create fixed cost CIP budgets based on prior year actual activity, anticipated rate increases and anticipated capital asset additions (i.e. utility charges, equipment replacement, fleet maintenance and fuel). CRITICAL Yes Projection Scenarios with GL Budgeting for CIP BD.86 The system has the ability to create replacement and maintenance CIP budgets based on an items useful life, annual maintenance, and annual replacement contributions. DESIRED No BD.87 The system has the ability to allow administrators to pre-populate fields, allowing individual department to fill in CIP budget information, with an option by period, easily in a template format. DESIRED Yes Budgeting Process BD.88 The system has the ability to lockout changes to the CIP budget after user-defined dates and criteria. DESIRED Yes Budgeting Process Forecasting MD.89 The system has the ability to provide a budget DESIREDYes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE model or framework for forecasting purposes. The system has the ability to provide budget trending and forecasting capabilities including: BD.90 Straight line projection; CRITICAL Yes BD.91 Percentage based on last year actual; CRITICAL Yes Budget Projection Scenario BD.92 Percentage based on last year budgeted; and CRITICAL Yes Budget Projection Scenario BD.93 Other, user defined.DESIRED Yes Budget Projection Scenario Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to provide salary and benefit forecasting capabilities based on the import/integration from the payroll application including: BD.94 Number of positions;CRITICAL Yes BD.95 Multiple types of pay;CRITICAL Yes BD.96 Current salary ranges;CRITICAL Yes *Current Salary BD.97 Bonuses and overtime;CRITICAL Yes BD.98 Longevity;CRITICAL Yes BD.99 Holiday pay days;CRITICAL Yes BD.100 Fringe benefit changes; andCRITICAL Yes BD.101 Other, user defined.CRITICAL Yes *Depending on what this includes The system has the ability to accommodate automated expenditure analysis of multiple elements including: BD.102 Expenditures and revenues to date;CRITICAL Yes QBE BD.103Encumbrances;CRITICAL Yes QBEBD.104 Outstanding invoices;CRITICAL Yes QBE BD.105 Outstanding payments;CRITICAL Yes QBE BD.106 Balance available to spend;CRITICAL Yes QBE (Budget Remaining) BD.107 Estimate of expenditures to year end;CRITICAL Yes (Encumbrances, Budget Remaining, etc.) BD.108 Expected total expenditures for the year;CRITICAL Yes Budget BD.109 Estimate of revenues to year endCRITICAL Yes Budget BD.110 Estimated total revenues to year endCRITICAL Yes Revenue Budget Remaining BD.111 Collected revenue; andCRITICAL Yes YTD Revenue BD.112 Other, user defined.DESIRED No If exported to Excel, manual entry. BD.113 The system has the ability to allow multiple users to build and save budget forecasting scenarios. DESIRED Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE BD.114 The system has the ability to allow at least 99 budget forecasting models to be saved. DESIRED Yes BD.115 The system has the ability to enter and store notes and comments or attach supporting documentation to each budget forecast model. CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments BD.116 The system has the ability to allow budget forecast/models to be named. CRITICAL Yes BD.117 The system has the ability to provide long-term forecasting capabilities for a minimum of five years in the future. CRITICAL Yes BD.118 The system has the ability to provide "what if" scenario projections for the budget.CRITICAL Yes Reporting BD.119 The system has the ability to export budget data to Microsoft Excel.CRITICAL Yes BD.120 The system has the ability to import budget data from Microsoft Excel.CRITICAL Yes BD.121 The system has the ability to integrate with common desktop publishing applications for producing the final or "presentation" budget document (e.g. MS Word, MS Excel)CRITICAL Yes BD.122 The system has the ability to track and report on adjustments made to the budget during the year.CRITICAL Yes BD.123 The system has the ability to report on budgets at any level of the chart of account structure.CRITICAL Yes BD.124 The system has the ability to allow analysis of current year budget by providing reports that indicate budget-to-actual revisions. DESIRED Yes BD.125 The system has the ability to allow analysis of current year budget by providing reports that CRITICAL Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE indicate budget-to-actual invoices. BD.126 The system has the ability to allow analysis of current year budget by providing reports that indicate budget-to-actual encumbrances. CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments BD.127 The system has the ability to allow analysis of current year budget by providing reports that indicate budget-to-actual requisitions. CRITICAL Yes BD.128 The system has the ability to allow analysis of current year budget by providing reports that indicate budget-to-actual balance. CRITICAL Yes BD.129 The system has the ability to project and report on end of year accruals (e.g. payroll). CRITICAL Yes Leave Liability Report BD.130 The system has the ability to query for specific words in budget line items. CRITICAL Yes BD.131 The system has the ability to allow "wildcard" searches for a portion of a word. CRITICAL Yes BD.132 The system has the ability to allow "drill-down" from any line item in a system generated report. CRITICAL Yes BD.133 The system has the ability to provide a budgeted line item sub-entry report (e.g. for line items that include multiple sub-entries in order to expand and identify any budget line detail). DESIRED Yes BD.134 The system has the ability to allow analysis of current year budget by providing reports that indicate budget-to-actual requisitions. CRITICAL Yes BD.135 The system has the ability to provide budget-to-actual reports by user-defined fields, such as by funds, organizations or accounts. CRITICAL Yes Depending on COA BD.136 The system has the ability to generate comparative budget to actual revenue reports. CRITICAL Yes Budgeting – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE BD.137 The system has the ability to print original budget plus any changes/amendments to reach the final budget from prior years (i.e. the full life cycle of a prior year budget). CRITICAL Yes Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GENERAL PROGRAM CAPABILITIES: Purchasing: PU.1 Ability to accommodate user defined vendor categories (e.g., Disadvantaged Business Enterprises, Problem vendors, etc.). DESIRED Yes PU.2 Ability to produce labels (or a label file for export) for vendors requiring a W-9. CRITICAL Yes PU.3 Ability to maintain multiple location addresses for each vendor. Please utilize the Comments column to notate the maximum number of addresses for each vendor. CRITICAL Yes PU.4 Ability to provide a vendor comment file that may contain a user-defined amount of information, viewable by any user but updateable only by users with authorized security. DESIRED Yes PU.5 Ability to maintain and print out an audit trail for changes to the vendor master file. CRITICAL Yes PU.6 Ability for users with authorized security to add or change vendor master file records. CRITICAL Yes PU.7 Ability to hide inactive vendors after a user-specified period of time without activity, with appropriate workflow approval.DESIRED Yes PU.8 Ability to add user defined fields to the vendor file. DESIRED Yes PU.9 Ability to delete vendors after a user-specified period of time without activity. NA Yes Ability to track the following fields on the Vendor file: DESIRED Yes PU.10 Name CRITICAL Yes PU.11 DBA Name CRITICAL Yes PU.12 Title (e.g., Dr., Attorney, etc.) CRITICAL Yes PU.13 Employee designation CRITICAL Yes PU.14 Vendor number CRITICAL Yes PU.15 Multiple addresses (i.e., bid, orders, multiple remit to, etc.) (Please list in the Comments column the number of addresses allowed per vendor.) CRITICAL Yes PU.16 Vendor e-mail & web site information CRITICAL Yes PU.17 Contact person(s) CRITICAL Yes PU.18 Federal Tax Identification Number (TIN) CRITICAL Yes Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PU.19 Phone, mobile phone, and fax number(s) CRITICAL Yes PU.20 Minority/woman/disadvantaged business indicator DESIRED Yes PU.21 Last date vendor utilized CRITICAL Yes PU.22 Default chart of account information CRITICAL Yes PU.23 Payment methods DESIRED Yes PU.24 Type of company (e.g., corporation, partnership, etc.) CRITICAL Yes PU.25 Commodity DESIRED Yes PU.26 Standard payment terms DESIRED Yes PU.27 Problem vendor flag DESIRED Yes As a user-defined field. PU.28 Preferred vendor flag DESIRED Yes As a user-defined field. PU.29 Vendor-on-hold flag (e.g. litigation, payment dispute, etc.) CRITICAL Yes PU.30 Other user-defined information DESIRED Yes PU.31 Ability to classify one-time vendors. DESIRED Yes PU.32 Ability to track vendor performance DESIRED No PU.33Ability to track the following by vendor but limited to: purchase orders, invoices, contracts, awarded bids, checks DESIREDYes Requisitions PU.34 Ability to electronically process multi-delivery, direct ship, blanket and non-blanket requisitions.DESIRED Yes PU.35 Ability to display multiple account numbers on any line item on requisitions. DESIRED Yes PU.36Ability to punch-out to cXML vendor hosted web sites for online shopping catalogs. DESIREDYes PU.37 Ability to requisition with or without commodity description. DESIRED Yes Ability to perform the following requisition functions, with the appropriate security: PU.38 Inquiry CRITICAL Yes PU.39 Add CRITICAL Yes PU.40 Change CRITICAL Yes PU.41 Reject CRITICAL Yes Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PU.42 Delete CRITICAL Yes PU.43 Ability to provide for multiple lines of input per individual requisition. DESIRED Yes PU.44 Ability to provide reports to users and management on requisition status. DESIRED Yes PU.45 Ability to create and track all requisitions by date, by requester, by budget, by item, by action item, etc. CRITICAL Yes PU.46 Ability to check against the budget and pre-encumber requisition per line item. DESIRED Yes PU.47 Ability to modify items ordered through change order (add or delete) including part, class, quantity, unit of measure, vendor, cost, project, fund, with the appropriate security. DESIRED Yes PU.48 Ability to track requisitions and automatically date and time stamp (received, accepted, returned, re-received) with notes and comments.DESIRED Yes PU.49 Ability to convert lines of requisitions to multiple purchase orders and different vendors. DESIRED No PU.50Ability to carry forward approval and user contact information from the requisition to the purchase order. DESIREDYes PU.51 Ability to limit general ledger distribution accounts to only those valid for that department/user. DESIRED Yes PU.52 Ability to have multiple line items per purchase order with capability for one/multiple delivery schedules per line printed on purchase order. DESIRED YesPU.53 Ability to automatically or manually number requisitions with the ability to restart the numbering process with each fiscal year. CRITICAL Yes PU.54 Ability to create purchase orders from requisitions. DESIRED Yes PU.55 Ability to allow for unlimited standard and free form messages at the header and line item level. DESIRED Yes PU.56 Ability to generate bill to and ship to information automatically with secondary or internal delivery to location. DESIRED YesPU.57 Ability for requisition to specify multiple delivery dates and locations by line item. DESIRED Yes Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PU.57 Ability for requisition to specify multiple delivery dates and locations by line item. DESIRED Yes PU.58 Ability to request a budget transfer as part of the requisition process DESIRED No PU.59 Ability to notify originator when requisitions have been rejected. DESIRED Yes PU.60 Ability to assign a requisition to a project DESIRED Yes PU.61 Ability to create unique workflow rules by department, dollar amount, general ledger account or user. DESIRED Yes PU.62 Ability for user to check on status of workflow approval DESIRED Yes PU.63 Ability to interface to a contract file for contract items DESIRED Yes PU.64 Ability to create a pick ticket if item is in inventory DESIRED Yes PU.65 Ability to create requisition for a particular work order and task DESIRED Yes PU.66 Ability to change terms and discounts with proper security. DESIRED No Reports: PU.68 Ability to produce ad hoc reports using a report writer (i.e., SQL Server Reporting Services) CRITICAL Yes PU.69 Ability to produce charts, highlight figures, create tables using the ad hoc report writer. CRITICAL Yes PU.70 Ability to provide security for ad hoc report writer to ensure only users with permissions can access appropriate information. DESIRED Yes PU.71 Ability to create PDF files or HTML links. CRITICAL Yes PU.72 Ability to schedule reports for regular production (i.e., monthly, bi-weekly, etc.). CRITICAL Yes PU.73 Ability for scheduled reports to be emailed to a user. CRITICAL Yes PU.74 Ability to export queries to popular desktop applications (i.e., Excel, Word). CRITICAL Yes PU.75 Ability to create a requisition report, which can be sorted by buyer. DESIRED Yes PU.76 Ability to display and/or print any / all reports and screens. DESIRED Yes PU.77 Ability to generate vendor reports based upon user defined criteria. DESIRED Yes Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PU.78 Ability to track and report on requisition, purchase order and receiving information. DESIRED Yes PU.79 Ability to merge requisitions into single purchase order to be sent to vendor. DESIRED Yes PU.80 Ability to create an unlimited number of user defined fields on a requisition. DESIRED Yes PU.81 Ability to attach documents to a requisition and have those flow onto purchase order. DESIRED Yes PU.82 Ability to create a bid or contract from a requisition DESIRED No PU.83 Ability to create both current and next year requisitions with proper permissions. DESIRED Yes PU.84 Ability to create a requisition with a vendor on the fly. DESIRED Yes PU.85 Ability to indicate on requisition if three-way match is required. DESIRED No Not required, but can be tracked. PU.86 Ability to customize requisition screens so user only sees fields that are pertinent to them. DESIRED Yes PU.87 Ability to copy line items within a requisition or copy the entire requisition to a new one. DESIRED Yes PU.88 Ability to establish shipping locations per line item. DESIRED Yes Purchase Orders: PU.89 Ability to support encumbrance control for budgeted funds. DESIRED Yes PU.90 Ability to support soft pre-encumbrance control, whereby a warning is given if sufficient funds are not available. DESIRED Yes PU.91 Ability to copy information from one process to another without rekeying (i.e., requisition to purchase order). DESIRED Yes PU.92 Ability to copy, paste all information. DESIRED Yes PU.93 Ability for the purchase order to be submitted back to the vendor via the cXML interface if noted to do so on the vendor profile. DESIRED Yes PU.94 Ability to drill down to supporting documents within the purchasing system. DESIRED Yes Yes Yes Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Ability to establish and maintain information concerning: PU.95 Vendors CRITICAL Yes PU.96 Commodities and a commodity coding structure (NIGP codes) DESIRED Yes PU.97 Standards or specifications for items acquired DESIRED Yes PU.98 Standard text for terms and conditions of purchases DESIRED Yes PU.99 Ability to record and maintain history of purchases, commodities, and volumes. DESIRED Yes PU.100 Ability to support workflow for procurement approval process, including multiple approvals at the departmental and central purchasing levels. DESIRED Yes PU.101 Ability to support two-way and three-way matching of documents. DESIRED Yes PU.102 Ability to support automatic entry into other modules, such as inventory, work orders and capital assets from purchasing. DESIRED Yes PU.103 Ability to maintain history of all purchasing processes including requisitions and multiple types of purchases. DESIRED Yes PU.104 Ability for end-users to check expenditures to date against encumbrances and budgets and see results on-line in real time prior to processing an expenditure request. DESIRED Yes PU.105 Ability to support updating general ledger accounts for all procurement transactions. DESIRED Yes PU.106 Ability to look up real-time status of purchasing processes. DESIRED Yes PU.107 Ability to track last purchase date and amount for any item. DESIRED Yes PU.108 Ability to track expenditures against credit cards issued to employees. DESIRED Yes PU.109 Ability to utilize imaged or scanned documents such as vendor invoices and other source documents. DESIRED Yes PU.110 Ability to accommodate partial receipts. DESIRED Yes PU.111 Ability to detect and measure early / late and over / under shipments. DESIRED Yes PU.112 Ability to maintain discrepancy file by vendor, stock number, item, dates, control number, purchase order number (receiving exception file). DESIRED Yes PU.113 Ability to manually flag purchases for fixed asset tables upon receipt of good, with the appropriate security. DESIRED Yes PU.114 Ability to audit receiving data by logon ID, date, time, etc. DESIRED Yes Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PU.115 Ability to flag received goods for entry into inventory by item number. DESIRED Yes PU.116 Ability to select all during purchase order receiving. DESIRED Yes PU.117 Ability to support electronic (on-line) or fax capabilities for purchase orders and other vendor/procurement functions. DESIRED Yes Electronic not Fax. Although it is not an Incode feature specifically, yes you can fax POs. It is a Windows feature that if you have faxing capability on your computer you can select fax vs printer. PU.118 Ability to create purchase order user defined fields that are available during purchase order entry process.DESIRED Yes PU.119 Ability to allow purchase orders created from requisitions to automatically post. DESIRED Yes PU.120Ability to support purchasing thresholds by vendor (e.g., $25,000 bid limit). CRITICALYes Using Contracts module. PU.121 Ability to support one master vendor file for all modules in the system, with security on the ability to change and/or update vendor records. CRITICAL Yes PU.122 Ability to detect duplicate vendor information upon entry of vendor information. CRITICAL YesPU.123 Ability for purchase orders to specify multiple delivery dates and locations by line item. DESIRED Yes PU.124 Ability to allow transactions with valid vendors only. DESIRED Yes PU.125 Ability to allow the selective inactivation or purging of vendor records by user-defined criteria. DESIRED Yes PU.126 Ability to search for a vendor by item code, number, or description (in other words, attach vendor to an item(s)). DESIRED Yes Ability to maintain statistics in dollar amounts for each vendor for user-specified periods for the following criteria: PU.127 Payment history CRITICAL Yes PU.128 Discounts taken CRITICAL Yes PU.129 Purchase price variances CRITICAL Yes PU.130 Ability to effective date transactions, either before or after the current date. CRITICAL Yes Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PU.131 Ability to enter a percentage discount on the purchase order. CRITICAL No PU.132 Ability to enter future dates beyond the end of the fiscal year CRITICAL Yes PU.133 Ability to mass close purchase orders. CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments PU.134 Ability to summarize charges on an account and project level at the end of a purchase order. CRITICAL Yes PU.135 Ability to create purchase order change orders to the original purchase order document and update general ledger accordingly. CRITICAL Yes PU.136 Ability to have an integrated document management system where you can view all related documents within the purchasing module (requisition, purchase order, invoice and accounts payable check). CRITICAL Yes Provide for the following carry forward methods for PO's at year end: PU.137 GAAP CRITICAL Yes PU.138 Budgetary CRITICAL Yes PU.139 GAAP/Budgetary CRITICAL Yes PU.140 Transfer CRITICAL Yes PU.141 Ability to disencumber the purchase order from the prior year; re-encumber and charge the expense to the current year. CRITICAL Yes PURCHASE ORDER REPORTSPU.142 Ability to produce ad hoc reports using a report writer (i.e., SQL Server Reporting Services). CRITICAL Yes PU.143Ability to produce charts, highlight figures, create tables using the ad hoc report writer. CRITICALYes PU.144 Ability to provide security for ad hoc report writer to ensure only users with permissions can access appropriate information. CRITICAL Yes PU.145Ability to create PDF files or HTML links. CRITICAL YesPU.146 Ability to schedule reports for regular production (i.e., monthly, bi-weekly, etc.). CRITICAL Yes PU.147 Ability for scheduled reports to be emailed to a user. CRITICAL Yes PU.148 Ability to export queries to popular desktop applications (i.e., Excel, Word). CRITICAL Yes Ability to create the following purchasing reports: Purchasing - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PU.149 Open purchase orders report by expense account DESIRED Yes PU.150 Open purchase orders report by due date DESIRED Yes PU.151 Open purchase orders report by vendor DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments PU.152 Open purchase orders report by commodity code DESIRED Yes PU.153 Open purchase orders audit report DESIRED Yes PU.154 Items not received listing DESIRED Yes PU.155 Ability to generate reports of all purchase orders based on calculated user-defined criteria (e.g., >$2500 or between 5/1/ and 6/1). DESIRED Yes PU.156 Ability to process workflow for purchase order change orders. DESIRED Yes PU.157 Ability to mass cancel selected purchase orders prior to yearend processing. DESIRED Yes PU.158 Ability to carry forward open encumbrances to the new year. DESIRED Yes PU.159 Ability to indicate on the purchase order if three-way match is required. DESIRED No Not required, but can be tracked. PU.160 Ability for purchase order receiving to automatically generate an inventory receipt transaction DESIRED Yes PU.161 Ability to match open purchase order encumbrances to associated general ledger accounts. DESIRED Yes PU.162 Ability to have up to 199-line items on a purchase order. DESIRED Yes PU.163 Ability to have multiple accounts on a purchase order line. CRITICAL Yes PU.164 Ability to have up to a 210-character description on purchase order line items. DESIRED Yes PU.165 Ability to define ship-to locations per purchase order line item. DESIRED Yes Accounts Payable- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments General Requirements AP.1 The system has the ability to view approval status of purchase orders and requisitions. DESIRED Yes AP.2 The system has the ability to produce a full audit trail on all transactions CRITICAL Yes AP.3 The system has the ability to print 1099 forms on a laser printer. CRITICAL Yes AP.4 The system has the ability to transmit 1099 forms electronically per federal government regulations CRITICAL Yes AP.5 The system has the ability to accommodate 3-way matching of purchase order, receiving documents, and invoice. DESIRED Yes AP.6 The system has the ability to set a tolerance at invoice level by department, which can limit the amount of override allowed on an invoice. DESIRED Yes AP.7 The system has the ability to support electronic workflow for approvals by dollar amount DESIRED Yes AP.8 The system has the ability to support electronic workflow for approvals by general ledger account number. CRITICAL Yes AP.9 The system has the ability to import purchasing card transaction detail. DESIRED Yes AP.10 The system has the ability to support "positive pay." The system has the ability to send an electronic file of all checks, including system-driven I manual checks, to the City's bank for comparison with checks being cashed in order to help reduce opportunities for fraud. DESIRED Yes AP.11 The system has the ability to accept an import file from utility companies for payment. DESIRED Yes AP.12 The system has the ability to distribute journal entries from accounts payable to general ledger immediately (real-time) or in batch. CRITICAL Yes AP.13 The system has the ability to make corrections or additions to any field or screen throughout the purchasing process with appropriate security and with an audit trail of all changes (i.e., PO Corrections, Invoice Corrections). CRITICAL Yes AP.14 The system has the ability to make corrections or additions to any field or screen throughout the purchasing process with appropriate security and with an audit trail of all changes including after the time of payment for select information (i.e. description or attachments). CRITICAL Yes Accounts Payable- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Invoice Entry AP.15 The system has the ability to support decentralized invoice entry at the department level. CRITICAL Yes AP.16 The system has the ability to support batch, multiple or individual invoice entry. CRITICAL Yes AP.17 The system has the ability to support at least a 35-character invoice number field. CRITICAL Yes AP.18 The system has the ability to accommodate partial payment. CRITICAL Yes AP.19 The system has the ability to support at least a 256-character invoice description field. DESIRED Yes AP.20 The system has the ability to have an applied date in a fiscal year based on the invoice date (i.e. when receiving an invoice in a new fiscal year dated for a previous fiscal year). CRITICAL Yes The system has the ability to support multiple status modes for invoices including but not limited to the following: AP.21 Pending; CRITICAL Yes AP.22 Open; CRITICAL Yes AP.23 Approved; CRITICAL Yes AP.24 Held; CRITICAL Yes AP.25 Reject; CRITICAL Yes AP.26 Delete; and CRITICAL Yes AP.27 Other, user-defined DESIRED No AP.28 The system has the ability to copy existing invoices to new ones. DESIRED Yes AP.29 The system has the ability to accumulate multiple invoices into one vendor check with the ability to turn this function on and off. CRITICAL Yes AP.30 The system has the ability to electronically attach scanned invoices to the payable entry. CRITICAL Yes AP.31 The system has the ability to flag invoices as reimbursable expenses through the grant process. DESIRED No Accounts Payable- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AP.32 The system has the ability to allow for an invoice to be distributed to (at least) 99 different general ledger accounts. DESIRED Yes AP.33 The system has the ability to automatically split invoices to difference accounts based on user-defined rules. CRITICAL Yes AP.34 The system has the ability to enter invoices upon receipt and select future payment date. DESIRED Yes AP.35 The system has the ability to support recurring invoices CRITICAL Yes AP.36 The system has the ability to hold credit invoices and apply them to future invoices. DESIRED Yes AP.37 The system has the ability to flag invoices during invoice entry required for 1099 processing and reporting. CRITICAL Yes Check Processing, Printing and Reconciliation AP.38 The system has the ability to interface with laser check printers. CRITICAL Yes AP.39 The system has the ability to import a file for bank reconciliation. CRITICAL Yes AP.40 The system has the ability to update the general ledger to account for voided and re-issued checks. CRITICAL Yes AP.41 The system has the ability prohibit duplicate check numbers within the same checkbook. CRITICAL Yes AP.42 The system has the ability to generate manual or off-cycle checks. CRITICAL Yes AP.43 The system has the ability to print checks in numerical order. CRITICAL Yes AP.44 The system has the ability to pay a large number of invoices to one vendor with one check and have stub information printed on an overflow statement. CRITICAL Yes AP.45 The system has the ability to print the entire invoice number on the check. CRITICAL Yes AP.46 The system has the ability to print a minimum of 20 characters in a comments field on the check CRITICAL Yes AP.47 The system has the ability to produce digitized electronic signatures as part of the check printing process. CRITICAL Yes AP.48 The system has the ability to print a check register at pre-determined intervals and on demand. CRITICAL Yes Accounts Payable- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AP.49 The system has the ability to re-print check registers for past dates to include complete activity 9i.e. voided or canceled checks). CRITICAL Yes AP.50 The system has the ability to notify a user and supervisor if check numbers are missing in that time period (i.e. voided or destroyed checks). DESIRED Yes AP.51 The system has the ability to process ACH payments. CRITICAL Yes AP.53 The system has the ability to store multiple email addresses for vendors with designation for a primary. CRITICAL Yes AP.54 The system has the ability to lock the ACH file between processing and transmittal. CRITICAL Yes AP.55 The system has the ability to print month end and year end check register which indicates cleared and/or outstanding checks. CRITICAL Yes AP.56 The system has the ability to drill back to the requisition and supporting documentation that created the purchase order. CRITICAL Yes AP.57 The system has the ability to print a duplicate check during the check printing process. CRITICAL Yes AP.58 The system has the ability to re-run the check printing process CRITICAL Yes Vendor Management AP.59 The system has the ability to search by any field in the vendor file. CRITICAL Yes AP.60 The system has the ability to provide "wild-card" search capability for a work or portion of a word in any field in the vendor file. CRITICAL Yes AP.61 The system has the ability to allow a search query for a single word that may exist in multiple fields within the vendor file (i.e. a search for a particular work in a vendor name but also in a vendor contact name or d/b/a). CRITICAL Yes AP.62 The system has the ability to indicate whether inactive vendors should be included when searching for a field in the vendor file. CRITICAL Yes AP.63 The system has the ability to assign a classification to a vendor by user-defined pick table. CRITICAL Yes AP.64 The system has the ability to provide multiple vendor address fields. CRITICAL Yes AP.65 The system has the ability to allow inquiry-only access to the vendor table. CRITICAL Yes Accounts Payable- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AP.66 The system has the ability to flag a vendor that is not to be used or is inactive. CRITICAL Yes AP.67 The system has the ability to maintain one vendor file that is shared between requisitions, purchase orders, contracts, and accounts payable. CRITICAL Yes AP.68 The system has the ability to integrate with purchasing card systems for the purpose of maintaining a single vendor file. CRITICAL Yes AP.69 The system has the ability to compare vendors that are owed money with vendors that owe the City money and warn the use when this condition exists. CRITICAL No AP.70 The system has the ability to merge vendor records with proper security permissions and an audit trail while maintaining all data for each merged vendor record. CRITICAL Yes AP.71 The system has the ability to attach files to the vendor file for audit purposes (e.g. W9, etc). CRITICAL Yes AP.72 The system has the ability to provide an audit trail for all changes to the vendor file. CRITICAL Yes AP.73 The system has the ability to allow a user to view all of the vendor transactions including purchase orders and purchasing card activity. CRITICAL Yes AP.74 The system has the ability to report on purchase order and purchasing card transactions separately. CRITICAL Yes AP.75 The system has the ability to enter a vendor on the fly or a onetime vendor with appropriate approval and permissions. CRITICAL Yes The system has the ability to notify a user that a vendor already exists when setting up a new vendor based on the following fields with the ability to override based on appropriate security permissions: AP.76 Name; CRITICAL Yes AP.77 Doing-Business-As-Name; CRITICAL Yes AP.78 Address; CRITICAL Yes AP.79 Tax ID; CRITICAL Yes AP.80 Email Address; CRITICALYesAP.81 Phone number; CRITICAL Yes Accounts Payable- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AP.82 Point of contact, and CRITICAL Yes AP.83 Other user-defined criteria DESIRED No Vendor Processing AP.84 The system has the ability to allow for the electronic submission of invoice from venders (e.g., e-bills, etc). DESIRED Yes AP.85 The system has the ability to automatically assign payment terms for vendors and provides the ability to override the payment terms at the vendor and/or invoice level. DESIRED Yes Yes, can automatically assign payment terms but can not change on the invoice. AP.86 The system has the ability to produce 1099 Forms per federal standards. CRITICAL Yes AP.87 The system has the ability to correct errors made in 1099 boxes and recalculate at year end so the information on the final 1099 form is correct. CRITICAL Yes AP.88 The system has the ability to calculate percentage and amount discounts 9i.e. early payments). CRITICAL Yes AP.89 The system has the ability to flag invoices (or groups of invoices) so that more than one check may be written to a vendor in any given check run for those transactions or vendors requiring separate checks. CRITICAL Yes AP.90 The system has the ability to calculate and trach retainage for contractor or subcontractor invoices. CRITICAL No AP.91 The system has the ability to flag a vendor as being a check vendor or an ACH vendor. CRITICAL Yes AP.92 The system has the ability to override a flag on a vendor for ACH to be able to issue a check. CRITICAL Yes AP.93 The system has the ability to track date of last activity for vendors CRITICAL Yes AP.94 The system has the ability to track calendar year-to-date payments in addition to fiscal year-to-date totals. CRITICAL Yes AP.95 The system has the ability to produce tentative 1099 lists fir review before printing or transmitting final list to the IRS. CRITICAL Yes AP.96 The system has the ability to specify the box or line on the 1099 form that the dollar amount will be printed in or on. CRITICAL Yes Yes Accounts Payable- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AP.97 The system has the ability to provide notification of duplicate invoice number entry of same vendor and provides for authorized user override. CRITICAL Yes AP.98 The system has the ability to show amount retained on each vendor/subcontractor check. DESIRED No AP.99 The system has the ability to view and search through vendor list online (alphabetically by bender name and vendor number) and be able to select vendor from that screen for invoice entry. DESIRED Yes AP.100 The system has the ability to change vendor remit-to address. CRITICAL Yes AP.101 The system has the ability to record with an audit trail when the remit-to address is changes. CRITICAL Yes AP.102 The system has the ability to attach files to document the change of address in a vendor file. DESIRED Yes Reporting AP.103 The system has the ability to generate a report of anticipated cash requirement for disbursements. DESIRED Yes AP.104 The system has the ability to generate a report of scheduled checks to be written. CRITICAL Yes AP.105 The system has the ability to generate a vendor master listing report. CRITICAL Yes AP.106 The system has the ability to generate a summary payment report by vendor. CRITICAL Yes AP.107 The system has the ability to generate a report of 1099 vendors by tax category. CRITICAL Yes AP.108 The system has the ability to export report information to MS Word and MS Excel. CRITICAL Yes The system has the ability to generate a report or allow on-screen inquiry of a variety of vendor information (outstanding checks, volume of checks, etc.) AP.109 Vendor; CRITICAL Yes AP.110 Check number CRITICAL Yes AP.111 Date or date range; CRITICAL Yes AP.112 Address CRITICAL Yes Accounts Payable- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AP.113 Invoice Yes AP.114 Amount; and DESIRED Yes AP.115 Other, user-defined criteria (based on any element in the vendor file). DESIRED Yes AP.116 The system has the ability to generate a report of checks paid by department. DESIRED Yes AP.117 The system has the ability to generate a report of checks paid by fund. DESIRED Yes AP.118 The system has the ability to generate a report of invoices outstanding by department. DESIRED Yes AP.119 The system has the ability to generate a monthly expenditure report by fund. DESIRED Yes AP.120 The system has the ability to generate an end of year AP Reconciliation report. DESIRED Yes AP.121 The system has the ability to generate an aging report by fund. DESIRED Yes AP.122 The system has the ability to generate a monthly check reconciliation report of all checks as well as manual/off-cycle checks. DESIRED Yes AP.123 The system has the ability to provide ad-hoc reporting capabilities. CRITICAL Yes AP.124 The system has the ability to provide ad-hoc query capabilities by invoice number with the ability to display individual line items on the invoice. DESIRED Yes Accounts Receivable & Billing- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GENERAL PROGRAM CAPABILITIES: AR.1 The system has the ability to provide an Accounts Receivable, Billing, and Cash Receipts module that is integrated with its other system modules such as general ledger, cash receipts, purchasing, accounts payable and accounts receivable. CRITICAL YES AR.2 The system has the ability to identify each transaction by a reference number that is sequentially generated automatically CRITICAL YES AR.3 The system has the ability to produce summary and detail general ledger and sub ledger journals one for every accounts receivable transaction CRITICAL YES AR.4 The system has the ability to provide decentralized data entry of billing information and an electronic approval process for submission of bills. CRITICAL YES AR.5 Ability to merge customer records CRITICAL YES YOU CAN MERGE CONTACT RECORDS AR.6 Ability to attach documents to invoices, customers, ad or receipts CRITICAL YES AR.7 Ability to indicate upon customer entry when a customer may already exist CRITICAL YES AR.8 Ability to support us of bar-coding and scanning technology for invoicing and collection CRITICAL YES AR.9 Receivable system can track loans and payments (receivables) linked to the loan. DESIRED YES AR.10 Ability to support both accrual and cash basis accounting CRITICAL YES AR.11 Sorting and displaying accounts receivable in a prescribed aging format CRITICAL YES AR.12 Ability to receive Electronic Fund Transfers for customer payments. DESIRED YES AR.13 AR.14 Ability to automatically assign sequential customer and invoice numbers. CRITICAL YES AR.15 Ability to adjust bills for a customer. CRITICAL YES AR.16 Ability to accommodate decentralized cash deposit entry. NA NA AR.17 Ability to support use of bar-coding and scanning technology for invoicing and collection. DESIRED YES AR.18 Ability to have separate bank accounts CRITICAL YES AR.19 System should provide method of user defined structures for grouping customers into unique types/classifications. CRITICAL YES Accounts Receivable & Billing- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AR.20 Ability to indicate upon customer entry when a customer already exists for a given SSN CRITICAL YES AR.21 Ability to security sensitive customer information (e.g. Date-of-Birth, SSN, EFT, and driver's license) CRITICAL YES AR.22 Ability to merge customer records (singly or en masse)CRITICAL YES YOU CAN MERGE CONTACT RECORDS AR.23 Ability to activate and inactivate customers CRITICAL YES AR.24 Ability to attach documents to invoices, customers, and/or receipts. CRITICAL YES AR.25 Ability to develop payment plans rules based on type of offense, type of receivable with appropriate security permissions DESIRED NO THERE MAY BE A WORK AROUND FOR THIS Customer Data Record: AR.26 Customer Number CRITICAL YES AR.27 Customer Name CRITICAL YES AR.28 Customer active indicator CRITICAL YES AR.29 Last account activity CRITICAL YES AR.30 Person/Entity indicator CRITICAL YES AR.31 Multiple Contact names DESIRED YES AR.32 Contact email address DESIRED YES AR.33 Cross Reference ID to external systems. DESIRED YES AR.34 Social Security Number or Tax ID Number CRITICAL YES AR.35 User-Defined ID Number (e.g., property index number) CRITICAL YES AR.26 Customer Number CRITICAL YES AR.36 Multiple Phone number (e.g., office, cell, etc.) DESIRED YES AR.37 Multiple Addresses DESIRED YES AR.38 Web address DESIRED YES AR.39 Current and unpaid late payment penalty and interest charges CRITICAL YES AR.40 Balance due CRITICAL YES AR.41 Last payment amount CRITICAL YES AR.42 Last payment date CRITICAL YES AR.43 Year-to-date payments CRITICAL YES AR.44 Customer Credit Score DESIRED NO THIS IS AVAILABLE IN UTILITY BILLING, BUT NOT AR Accounts Receivable & Billing- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AR.45 Bad check or dunning status DESIRED YES AR.46 Ability to flag customer with a bankruptcy status and notes CRITICAL YES AR.47 Customer type (multiple) CRITICAL YES AR.48 Statement cycle (e.g., weekly, monthly) DESIRED YES AR.49 Notes/comments (miscellaneous additional information) CRITICAL YES AR.50 Customer History CRITICAL YES AR.51 Date customer was added DESIRED YES AR.52 Default delivery method (i.e., Print, Fax, Email, Print/Email) CRITICAL YES AR.53 User Defined fields DESIRED YES AR.54Ability to add information CRITICAL YESInvoices/Statements: AR.55 Ability to itemize charges on customer invoice. CRITICAL YES AR.56 Ability to manage separate billing cycles by department, receivable, and customer type CRITICAL YES AR.57 Ability to develop customized invoices (e.g., Police logo for public safety intergovernmental billings and site logo for misc. receivables) DESIRED YES AR.58 Ability to import invoices produced by other billing systems to allow centralized collections and payment processing functions. DESIRED NO AR.59 Ability to produce one-time or recurring invoices. CRITICAL YES AR.60 Ability to perform insurance billing for retired employees CRITICAL YES AR.61 Ability to allow viewing of all outstanding invoices when applying payments to a customer account CRITICAL YES AR.62 Ability of allow customers to pre-pay for anticipated future invoices and apply those payments with appropriate security permissions DESIRED YES AR.63 Ability to perform automated inter-departmental billing DESIRED YES AR.64 Ability to suppress invoices for internal customers and create automatic journal entries for workflow approval with sufficient detail of charges. DESIRED YES AR.65 Ability to charge different rates for internal and external customers. DESIRED YES Accounts Receivable & Billing- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AR.66 Ability to include the billing date range and/or period on invoices. CRITICAL YES AR.67 Ability to maintain and send invoices to multiple addresses for the same customer. CRITICAL YES AR.68 Ability to generate statements showing activity and beginning and ending balances for any user-defined time period. CRITICAL YES AR.69 Ability for customers to search and pay for general bills using an online citizen portal. CRITICAL YES Has ability to generate account statements for the following: AR.70 Specific accounts CRITICAL YES AR.71 Range of accounts within a department CRITICAL YES AR.72 Range of customers DESIRED YES AR.73 Delinquent accounts CRITICAL YES AR.74 Ability to generate consolidated statements for customers with multiple accounts. DESIRED NO AR.75 Ability to maintain detail of unbilled charges. DESIRED YES AR.76 Ability to exclude / include billing detail data elements, allowable charges, and overhead on specific bills or all bills. DESIRED YES AR.77 Ability to correct and reprint invoices and statements. CRITICAL YES AR.78 Ability to accommodate online cancellation and one step automatic reversals of invoice entries. CRITICAL YES AR.79 Ability to print a duplicate bill and or statement upon request. CRITICAL YES AR.80 Ability to store multiple user-defined dunning messages and/or letters, according to user-specified parameters. NA YES AR.81 Ability to classify dunning notices (e.g., groups of customers) NA YES AR.82 Ability to write-off small discrepancies between the amount due and the amount received with proper security. NA YES AR.83 Ability to generate an invoice with sufficient and flexible text area to adequately describe services provided-customized invoice process CRITICAL YES Accounts Receivable & Billing- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AR.84 System should allow for a single invoice to be distributed to multiple accounting distributions based on a user-defined allocation (e.g., percentage) CRITICAL YES AR.85 Ability to retain history on written-off accounts for user-defined periods CRITICAL YES Receipts: AR.86 Ability to record cash, check & credit card receipts and create user-defined payment methods. CRITICAL YES AR.87 Ability to apply revenue to multiple funds and/or accounts. CRITICAL YES AR.88 Ability to accept batch entry of invoices, cash receipts or adjustment transactions. CRITICAL YES AR.89 Ability to accommodate Electronic Fund Transfers (EFT) CRITICAL YES AR.90 Ability to Support Lockbox Processing (including NACHA formats) DESIRED YES AR.91 Ability to break out EFT payments to different account numbers. CRITICAL YES AR.92 Provides for secure / PCI Compliant Credit Card Processing CRITICAL YES AR.93 Provides Remote Deposit Capture for Checks (Check 21 Compliance) DESIRED NO AR.94 Ability to accommodate multiple payments for an invoice. DESIRED YES AR.95 Ability to accommodate single payments applied against multiple invoices. DESIRED YES AR.97 System will notify customer that credits or overpayment has been made. DESIRED YES AR.98 Ability, upon customer overpayment, to optionally select to carry a credit balance or to generate a refund, kicking off the payment process and associated approvals. DESIRED YES AR.99 Ability to systematically prevent refunds for less than a certain dollar amount, which can vary by type of refund. CRITICAL YES AR.100 Ability to integrate with Accounts Payable for issuing a refund check CRITICAL YES AR.101 Ability to calculate and accommodate user-defined discounts (i.e., a 2% discount for early payment, etc.). CRITICAL YES AR.102 The system has the ability to support online (web-based) payments. CRITICAL YES AR.103 Ability to generate interest on overdue amounts. CRITICAL YES AR.104 Ability to adjust interest dates at time of payment and recalculate interest owed CRITICAL YES Accounts Receivable & Billing- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AR.105 Ability to generate late payment fees by either a percentage or flat amount. CRITICAL YES AR.106 Ability to accommodate different fee structures for different receivable types. CRITICAL YES AR.107 Ability to calculate credit score based on user defined criteria. DESIRED NO Ability to generate the following information on cash receipts: AR.108 Amount CRITICAL YES AR.109 Customer Name (optional) CRITICAL YES AR.110 Customer ID (optional) CRITICAL YES AR.111 Customer address (optional) CRITICAL YES AR.112 Default accounts (multiple) CRITICAL YES AR.113 Date of service CRITICAL YES AR.114 Current date CRITICAL YES AR.115 Individual who received the payment DESIRED YES AR.116 Form of payment (check, cash, credit) CRITICAL YES AR.117 Description of service (text and/or code) (multiple) CRITICAL YES AR.118 Ability to transfer overages to other related bills, with the appropriate accounting affect automatically. CRITICAL YES AR.119 Ability to pull up an existing cash receipt entry and reverse it, with the appropriate accounting affect automatically. CRITICAL YES AR.120 Ability to provide flexible NSF rules (fixed, percentage, or escalating fee amounts) DESIRED YES AR.121 Ability to secure cash drawer by opening only on cash payments DESIRED YES AR.122 Ability to reverse a lockbox process or a batch of receipts CRITICAL YES Reports: AR.123 Ability to produce ad hoc reports using a report writer (i.e., SQL Server Reporting Services) DESIRED YES AR.124 Ability to provide security for ad hoc report writer to ensure only users with permissions can access appropriate information. DESIRED YES AR.125 Ability to copy existing reports to new report titles for modification to a new report. DESIRED YES Accounts Receivable & Billing- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments AR.126 Ability to create PDF files or HTML links. CRITICAL YES AR.127 Ability to schedule reports for regular production (i.e., monthly, bi-weekly, etc.). CRITICAL YES AR.128 Ability for scheduled reports to be emailed to a user. CRITICAL YES AR.129 Ability to export queries to popular desktop applications (i.e., Excel, Word). CRITICAL YES Ability to generate a report by user or by department for: AR.130 Daily cash receipts CRITICAL YES AR.131 Cash register journals CRITICAL YES AR.132 Daily bank deposits CRITICAL YES AR.133 The system has the ability to produce a listing of late customer accounts where "late" can be user defined CRITICAL YES AR.134 The system has the ability to generate AR aging reports for both summary by customer and detail within customer by invoice CRITICAL YES AR.135 The system has the ability to compute late charges for customers not paying within a designated period of time. CRITICAL YES AR.136 Ability to list receivables written off. CRITICAL YES AR.137 Ability to accommodate automatic reconciliation to the bank. CRITICAL YES AR.138 Ability to generate a variance report showing revenue accruals vs. actual collection. CRITICAL YES Capital Assets - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Functional Requirements – Capital Assets FA.1 Ability to track non-capitalized assets / equipment items (i.e.: computer equipment, non-licensed vehicles) per department / division for risk management purposes. CRITICAL YES FA.2 Ability to track non-depreciable technology inventory items (desktops, laptops, etc.) including detailed information such as component detail, serial numbers, technical specifications, etc.CRITICAL YES FA.3 Ability to fully integrate with purchasing, project & grant accounting and work orders to create or improve assets. CRITICAL YES FA.4 Ability to update assets from capitalized to non-capitalized (or vice versa) and automatically create the necessary general ledger posting. CRITICAL YES FA.5 Ability to restrict separate role permissions for capitalized and non-capitalized assets. DESIRED YES RESTRICTIONS CAN BE SET IN PROCESSING Ability to identify grant funded assets: FA.6By identifying more than one grant associated with an asset DESIRED YESFA.7 By identifying the percentage split, or capitalization breakout (to each grant) for each asset DESIRED YES FA.8 Ability for capital asset system to provide robust query ability. CRITICAL YES FA.9 Ability to export/import capital asset information to/from common spreadsheet applications. CRITICAL YES FA.10 Ability to support bar coded asset tags and portable bar code readers for performing physical inventories. DESIRED YES FA.11 Asset numbers do not necessarily need to correlate to asset tag numbers - Allow the system to generate tag numbers, have external tag numbers assigned, or not have tag numbers. DESIRED YES MANUALLY FA.12 Ability for system to list and value infrastructure capital assets. CRITICAL YES FA.13 Ability for system to identify capital outlay by program the assets support. DESIRED YES FA.14 Ability for system to depreciate capital assets and allocate depreciation to those programs that use the assets. YES Capital Assets - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Invoice Entry FA.15 Ability for the fixed asset module to interface with the accounts payable module. Information on newly obtained fixed assets is reported for verification, then automatically transferred from the accounts payable module into the fixed assets master file system. CRITICAL YES FA.16 Ability to track multiple user defined fields on the asset master record. DESIRED YES FA.17 Ability to provide a classification scheme to code fixed assets according to type (i.e., desks, cars, etc.). CRITICAL YES FA.18 Ability to accommodate free-form descriptive text to further describe any asset. The text is electronically associated with the master file. DESIRED YES FA.19 Security access to edit assets is assigned to each asset. DESIRED NO NOT ON AN INDIVIDUAL ASSET LEVEL FA.20 Ability to idle assets (suspend depreciation). DESIRED YES FA.21 Ability to link to all related ERP modules (Fleet, etc.). DESIRED YES FA.22 Ability to access a master file by entering any asset field. DESIRED YES FA.23 Ability to accommodate alpha numeric asset numbers. CRITICAL YES FA.24 Ability to accommodate parent/child relationships between related assets, such as a master unit with one or more accessories. DESIRED YES FA.25 Ability to reassign parent/child relationships. DESIRED YES FA.26 Ability to capitalize items in aggregate (as a group). CRITICAL YES FA.27 Can track quantity in the asset master record - minimum of 6 digits. DESIRED YES Project Based Assets: FA.28 Interfaces with the work order system to capture project costs for aggregate / project assets CRITICAL YES FA.29 Allows a project to be associated with multiple assets DESIRED YES FA.30 Allows an asset to be associated with multiple projects DESIRED YES FA.31 Ability to associate multiple capital accounts and multiple related depreciation expense accounts with an asset, and assign a percentage split between each. DESIRED YES Capital Assets - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments FA.32 Ability to track Construction in Progress (CIP) assets. CRITICAL YES FA.33 Ability to transfer CIP asset to an active assets and perform. CRITICAL YES FA.34 Allows for transfer of assets between departments, locations and funds, accommodating interfund and inter-dept. transfers, duplicating all identifying data from original record. CRITICAL YES Maintains on-line history of asset transactions, including: FA.35 Location changes DESIRED YES FA.36 Account number changes DESIRED YES FA.37 Status change DESIRED YES FA.38 Change to key field in auxiliary system DESIRED YES FA.39 Partial disposals CRITICAL YES FA.40Valuation change CRITICAL YESFA.41 Date of last depreciation adjustment CRITICAL YES FA.42 Ability to calculate asset values to replacement costs for insurance purposes. DESIRED YES FA.43 Supports asset value appreciation for real property and provides a detailed audit trail. Any appreciation does not affect cost basis. DESIRED YES FA.44 System has the ability to support multiple depreciation schedules. CRITICAL YES FA.45 Retention of fully depreciated assets in fixed asset master file for inventory control purposes prior to disposition. CRITICAL YES FA.46 Provides additional depreciation method for assets that are depreciated by amount used/consumed. CRITICAL YES FA.47 Ability to add and retire asset by a quantity. CRITICAL YES ASSET MASTERFILE Ability to record the following information on a capital asset: Capital Assets - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments FA.48 Fund/Account Group CRITICAL YES FA.49 Fund Type CRITICAL YES FA.50 Property Type CRITICAL YES FA.51 Building CRITICAL YES FA.52 Location CRITICAL YES FA.53 Responsibility CRITICAL YES FA.54 Department CRITICAL YES FA.55 Custodian CRITICAL YES FA.56 Program CRITICAL YES FA.57 Acquisition Date CRITICAL YES FA.58 Original Cost CRITICAL YES FA.59 Current Value CRITICAL YES FA.60 Status (active, disposed, idle, etc.) CRITICAL YES FA.61 Previous asset number CRITICAL YES FA.62 Document Reference Number CRITICAL YES FA.63 Acquisition method (purchased, donated, etc.) CRITICAL YES FA.64 Estimated salvage value CRITICAL YES FA.65 Estimated useful life CRITICAL YES FA.66 Replacement Cost CRITICAL YES FA.67 Capitalize flag CRITICAL YES FA.68 Depreciation flag CRITICAL YES FA.69 Depreciation method CRITICAL YES FA.70 Depreciation, Life-to-Date CRITICAL YES FA.71 Depreciation, Year-to-Date CRITICAL YES FA.72 Parent/Child Descriptions and Asset Numbers CRITICAL YES FA.73 Purchase Order Number CRITICAL YES FA.74 ID or Tag Number CRITICAL YES FA.75 Vendor Name and ID Number CRITICAL YES FA.76 Multiple Description lines (brand, model, and manufacturer of asset) CRITICAL YES Capital Assets - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments FA.77 Check Number and Date CRITICAL YES FA.78 Serial Number CRITICAL YES FA.79 Manufacturer CRITICAL YES FA.80 Model CRITICAL YES FA.81 Model year CRITICAL YES FA.82 License/Registration Number CRITICAL YES FA.83 Group / Assets Classification Number CRITICAL YES FA.84 Fund and Department Numbers CRITICAL YES FA.85 Quantity CRITICAL YES FA.91 Insurance Value CRITICAL YES FA.92 Disposal Restriction indicator CRITICAL YES FA.93 Disposal price CRITICAL YES FA.94 Disposal Date CRITICAL YES FA.95 Transfer Date CRITICAL YES FA.96 Responsibility Code CRITICAL YES FA.97 Funding Source CRITICAL YES FA.98Sale Price CRITICAL YES FA.99 Scheduled replacement date CRITICAL YES FA.100 Warranty information CRITICAL YES FA.101 Donation CRITICAL YES FA.102 Condition CRITICAL YES FA.103 Contractor CRITICAL YES FA.104 General Fund Category CRITICAL YES FA.105 Picture to provide visual reference for asset record CRITICAL YES FA.106 User Defined fields DESIRED YES REPORTS FA.107 Ability to produce ad hoc reports using a report writer (i.e., SQL Server Reporting Services) DESIRED YES Capital Assets - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments FA.108 Ability to produce charts, highlight figures, create tables using the ad hoc report writer. DESIRED YES FA.109 Ability to provide security for ad hoc report writer to ensure only users with permissions can access appropriate information. DESIRED YES FA.110 Ability to create PDF files or HTML links. DESIRED YES FA.111 Ability to schedule reports for regular production (i.e., monthly, bi-weekly, etc.). DESIRED YES FA.112 Ability for scheduled reports to be emailed to a user. DESIRED YES FA.113 Ability to export queries to popular desktop applications (i.e., Excel, Word). CRITICAL YES FA.114 Schedule of Assets grouped by GAAFR function and/or departments. The report can also be produced down to the division and/or cost center level. CRITICAL YES FA.115 Transaction Register audit trail of all acquisitions, transfers, changes, and retirements during a user-defined time period by asset type, department, or purchase amount. CRITICAL YES FA.116 New Acquisition Report showing all newly acquired fixed assets which have not been entered into the fixed assets master file system. (Requires purchasing, accounts payable module interface). CRITICAL YES FA.117 Fixed assets detail and summary maintained by department, fund/ account, responsible person, property type, location, and their associated cost or replacement value, and accumulated depreciation. CRITICAL YES FA.118 Physical inventory worksheet, sorted by department, location, and/or person responsible to assist in conducting physical inventory. Report provides the maximum amount of asset details that would assist in identifying asset locations. CRITICAL YES FA.119 Vehicle/equipment listing of master file information, including property tax number, item name, description, location, class number, charge account number, equipment ID number, motor number, model and manufacturer. CRITICAL YES FA.120 Schedule of current year's depreciation associated with each asset. CRITICAL YES Capital Assets - General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments FA.121 Replacement report listing all assets which should be considered for replacement during a user-defined period. DESIRED YES The following information can be displayed in a fixed asset report: FA.122 Valuation (orig. cost, acc. depr., book value) CRITICAL YES FA.123 Net changes (additions, deletions, financial adjustments) CRITICAL YES FA.124 Schedule of assets (original cost or book value) CRITICAL YES FA.125 Asset Listing - Short Form CRITICAL YES FA.126 Asset Listing - Detail CRITICAL YES FA.127 Asset Transaction History CRITICAL YES FA.128 Depreciation Register (YTD & Total Accumulated) CRITICAL YES FA.129 Depreciation Estimator (annual depreciation on existing assets for future years)CRITICAL YES FA.130 Schedule of Additions CRITICAL YES FA.131 Schedule of Disposals CRITICAL YES FA.132 Assets Transferred CRITICAL YES FA.133 Assets Idled CRITICAL YES FA.134 Financial Adjustments CRITICAL YES FA.135 Grant Funding CRITICAL YES FA.136 Related Assets (Parent/Child or Split Funded) CRITICAL YES Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GENERAL PROGRAM CAPABILITIES: PROJECTS: GA.1 Ability to maintain historical data for all capital and operating projects independent of general ledger data (across multiple fiscal years). DESIRED Yes GA.2 Ability to record timesheet information against a project. DESIRED yes Enter in Payroll but if the employee forgets to, then it can be entered after the fact. GA.3 Ability to add projects in or change projects to an active or inactive status. DESIRED Yes GA.4 Ability to enter text or comments on-line to a specific project. (Please specify in the Comments column how many characters are allowed.) DESIRED yes Unlimited as a note or in TCM as an attachment GA.5 Ability to accommodate multiple change orders and multiple transfers of funds within projects. DESIRED yes This is done as a journal entry GA.6 Ability to enter line-item data for future expenditures to reserve funds. DESIRED Yes GA.7 Ability to maintain data across multiple fiscal years DESIRED Yes GA.8 Ability to establish project budgets (balanced) across funds. DESIRED Yes You have budget checking options GA.9 Ability to establish project accounts to record project budgets, encumbrances and expenditures. DESIRED Yes GA.10 Ability to clone project accounts established from previous projects, then modify for a newly created project. DESIRED Yes GA.11 Ability to record project activity over multiple years. DESIRED Yes GA.12 Ability to record project activity over multiple departments. DESIRED Yes GA.13 Provides general ledger account information when viewing project account detail DESIRED Yes Ability to accommodate a variety of projects such as:FA.14 Ability for system to depreciate capital assets and allocate depreciation to those programs that use the assets. DESIRED Yes This is done in fixed assets GA.14 Small capital expenses (e.g., remodeling) DESIRED Yes GA.15 Large capital projects (e.g., buildings, infrastructure) DESIRED Yes Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GA.16 Miscellaneous projects, such as elections DESIRED Yes GA.17 Routine work order(s) for non-capital expenditures DESIRED Yes GA.18 Ability to classify project costs according to task (i.e., inspection, design). DESIRED Yes GA.19 Ability to prevent charges from being allocated to a closed project, sub-project, or phase with the ability to override with the proper security. DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments GA.20 Ability to track dedicated funds set aside for selected activities in projects (e.g., set aside funds for planned activities as they become known). DESIRED Yes Ability to validate charges against project mater files to determine if: GA.21 Charges are to open projects Yes Project must be open in order to have an expenditure or revenue post to it. GA.22 Accounts charged are valid for specified projects (e.g., costs are valid or budgeted for the project) DESIRED Yes Budget checking option GA.23 Ability to prevent entry to closed projects. DESIRED Yes GA.24 Ability to search project titles on-line, primarily to assist in proper identification for data entry. DESIRED Yes Global Search GA.25 Ability to perform flexible budgeting for projects while adhering to the level of budgetary controls established in the General Ledger. DESIRED Yes GA.26 Ability to import projects and project accounts DESIRED Yes Project Data: Ability to record the following project data: GA.27 Project Code DESIRED Yes GA.28 Type of project (paving, building, etc.) DESIRED Yes GA.29 Project Title DESIRED Yes GA.30 Major Project Code DESIRED Yes GA.31 State Id # DESIRED Yes User Defined Information Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GA.32 Federal CFDA DESIRED Yes User Defined Information GA.33 Drawdown frequency DESIRED Yes User Defined Information GA.34 Project Description DESIRED Yes User Defined Information GA.35 Project Justification DESIRED Yes User Defined Information GA.36 Department DESIRED Yes GA.37 Status DESIRED Yes GA.38 Project available budget DESIRED Yes GA.39 Estimated dollar amount to complete project DESIRED Yes GA.40 Create Fixed Asset indicator DESIRED No GA.41 User defined category indicating CAFR or GASB 34 categories (General Government, Public Works, Public Welfare, Public Safety, Parks) DESIRED Yes Reporting GA.42 Project fiscal range Yes Req. # Description of Requirement Criticality Response from Vendors Comments Ability to track the following dates: GA.43 Planned start date DESIRED Yes GA.44 Actual start date DESIRED Yes GA.45 Planned completion date DESIRED Yes User Defined Information GA.46 Project completion date DESIRED Yes User Defined Information Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Project reports: GA.47 Ability to produce ad hoc reports using a report writer (i.e., SQL Server Reporting Services) DESIRED Yes Reporting GA.48 Ability to produce charts, highlight figures, create tables using the ad hoc report writer. DESIRED Yes Dashboard and Cell Sense GA.49 Ability to provide security for ad hoc report writer to ensure only users with permissions can access appropriate information. DESIRED Yes GA.50 Ability to create PDF files or HTML links. DESIRED Yes No html links but you can share reports, email and export to any format. GA.51 Ability to schedule reports for regular production (i.e., monthly, bi-weekly, etc.). DESIRED Yes GA.52 Ability for scheduled reports to be emailed to a user. DESIRED Yes GA.53 Ability to export queries to popular desktop applications (i.e., Excel, Word). DESIRED Yes GA.54 Ability to produce trend reports along with key performance indicators using pre-built Excel Data Cubes. DESIRED Yes Cell Sense GA.55 Ability to inquire and report on any field in the Project module. DESIRED Yes GA.56 Ability to track and report on projects over multiple fiscal years. DESIRED Yes GA.57 Ability to create a completed project report. DESIRED Yes GA.58 Project inquiry and reporting display tie to the general ledger. DESIRED Yes GENERAL PROGRAM CAPABILITIES: GRANT: FA.47 Ability to add and retire asset by a quantity. Yes This is done in fixed assets GA.59 Ability to define the program or budget year of the grant/project differently than the system established fiscal year. DESIRED Yes GA.60 Ability to set up and report budget items based on multiple fiscal years and grant years. DESIRED Yes Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GA.61 Ability to track internal transfers for the site's cash match amount in the appropriation amount. DESIRED Yes Reporting, audit trail, but more information is needed GA.62 Ability to accommodate grant year accounting and comply with both calendar year and fiscal year budgeting requirements. DESIRED Yes GA.63 Ability to carry forward appropriations at year end. DESIRED Yes GA.64 Ability to establish and monitor against a grant budget separate and unique from the departmental or appropriations budget. DESIRED Yes Reporting GA.65 Ability to track actual expenditures against budgeted/allowable expenditures by user-defined period (i.e., monthly, quarterly, daily, etc.). DESIRED Yes Reporting GA.66Ability to generate hard-copy reimbursement requests to grantor agencies from expenditure data. DESIREDYes Reporting GA.67 Ability to establish and adjust budgets for each grant, with budget amendment. DESIRED Yes Budgeting adjustment GA.68 Ability to add or modify grant information online with audit trail of all changes. DESIRED Yes GA.69 Ability to provide for grant summary history online. DESIRED Yes GA.70 Ability to support multiple programs per grant (sub-grants). DESIRED Yes GA.71 Ability to uniquely identify each sub-grantee for grants and all grant financial activity related to sub-grantees. DESIRED Yes Each one would require a different name, but it can be done GA.72 Ability to process data from purchasing system for purchase orders and encumbrances. DESIRED Yes This is done in purchasing. Ability to accumulate costs either manually or automated from the following sources: GA.85 Pay variances including overtime, sick days, holidays, etc. DESIRED Yes Reporting Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GA.86 Accounts payable information DESIRED yes Reporting GA.87 Mileage/fuel expenditures DESIRED Yes User defined information GA.88 Equipment/asset costs DESIRED Yes Reporting GA.89 Ability to distribute employee costs to a project DESIRED Yes In purchasing, using a req or PO we can assign it to a project. Req. # Description of Requirement Criticality Response from Vendors Comments GA.90 Ability to distribute equipment cost to a project DESIRED Yes GA.91 Other user defined fields DESIRED yes User Defined fields are available throughout Incode. Ability to record the following grant data: GA.92 Grant Title DESIRED Yes GA.93 Federal or State grantor agency name. DESIRED Yes GA.94 Grant, Capital Project, Federal Assistant Grant, or Site-approved Contract Number or Reporting CategoryDESIRED Yes GA.95 Multiple Grant numbers DESIRED Yes GA.96 Grant name DESIRED Yes GA.97 Grant description DESIRED Yes GA.98 Grantor DESIRED Yes GA.99 Grantor Contact (Name, Phone Number, E-mail Address) DESIRED Yes Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GA.100 Grantor's mailing address DESIRED Yes GA.101 Date application submitted DESIRED Yes GA.102 Date application approved DESIRED Yes User Defined Information GA.103 Original grant approval amount DESIRED Yes User Defined Information GA.104 Grant budget DESIRED Yes GA.105 Grant amendments DESIRED Yes GA.106 Grant carryovers DESIRED Yes GA.107 Grant fiscal calendar DESIRED Yes GA.108 Grant beginning date DESIRED Yes GA.109 Grant expiration date DESIRED Yes GA.110 Amounts of site matching funds DESIRED GA.111 Responsible department or division DESIRED Yes GA.112 Department or division contact DESIRED Yes GA.113 Ability to capture all grant transaction activity through the general ledger. DESIRED Yes GA.114 Ability to uniquely identify each grant through the assignment of an agency defined grant number. DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments Ability to capture grant expenditures and revenues by: Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GA.115 General ledger account numbers DESIRED Yes GA.116 Grantor-defined categories or accounts DESIRED Yes GA.117 Grant purchase orders and encumbrances DESIRED Yes GA.118 Grants status codes DESIRED Yes GA.119 Narrative fields for miscellaneous information DESIRED Yes GA.120 User defined fields DESIRED Yes GRANT REPORTS GA.121 Ability to produce ad hoc reports using a report writer (i.e., SQL Server Reporting Services) DESIRED Yes GA.122 Ability to produce charts, highlight figures, create tables using the ad hoc report writer. DESIRED Yes Dashboard and reporting GA.123 Ability to provide security for ad hoc report writer to ensure only users with permissions can access appropriate information. DESIRED Yes GA.124 Ability to create PDF files or HTML links. DESIRED Yes GA.125 Ability to schedule reports for regular production (i.e., monthly, bi-weekly, etc.). DESIRED Yes GA.126 Ability for scheduled reports to be emailed to a user. DESIRED Yes GA.127 Ability to export queries to popular desktop applications (i.e., Excel, Word). DESIRED Yes FA.120 Schedule of current year's depreciation associated with each asset. DESIRED Yes In fixed assets GA.129 Ability to produce reports for any user-defined period, including grant life to date or grant year. DESIRED Yes GA.130 Ability to generate reports on either a cash or accrual basis. DESIRED Yes Incode works with either modified cash or accrual, but it cannot switch back and forth between the two. Project & Grant Accounting- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE GA.131 Ability to produce all reports using both grantor-defined categories or the site's chart of accounts. DESIRED Yes Ability to provide the following reports: GA.132 Expenditures and revenues per grant DESIRED Yes Reporting GA.133 Sources of revenues DESIRED Yes GA.134 Reimbursed costs DESIRED Yes GA.135 Budget vs. actual costs DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments GA.136 Combined grant revenue and expenditure reports DESIRED Yes GA.137 Pending approval grant report DESIRED No GA.138 Pending expiration or expired grant report DESIRED Yes Cash Management- General Requirements City of Corcoran – Criticality = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments GENERAL PROGRAM CAPABILITIES: CASH MANAGEMENT: CM.1 Ability to integrate with accounting system transactions to provide a “budget vs. actual” cash flow analysis. DESIRED YES Ability to reconcile cash accounts (book balance) with their corresponding bank accounts (bank balance), including: YES REPORTS CM.12 Ability to produce ad hoc reports using a report writer (i.e., SQL Server Reporting Services). CRITICAL YES CM.13 Ability to produce charts, highlight figures, create tables using the ad hoc report writer. CRITICAL YES CM.14 Ability to provide security for ad hoc report writer to ensure only users with permissions can access appropriate information. CRITICAL YES CM.15 Ability to create PDF files or HTML links. CRITICAL YES CM.16 Ability to schedule reports for regular production (i.e., monthly, bi-weekly, etc.). CRITICAL YES CM.17 Ability for scheduled reports to be emailed to a user. DESIRED YES CM.18 Ability to export queries to popular desktop applications (i.e., Excel, Word). CRITICAL YES CM.19 Daily treasurer’s totals. CRITICAL YES CM.20 Cash flow summary and detail. CRITICAL YES Support for check/warrant reconciliation, including: CRITICAL YES CM.22 CM.23 Payables/Payroll check writing history files DESIRED YES CM.24 Can manually indicate that checks have cleared CRITICAL YES CM.25 Reports for cleared, outstanding, and voided checks CRITICAL YES CM.26 Support for miscellaneous cash receipts, including walk-in payments from the public, mailed-in payments, turnovers from other departments, payments against any outstanding invoices, including delinquent accounts. CRITICAL YES CM.27 Daily Payments Journal that includes a detailed list of payments received, as well as a summary by receipt and tender type. DESIRED YES Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments General Requirements HR.1 The system has the ability to support a system-generated unique employee number with override capabilities. CRITICAL Yes HR.2 The system has the ability to track various employee information through unique employee identifier. CRITICAL Yes HR.3 The system has the ability to capture and maintain 1-9 documentation and track status. CRITICAL Yes HR.4 The system has the ability to via automated workflow, generate personnel status email notices on-line (e.g. FMLA, applicant rejection, military leave, leave donation, return to work, benefit information).CRITICAL Yes HR.5 The system has the ability to accommodate workflow approvals of human resources-related processes and documents. DESIRED Yes The system has the ability to maintain and manage employee personnel information, including (but not limited to) the following fields: HR.6 Name; CRITICAL Yes HR.7 DOB; CRITICAL Yes HR.8 SSN; CRITICAL YesHR.9 Employee number; CRITICAL Yes HR.10 Spouse information; DESIRED Yes HR.11 Dependent information; DESIRED Yes HR.12 Contact detail (phone, cell, e-mail address); CRITICAL Yes HR.13 Date of hire; CRITICAL Yes HR.14 Start date; CRITICAL Yes HR.15 Leave date(s); CRITICAL Yes HR.16 Benefit detail (benefit eligible date, retirement date); CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.17 Emergency contact information (name(s), phone, address, e-mail address); and CRITICAL Yes HR.18 Other standard and user-defined fields. CRITICAL Yes HR.19 The system has the ability to capture multiple emergency contacts.DESIRED Yes HR.20 The system has the ability to, upon new hire, notify all pertinent departments (based on user0defined criteria) and trigger appropriate workflow processes (e.g. established network access and sets up workstation, Payroll set-up, Benefits enrollment, equipment issued etc.). DESIRED No HR.21 The system has the ability to provide for an orientation process checklist that can be customized by and for each department and by job title. DESIRED Yes HR.22The system has the ability to attach files to work orders at entry, management or reporting stage. DESIREDYes HR.23 The system has the ability to accommodate planned or immediate terminations. CRITICAL Yes HR.24 The system has the ability to define multiple separation codes (discharged die to misconduct, performance issues, poor attendance, other user-defined; resignation due to mutual agreement, career advancement, career change relation, retirement, other user-defined). CRITICAL Yes HR.25 The system has the ability to record employee's and supervisor's reasons for termination/separation. CRITICAL Yes HR.26 The system has the ability to track the length of time an employee has filled a position. CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.27 The system has the ability to record and track items assigned to employees (e/g/ cell phone, keys, ID card, Parking pass, etc). CRITICAL Yes HR.28 The system has the ability to general personnel action forms on-line.CRITICAL Yes HR.29 The system has the ability to transfer employees from one position to another. CRITICAL Yes HR.30 The system has the ability to accommodate user-defined rules for employee transfer (e.g. employees assigned to multiple departments are flagged as exceptions). DESIRED No The system has the ability to track the following position data: HR.31 Fiscal year; CRITICAL Yes HR.32 Job title; CRITICAL Yes HR.33 Job code; CRITICAL Yes HR.34 Position number; CRITICAL Yes If position tile includes HR.35 Position type (e/g/ skilled labor, management, etc). DESIRED No HR.36 Supervisor name; CRITICAL Yes HR.37 Physical work location; DESIRED No HR.38 Department/program/project; CRITICAL Yes HR.39 Exempt/mom-exempt status; CRITICAL No HR.40 Percent of fulltime; CRITICAL Yes HR.41 Pay rate; CRITICAL Yes HR.42 Probation end date/period; CRITICAL No On employee, not position HR.43 Salary range; DESIRED Yes Salary Schedule values HR.44 FT/PT/retiree flag; CRITICAL Yes HR.45 Temp/permanent flag; CRITICAL Yes HR.46 Department/division/program start date; DESIRED No Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Budget Preparation HR.47 Promotion date(s); CRITICAL Yes HR.48 Anniversary date; CRITICAL Yes HR.49 Unlimited text field or comments; andDESIRED Yes HR.50 Other user-defined fields. DESIRED Yes HR.51 The system has the ability to accommodate multiple labor codes. DESIRED Yes HR.52 The system has the ability to maintain job descriptions online. CRITICAL Yes HR.53 The system has the ability to allow positions to be budgeted for partial year (e.g. 3,6,9 months). CRITICAL Yes HR.54 The system has the ability to reinstate a separated employee, requiring approval sign-ff per user-defined rules (at multiple levels if necessary). CRITICAL Yes The system has the ability to maintain current salary information including (but not limited to): HR.55 Effective date; CRITICAL Yes HR.56 Salary range; DESIRED Yes HR.57 Wage range; DESIRED Yes HR.58 Employee review date; CRITICAL Yes HR.59 Pay change reason/action code; CRITICAL Yes HR.60 Amount of change; CRITICAL Yes HR.61 Unlimited text field to describe pay change reason/action; and DESIRED No 100 characters HR.62 Other user-defined fields. DESIRED Yes HR.63 The system has the ability to provide for multiple salary schedule. CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.64 The system has the ability to accommodate multiple salary table lined to multiple job/description classes. CRITICAL Yes HR.65 The system has the ability to accommodate tracking shift structure for employees. CRITICAL Yes HR.66 The system has the ability to capture permanent and temporary job-type indicators, including (but not limited to) seasonal and provisional employees. DESIRED Yes With standard and user-defined fields HR.67 The system has the ability to capture the typical hours of a position (e.g. 9am to 5pm). CRITICAL Yes Scheduled hours, but not time of day HR.68 The system has the ability to support the submission of a detailed budget, one that includes revenue sources, detailed expenditures, multi-funding sources, multi-year budget and matching funds. DESIRED Yes HR.69 The system has the ability to provide multiple pay grades. CRITICAL Yes HR.70 The system has the ability to assign employees to single or multiple jobs and graces (with multiple levels of sign-off approval per user-defined rules). Yes HR.71 The system has the ability to provide positions filled/available reporting. CRITICAL Yes HR.72 The system has the ability to monitor base salary and additional compensation components by employee. CRITICAL Yes The system has the ability to allow the City to define a number of employee deductions/garnishments including (but not limited to): HR.73 Child support; CRITICAL Yes HR.74 Tax liens; CRITICAL Yes HR.75 Bankruptcy's; CRITICAL Yes HR.76 Creditors; CRITICAL Yes HR.77 Trustees; CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.78 Court orders; and CRITICAL Yes HR.79 Other, user defined. DESIRED Yes HR.80 The system has the ability to track temporary alternate duty assignments and restrictions. DESIRED Yes HR.81 The system has the ability to generate seniority reporting. DESIRED Yes HR.82 The system has the ability to support HIPPA compliance. DESIRED Yes The system has the ability to maintain, at a minimum, the following applicant data: HR.83 Date of application; CRITICAL Future Future Applicant Module – initial feature set unknown HR.84 Time of application; CRITICAL Future HR.85 Applicant Name CRITICAL Future HR.86 Source of application information; DESIRED Future HR.87 Relatives employed by City; CRITICAL Future HR.88 Address; CRITICAL Future HR.89 Phone number/s; CRITICAL Future HR.90 Email address/es; CRITICAL Future HR.91 Positions applied/referred for; CRITICAL Future HR.92 Ability to be legally employed in the USA (Y/N); CRITICAL Future HR.93 Reference detail; CRITICAL Future HR.94 Attached resume (Word or pdf); CRITICAL Future HR.95 Criminal background information; CRITICAL Future HR.96 Previous employment information; CRITICAL Future HR.97 Education; CRITICAL Future HR.98 Certificates/licensure; CRITICAL Future HR.99 Results of required test; and CRITICAL Future HR.100 Other user defined. DESIRED Future Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to track EEO data for use in statistical analysis and reporting, including but not limited to: HR.101 Requisition Number;DESIRED Future Future Applicant Module – initial feature set unknown HR.102 Selected Flag;DESIRED Future HR.103 Applicant name;CRITICAL Future HR.104 Applicant ID; DESIRED Future HR.105 Applicant Record Number DESIRED Future HR.106 Applicant address; CRITICAL Future HR.107 Hone phone; CRITICAL Future HR.108 Application received date CRITICAL Future HR.109 Email address; CRITICAL Future HR.110 Race; CRITICAL Future HR.111 Sex; CRITICAL Future HR.112 Department; CRITICAL Future HR.113 Highest grade completed; CRITICALFuture HR.114 GPA; DESIREDFuture HR.115 Recruiting Source; CRITICAL Future HR.116 Other user-defined fields. DESIREDFuture HR.117 The system has the ability to store EEO data separate from the applicant record. CRITICAL Future HR.118The system has the ability to restrict access to EEO data to authorized users as determined by City user profiles. CRITICAL Future HR.119 The system has the ability to populate EEO data by electronic submissions from applicant record and requisition data. CRITICAL Future HR.120 The system has the ability to save EEO data upon initial entry for user's profile with blocks prefilled for multiple application submissions. DESIRED Future HR.121 The system has the ability to track ADA DESIREDFuture Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE accommodations with an applicant. Req. # Description of Requirement Criticality Response from Vendors Comments HR.122 The system has the ability to support EEO an ADA analysis. DESIRED Future Future Applicant Module – initial feature set unknown HR.123 The system has the ability to flag an employee record upon SSN validation, once terminated as unable to reapply. CRITICAL Future New Hite Processing HR.124 The system has the ability to send information to required departments for data transfer once hired (i.e. IS for computer account setup, etc.). DESIRED No Manual notification could be sent HR.125 The system has the ability to require fingerprints for certain employees, prior to starting their first day.CRITICAL No HR.126 The system has the ability to produce a user-defined pre-employment checklist of forms that must be completed electronically. CRITICAL No Paper forms can be created. HR.127 The system has the ability to monitor conditional fire requirements and pass/fail information, test scores, drug tests and other data.CRITICAL Yes HR.128 The system has the ability to notify applicant that additional documentation is needed for hire (e.g. degrees, certifications, etc.)/ CRITICAL No Manual notification can be sent HR.129 The system has the ability to identify training requirements based on multiple factors including the position ID, job code, department, division/service area. DESIRED No The system has the ability to define a checklist for benefit eligible and non-benefit eligible new employees, including: HR.130 Employee Handbook and Policy Manuals CRITICAL Yes Onboarding task HR.131 Union Contract (confirm that contract was provided only). CRITICAL Yes Onboarding task Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to provide salary and benefit forecasting capabilities based on the import/integration from the payroll application including: HR.132 Required Forms;DESIRED Yes HR.133 Optional Forms; andDESIRED Yes HR.134 Other, user defined.DESIRED Yes The system has the ability to define a checklist for employees new to position based upon: HR.135 Job class;CRITICAL Yes Onboarding task HR.136 Position level;CRITICAL Yes Onboarding task HR.137 Department; andCRITICAL Yes Onboarding task HR.138 Other, user defined.DESIRED Yes Onboarding task HR.139 The system has the ability to define orientation requirements for new hires based upon department, job class, and/or other factors. CRITICAL Yes Onboarding task HR.140 The system has the ability to route completed new employee forms to appropriate departments, based upon multiple workflows. DESIRED No HR.141 The system has the ability to list missing documents by each new hire and/or dates. CRITICAL Yes Onboarding task HR.142 The system has the ability to define different escalation factors based upon checklist item (e.g. required item has a certain time frame vs and optional item). DESIRED Yes Onboarding time due HR.143 The system has the ability to override missing required checklist items with security permissions. DESIRED Yes HR.144 The system has the ability to correct and make adjustments to forms based upon effective date and/or retroactively. CRITICAL Yes HR.145 The system has the ability to set up special posting and hiring rules for union, related jobs and positions (example; lateral postings). CRITICAL Yes Notes or documents Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments Benefits HR.146 The system has the ability to provide for a Benefits-specific new employee orientation checklist that can be customized by and for each department, job class, and status (temporary or permanent) (all items assigned to employee). CRITICAL Yes Benefits Administration and onboarding task HR.147 The system has the ability to accommodate participant and dependent benefit enrollment processing for benefit options. CRITICAL Yes HR.148 The system has the ability to establish multiple eligibility rules. CRITICAL Yes Benefit eligibility date and other rules manually HR.149 The system has the ability to calculate premium amounts based on user-defined tables. CRITICAL Yes HR.150 The system has the ability to start and stop any deductions at any given time. CRITICAL Yes HR.151 The system has the ability to support flexible benefit accounts. CRITICAL Yes HR.152 The system has the ability to support flexible spending accounts enrollment and reimbursement. CRITICAL Yes HR.153 The system has the ability to identify type of coverage (e.g., single, 2-person family). CRITICAL Yes HR.154 The system has the ability to track benefits eligibility. CRITICAL Yes HR.155 The system has the ability to notify employees of benefit eligibility dates. CRITICAL Yes HR.156 The system has the ability to maintain coverage and deduction detail by date.CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to track the following:HR.157 Coverage effective dates;CRITICAL Yes HR.158 Coverage history;CRITICAL Yes HR.159 Name change history;CRITICAL Yes HR.160 Dependent information;CRITICAL Yes HR.161 Beneficiary information; and CRITICAL No HR.162 Years of serviceCRITICAL Yes The system has the ability to maintain premium and deduction amounts for multiple benefit plans including (but not limited to): HR.169 Health Insurance; CRITICAL Yes HR.164 Dental Insurance; CRITICAL Yes HR.165 Vision Insurance; CRITICAL Yes HR.166 Life Insurance; CRITICAL Yes HR.167 Deferred compensation plans, including retirement plans; CRITICAL Yes HR.168 Flexible spending accounts for medical and childcare reimbursement accounts; CRITICAL Yes HR.169 Long term disability; CRITICAL Yes HR.170 Short term disability; CRITICAL Yes HR.171 529.Education Savings Plan; and DESIREDYes HR.172 457 Plan. CRITICAL Yes HR.173 The system has the ability to allow six months open for benefits enrollments and closeouts. DESIRED Yes HR.174 The system has the ability to establish multiple eligibility rules. DESIRED Yes Date and position group HR.175 The system has the ability to track benefit allowance contributions to insurance other than health insurance. DESIRED Yes HR.176 The system has the ability to differentiate for deferred compensation purposes, any employer match. CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.177 The system has the ability to establish the appropriate tax ramifications for the deferred compensation amounts.CRITICAL Yes HR.178 The system has the ability to manually adjust benefit withholdings.CRITICAL Yes HR.179 The system has the ability to maintain the benefit pool even in the certain user-defined non-paid statuses.DESIRED Yes The system has the ability to maintain benefit eligibility data including: HR.180 Length of serviceCRITICAL Yes Hr.181 Age;CRITICAL Yes HR.182 Marital status;CRITICAL Yes By assigning to a BE plan by marital status HR.183 Dependent information for multiple dependents (including name, SSN, Address, other contact information);DESIRED Yes HR.184Employee status (active, retired, leave of absence, suspension, termination, FMLA, military leave, etc.)CRITICALYes HR.185Hours worked by various search criteria (e.g. weekly, bi-weekly, pay period, annually); andCRITICALYes HR.186 Other user defined.DESIRED? Need more information HR.187 The system has the ability to provide tracking for death of employees, retirees or dependent.DESIRED Yes HR.188 The system has the ability to allow mass updates of employee plan designation.DESIRED Yes HR.189 The system has the ability to allow online update of benefits individually and as a group.DESIRED Yes HR.190 The system has the ability to generate summary statements by employees.DESIRED Yes HR.191 The system has the ability to integrate COBRA and Retiree Benefits with General Ledger and Accounts Receivable.DESIRED Yes HR.192 The system has the ability to track and bill health and other benefit payments for retirees.DESIRED Yes With Accounts Receivable module Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments HR.193 The system has the ability to identify leave, start and end dates.CRITICAL Yes HR.194 The system has the ability to identify employee status (e.g. FLMA leave, military leave, retired).CRITICAL Yes HR.195 The system has the ability to track different leave types which accumulate concurrently as defined by user for each employee (e.g. military annual leave, military leave, workers' compensation).DESIRED Yes HR.196 The system has the ability to track leave and place annual or automatic stop on accruals when contract maximums are reached.CRITICAL Yes HR.197 The system has the ability to notify employees of rejected leave requests.CRITICAL Yes HR.198 The system has the ability to provide notices to employees for Family Medical Leave Act (FMLA) events, based on user-defined criteria.DESIRED Yes Employee form; on user demand HR.199 The system has the ability to track FMLA based on user-defined criteria (e.g. length of service, eligibility, previous FMLA use etc.).DESIRED Yes HR.200 The system has the ability to maintain benefit coverage for employees on leave who elect to pay for his or her own coverage.DESIRED Yes HR.201 The system has the ability to produce confirmation letters indicating the employee's current participation levels in all benefit plans.DESIRED Yes HR.202 The system has the ability to interface with the employee’s self-service module for benefit plan open enrollment, benefits and other changes, etc., (with verification process).CRITICAL Yes HR.203 The system has the ability to track current and historical benefit costs including (But not limited to) employer cost, employee cost and total premiums/contributions.DESIRED Yes HR.204 The system has the ability to maintain a record of employee plan history.DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments HR.205 The system has the ability to validate that the employee is eligible for the plan selected.CRITICAL No User determines HR.206 The system has the ability to determine coverage and deduction amounts for the employee using parameters stored in the benefit plan structure tables.CRITICAL Yes HR.207 The system has the ability to support pre-and post-tax payroll deductions.CRITICAL Yes HR.208 The system has the ability to automatically produce payroll deductions based on benefit plan enrollments.CRITICAL Yes HR.209 The system has the ability to process and pay benefits reimbursement on a payroll check.DESIRED Yes HR.210 The system has the ability to retroactively enroll in plans and automatically impact payroll to compute the proper pay adjustments and deductions.CRITICAL Yes HR.211 The system has the ability to retroactively enroll dependents in plans and automatically impact payroll to compute the proper pay adjustments and deductions.CRITICAL Yes HR.212 The system has the ability to recalculate life insurance amounts and costs to be recalculated for all employees at any time during the year based on changed salary, cover, and/or plan cost parameters.DESIRED Yes HR.213 The system has the ability to enter new enrollment data for a future date without changing the current elections until the date of the new enrollment period begins.DESIRED Yes Employee Discipline/Grievances HR.214 The system has the ability to record and track various discipline types that are maintained by the HR department.DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments HR.215 The system has the ability to record and track disciplinary actions (and maintain history) including information on incidents causing the action, steps taken in resolution, and the personnel involved.CRITICAL Yes HR.216 The system has the ability to allow a new supervisor (within the City) to view prior discipline action, with appropriate security.CRITICAL Yes HR.217 The system has the ability to automatically route information to HR, supervisors, etc., regarding disciplinary actions.CRITICAL No User can send message. HR.218 The system has the ability to capture user-entered narrative for each step of grievance process.CRITICAL Yes HR.219 The system has the ability to track all disciplinary complaints, investigations, and actions, including (but not limited to); letters of reprimand; warnings; suspensions; discharges.CRITICAL Yes The system has the ability to capture and maintain disciplinary action detail, including (but not limited to): HR.220 File number; No HR.221 Employee name;CRITICAL Yes On employee record HR.222 Home department;CRITICAL Yes From employee record HR.223 Issue;CRITICAL Yes HR.224 Proposed discipline;CRITICAL No Could be captured in a note HR.225 Date;CRITICAL Yes HR.226 Date discipline rendered;CRITICAL No log could be used HR.227 Supervisor's name;CRITICAL Yes From employee position HR.228 Grievance field indicator;DESIREDNo HR.229 Unlimited notes and/or text entry; andDESIREDYes HR.230 Other user-defined fields.DESIREDNo Notes and Documents are available HR.231 The system has the ability to define multiple grievance rules.DESIRED No Grievance records, but not rules The system has the ability to maintain historical disciplinary action detail, including (but not limited to): HR.232 Employee;CRITICAL Yes HR.233 Date:CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments HR.234 Type of incident;CRITICAL Yes HR.235 Follow-up action; andCRITICAL Yes Step HR.236 Other user-defined fields.DESIRED No There are notes and documents Position Control The system has the ability to perform the following position transactions: HR.237 Add or delete positions;CRITICAL Yes HR.238 Reclassify positions;CRITICAL Yes HR.239 Change job title:CRITICAL Yes HR.240 Transfer positions;CRITICAL Yes HR.241 Freeze or unfreeze positions;CRITICAL Yes HR.242 Activate or inactivate positions;CRITICAL Yes HR.243 Split position funding and/or labor allocation;DESIRED Yes HR.244 Change the number of authorized full-time equivalents per positional andDESIRED Yes HR.245 Record associated effective dates of position transactions.CRITICAL Yes HR.246 The system has the ability to ensure that a position is defined and authorized before it can be budgeted.DESIRED Yes HR.247 The system has the ability to move positions from one location to another.DESIRED No HR.248 The system has the ability to track employee movement between positions.DESIRED Yes HR.249 The system has the ability to maintain multiple probation/adjustment period codes (including temporary position codes).DESIRED Yes HR.250 The system has the ability to assign a unique identifier and title to each position.DESIRED Yes HR.251 The system has the ability to track position budgeted cost.DESIRED Yes HR.252 The system has the ability to track position characteristics including (but not limited to); job classification; position title; work schedule; skills, training and certification requirements.CRITICAL Yes Some of the items are on the employee vs the position. Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments HR.253 The system has the ability to track internal promotions.CRITICAL Yes HR.254 The system has the ability to create budgets at job, grade, position, and organizational levels.CRITICAL Yes Dependent upon chart of accounts HR.255 The system has the ability to provide budget comparisons against actual costs.CRITICAL Yes HR.256 The system has the ability to perform multiple personnel budgeting forecast scenarios, with the ability to save information ("what-if" scenarios).DESIRED Yes HR.257 The system has the ability to capture job title history.DESIRED Yes HR.258 The system has the ability to accommodate budgeting for overall and departmental headcount salaries.CRITICAL Yes HR.259 The system has the ability to accommodate single or multiple funding sources for each positionDESIRED Yes HR.260 The system has the ability to maintain history on job vacancy (position) information for at least ten years.CRITICAL Yes Performance Evaluations HR.261 The system has the ability to accommodate job-specific employee evaluation forms in various formats that can be easily customized by the City.DESIRED Yes HR.262 The system has the ability to attach unlimited performance evaluations to the employee record.CRITICAL Yes HR.263 The system has the ability to capture performance and salary review information.CRITICAL Yes HR.264 The system has the ability to perform evaluation scheduling (including employee, reviewer(s), date).CRITICAL No HR.265 The system has the ability to record performance evaluation detail, including narratives.CRITICAL Yes HR.266 The system has the ability to accommodate electronic performance evaluations, utilizing electronic signatures to notate approval.CRITICAL No No electronic signature HR.267 The system has the ability to notify employees and supervisors of evaluation due dates (through workflow).CRITICAL Yes Dashboard and/or scheduled reports Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments HR.268 The system has the ability to track evaluation completion and overdue status (through workflow0, with periodic and/or continued automatic notifications until completion.CRITICAL Yes Dashboard HR.269 The system has the ability to accommodate performance evaluation "forms" that are linked to employee class (e.g. occupational types, etc.).CRITICAL Yes/No Yes for forms; No for link Training and Certifications The system has the ability to record and update employee training data, including (but not limited to): HR.270 Licenses;CRITICAL Yes HR.271 Certificates;CRITICAL Yes HR.272 Course enrollment/completion; andCRITICAL Yes HR.273 Other user-defined fields.DESIRED No Notes and documents are available HR.274 The system has the ability to track dates of licensure, certification, training, permits and other expirations.CRITICAL Yes HR.275 The system has the ability to provide employee and supervisor notices when expirations are within a user-defined time period.DESIRED Yes Dashboard and scheduled reports HR.276 The system has the ability to provide employee and supervisor notices of violation and expirations.DESIRED Yes/No Yes for expirations; No for violations HR.277 The system has the ability to track driver's license requirements for various job classes.DESIRED Yes HR.278 The system has the ability to track training attendance/completion by employee, division and department.CRITICAL Yes HR.279 The system has the ability to track progress toward and completion of licenses and certifications as required for specific jobs.CRITICAL Yes HR.280 The system has the ability to integrate with imaging/scanning/document management systems.CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments Employee Self Service The system has the ability to provide employees view access to personal information including (but not limited to): HR.281 Name;CRITICAL Yes HR.282 Address;CRITICAL Yes HR.283 Emergency contact information;CRITICAL Yes HR.284 Demographics;CRITICAL Yes HR.285 Benefit information (selected plans, dependents beneficiaries);CRITICAL Yes HR.286 Salary information (base, supplemental, YTD, history);CRITICAL Yes HR.287 Other deductions information (garnishments, child support, voluntary deductions);CRITICAL Yes HR.288 Flexible spending information (amount spent, remaining balance);CRITICAL Yes HR.289 Leave balances; andCRITICAL Yes HR.290 Other user-defined fields.DESIRED Yes Misc. benefits The system has the ability to allow employees to update personal information with appropriate verification process/workflow, including (but not limited to) the following: HR.291 Address;CRITICAL Yes HR.292 Phone number/s;CRITICAL Yes HR.293 Contact information;CRITICAL Yes HR.294 Emergency contact information;CRITICAL Yes HR.295 Direct deposit with attached supporting documentation;CRITICAL Yes HR.296 W4;CRITICAL Yes HR.297 Voluntary deduction amounts;CRITICAL Yes HR.298 Open enrollment at appropriate dates, andCRITICAL Yes HR.299 Other user-defined fields.DESIRED Yes Other benefits HR.300 The system has the ability toprovide notification of changes (as described able) to an employee and a supervisor or other user-defined department.DESIRED Yes HR staff Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments HR.301 The system has the ability to accommodate user-defined approval for Employee Self Service activities (changes, information entry) performed by the employee, including (but not limited to) user verification (via password or other identification verification means).DESIRED Yes Most items are employee to HR, but Leave request and hours entry can have a user-defined workflow. HR.302 The system has the ability allow employees to view pay stub information including (but not limited to) the following: gross pay, taxes, other deductions, net pay, pay period and year-to-date totals.CRITICAL Yes HR.303 The system has the ability to allow employees to review vacation and sick day balances and submit leave requests.CRITICAL Yes HR.304 The system has the ability to allow employees to review and request changes for direct deposit amounts.CRITICAL Yes HR.305 The system has the ability to allow employees to submit time/leave online.CRITICAL Yes HR.306 The system has the ability to display W2s for viewing and printing in a secure environment.CRITICAL Yes HR.307 The system has the ability to display the most recent pay stubCRITICAL Yes General Reporting HR.308 The system has the ability to provide employee benefits reporting.CRITICAL Yes HR.309 The system has the ability to generate reports and forms that comply with EEOC, FMLA, Department of Labor, Military Status and FLSA standards and regulations.CRITICAL Yes HR.310 The system has the ability to provide standard data and reports to meet established State and Federal reporting requirements.CRITICAL Yes HR.311 The system has the ability to generate a list of all employees charged to departments other than their home department.DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments HR.312 The system has the ability to query and generate reports on all information that is tracked and maintained.CRITICAL Yes HR.313 The system has the ability to query and export reports on all information that is tracked and maintained in the system.CRITICAL Yes HR.314 The system has the ability to generate a labor utilization report that shows filled and unfilled positions with user-defined dates and position salary information.DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments General Requirements PR.1 The system has the ability to generate one and only one payroll record per employee. CRITICAL Yes PR.2 The system has the ability to accommodate user-defined tables of acceptable ranges for time entry according to work groups. CRITICAL Yes PR.3 The system has the ability to accommodate an infinite number of employees, departments, jobs, shifts, pay rules, and other user-defined variables. CRITICAL Yes PR.4 The system has the ability to update pay rules and set effective date as desired (including retroactive, immediate/real-time, next payroll, any other future date). CRITICAL Yes Global update PR.5 The system has the ability to accommodate multiple pay periods, including (but not limited to): weekly; bi-weekly; semi-monthly; and monthly. CRITICAL Yes PR.6 The system has the ability to accommodate user-defined overtime rules, including start/stop times, scheduled hours, type of duty performed. CRITICAL Yes PR.7 The system has the ability to accommodate user-defined rules for shift differentials. CRITICAL Yes PR.8 The system has the ability to accommodate user-defined rules for premium pay (overtime and "time and a half") calculations, using variables such as scheduled hours, scheduled vs actual hours. CRITICAL Yes PR.9 The system has the ability to accommodate user-defined rules comp time for non-exempt employees. CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.10 The system has the ability to accommodate user-defined rules for comp time for exempt employees.DESIRED Yes PR.11 The system has the ability to calculate the remaining annualized payroll costs by month including accruals. DESIRED Yes PR.12 The system has the ability to track employee assignments to grants/projects/programs, including the percentage of time spent on those activities. DESIRED Yes This is tracked in time and attendance PR.13 The system has the ability to mask at the field level in the payroll module based on security permissions.DESIRED Yes PR.14 The system has the ability to integrate the payroll and HR modules with the budget module. DESIRED Yes This would be in position budgeting, which works with budgeting. Time Entry and Approval The system has the ability to support a variety of data collection methods and devices, including (but not limited to): PR.15 Terminal/PC entry; CRITICAL Yes PR.16 Time clocks; DESIRED Yes We can import a file from the time clock. PR.17 Swipe card readers; DESIRED Yes The timeclock would need to have this feature PR.18 Bar coding; and DESIRED NO PR.19 Smartphones and mobile devices. CRITICAL Yes PR.20 The system has the ability to support the concurrent use of different types of devices for data collections. DESIRED Yes PR.21 The system has the ability to print weekly timesheets for user-selected employees as necessary. DESIRED NO However, we have solutions that can accommodate. The system has the ability to track and adjust time in the following manner: PR.22 Earned; DESIRED Yes PR.23 Used; DESIRED Yes PR.24 Paid; DESIRED Yes PR.25 Training; DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.26 Vacation; CRITICAL Yes PR.27 Holiday; CRITICAL Yes PR.28 Unpaid leave; CRITICAL Yes PR.29 Administrative leave; CRITICAL Yes PR.30 Adjusted; CRITICAL Yes PR.31 Lost (e.g. vacation not rolled over); CRITICAL Yes PR.32 Sick bank; CRITICAL Yes PR.33 Sick leave; CRITICAL Yes PR.34 Funeral/bereavement leave; CRITICAL Yes PR.35 FLSA hours; CRITICAL Yes PR.36 FMLA hours (available and used); and CRITICAL Yes PR.37 POIC (Police Officer in Change); DESIRED Yes PR.38 Comp time; CRITICAL Yes PR.39 Workers' Compensation; CRITICAL Yes PR.40 Coupons (wellness, unscheduled City-wide days off); DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.41 Personal leave; CRITICAL Yes PR.42 Voluntary doc days; DESIRED Yes PR.43 Civil leave (jury duty, witness duty); CRITICAL Yes PR.44 Military pay; CRITICAL Yes PR.45 Short term disability CRITICAL Yes PR.46 Long term disability CRITICAL Yes PR.47 Other user defined. DESIRED Yes The system has the ability to support the following types of time entry: PR.48 Employee self-entry; CRITICAL Yes PR.49 Batch entry by data entry personnel CRITICAL Yes ESS PR.50 Third party time entry system; and CRITICAL Yes Import into payroll PR.51 Assignment and reassignment of employee time entry by a different supervisor. CRITICAL Yes If there is more than one approver. Req. # Description of Requirement Criticality Response from Vendors Comments PR.52 The system has the ability to accommodate remote site online timesheet data entry with online account validation. CRITICAL Yes ESS PR.53 The system has the ability to allow a user defined comments field in the timesheet. CRITICAL Yes ESS using activity line item PR.54 The system has the ability to restrict time entry to pre-establishment ranges, with authorized override capabilities. CRITICAL No However, we have solutions that can accommodate Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.55 The system has the ability to allow employees to record time for at least 10 different jobs per shift. CRITICAL Yes PR.56 The system has the ability to process and approve time sheets and time reports in a decentralized and electronic format. CRITICAL Yes ESS PR.57 The system has the ability to provide administrative rights to managers (e.g. allow managers to enter employee sick time). CRITICAL Yes PR.58 The system has the ability to require online approval of time by managers. CRITICAL Yes PR.59 The system has the ability to display employee's timesheet totals to enable timekeeper administration (e.g. supervisor) to validate, confirm and approve data. CRITICAL Yes PR.60 The system has the ability to route (through workflow) timecards to multiple manages (including Accounting Department) for review, edit and approval (i.e. in instances where employee has worked for multiple managers). CRITICAL Yes PR.61 The system has the ability to notify employees and/or a supervisor of rejected timecard (via workflow). CRITICAL Yes ESS Req. # Description of Requirement Criticality Response from Vendors Comments PR.62 The system has the ability to designate a back-up timecard and leave requests approval (e.g. when a typical approving manager is not available). CRITICAL No However, we have solutions that can accommodate PR.63 The system has the ability to require electronic signatures for time approval. DESIRED No Yes to electric time approval but not digital signatures. PR.64 The system has the ability to allow overtime approval to occur prior to or after the work has been performed. DESIRED No However, we have solutions that can accommodate PR.65 The system has the ability to reverse overtime with user-defined authorization. CRITICAL Yes Done in Payroll review Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.66 The system has the ability to hold data entered on-line in a suspense of pending file until approved electronically and released for processing. DESIRED YES PR.67 The system has the ability to allow managers to edit employee timecards (with appropriate authorization). CRITICAL Yes PR.68 The system has the ability to allow managers to perform mass edits on employee timecards (with appropriate authorization). DESIRED Yes PR.69 The system has the ability to adjust time entries in prior periods, with an audit trail of change (user, date change). DESIRED No However, we have solutions that can accommodate PR.70 The system has the ability to require an employee to acknowledge changes made to their timecard (submitted by anyone other than the employee). DESIRED No However, we have solutions that can accommodate PR.71 The system has the ability to allow overtime approval to occur prior to or after the work has been performed. DESIRED No However, we have solutions that can accommodate The system has the ability to store time and attendance history data, including (but not limited to): PR.72 Employee name; CRITICAL Yes PR.73 Employee ID number; CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments PR.74 Dates; CRITICAL Yes PR.75 Time leave (e.g. overtime); CRITICAL Yes PR.76 Manager approval history CRITICAL Yes PR.77 The system has the ability to store time and attendance history for at a minimum of six years. CRITICAL Yes PR.78 The system has the ability to store time and attendance history for at a minimum of ten years. DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.79 The system has the ability to accommodate for Fair Labor Standards Act (FLSA) laws based on the City's current pay codes. CRITICAL Yes PR.80 The system has the ability to adhere to all current and future local, State and Federal laws. CRITICAL Yes Leave Time Accrual and Use PR.81 The system has the ability to provide query capabilities for leave and accrual balances. CRITICALYes The system has the ability to capture and track leave for multiple leave types, including (but not limited to): PR.82 Earned; DESIRED Yes PR.83 Used; DESIRED Yes PR.84 Paid; DESIRED Yes PR.85 Training; DESIRED Yes PR.86 Vacation; CRITICAL Yes PR.87 Holiday; CRITICAL Yes PR.88 Unpaid leave; CRITICAL Yes PR.89 Administrative leave; CRITICAL Yes PR.90 Adjusted; CRITICAL Yes PR.91 Lost; CRITICAL Yes PR.92 Sick bank; CRITICAL Yes PR.93 Sick leave; CRITICAL Yes PR.94 Funeral/bereavement leave; CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.95 FLSA hours; CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments PR.96 FMLA hours CRITICAL Yes PR.97 POIC (Police Officer in Charge); DESIRED Yes PR.98 Comp time; CRITICAL Yes PR.99 Workers' Compensation CRITICAL Yes PR.100 Coupons (wellness, unscheduled City-wide days off); DESIRED Yes PR.101 Personal days; CRITICAL Yes PR.102 Voluntary doc days; DESIRED Yes PR.103 Civil leave (jury duty, witness duty); CRITICAL Yes PR.104 Military pay; DESIRED Yes PR.105 Short term disability; CRITICAL Yes PR.106 Long term disability; CRITICAL Yes PR.107 Other user-defined/ DESIRED Yes PR.108 The system has the ability to capture and maintain breaks in service. DESIRED PR.109 The system has the ability to provide comp time calculation functionality. CRITICAL Yes Need more information on this. Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.110 The system has the ability to accrue sick leave time every pay period for all qualified employees (on a work Status). DESIRED Yes PR.111 The system has the ability to provide separate user-defined accrual processes by leave type (such as vacation, comp, sick and personal time). CRITICAL Yes PR.112 The system has the ability to set and maintain leave and vacation accrual schedules by job class (or other user-defined classification). CRITICAL Yes PR.113 The system has the ability to accrue sick and vacation at the end of a user specified period (e.g. day, week, pay period, or month). CRITICAL yes Req. # Description of Requirement Criticality Response from VendorsComments PR.114 The system has the ability to accommodate partial eave accrual on a temporary and/or permanent basis (e.g. during FMLA leave). DESIRED Yes PR.115 The system has the ability to accommodate cumulative (rollover) and non-cumulative (used-it-to-lose-it) Leave accruals. CRITICAL Yes PR.116 The system has the ability to set a maximum for cumulative (rollover) leave accruals. CRITICAL Yes PR.117 The system has the ability to maintain leave accrual schedules, containing leave type and accrual rates. CRITICAL Yes PR.118 The system has the ability to temporarily suspend leave accrual (e.g. during unpaid leave). CRITICAL Yes PR.119 The system has the ability to calculate liability for unused earned leave by individual employee at regular intervals and on demand. CRITICAL Yes PR.120 The system has the ability to calculate liability for unused earned leave by groups of employees at regular intervals on demand. CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.121 The system has the ability to calculate liability for unused earned leave in accordance with city payout rules (i.e.50% is paid years of service). DESIRED Yes PR.122 The system has the ability to track and calculate the value of lost earned time at regular intervals and on demand. DESIRED yes Reporting PR.123 The system has the ability to alert managers on leave usage exceptions. DESIRED yes Dashboard The system has the ability to perform electronic approval process to approve overtime and leave time, including (but not limited to): PR.124 Request submittal; DESIRED Yes ESS PR.125 Manager(s) review/decisioning; DESIRED Yes ESS PR.126 Request status monitoring; DESIRED Yes ESS PR.127 Notification of request approval/decline; and DESIRED Yes ESS Req. # Description of Requirement Criticality Response from Vendors Comments PR.128 Other user defined. DESIRED PR.129 The system has the ability to provide drill down capability to see attachments to records based on security permissions. CRITICAL Yes PR.130 The system has the ability to notify user of attempt to submit leave request where accrued time is less than requested time. CRITICAL Yes PR.131 The system has the ability to submit sick and vacation leave request prior to accrual with appropriate workflow. DESIRED Yes PR.132 The system has the ability to provide employees online access to leave request status (e.g. pending, under review, etc.). CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.133 The system has the ability to automatically track FMLA leave based on Federal requirements. CRITICAL Yes PR.134 The system has the ability to restrict or allow sick and vacation leave to be used only after it is earned. CRITICAL Yes PR.135 The system has the ability to send an alert/notification to employee and supervisor when accrual maximum/minimum for leave time(s) is approaching. DESIRED Yes Dashboard smartcard PR.136 The system has the ability to deduct military, vacation and/or personal leave time if not used by City defined year end, with option to override with appropriate security. CRITICAL Yes Check ProcessingThe system has the ability to print the following information on pay stubs: PR.137 Benefit tracking; DESIRED Yes PR.138 Leave tracking; CRITICAL Yes PR.139 YTD payroll; CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments PR.140 YTD benefits;DESIRED Yes PR.141 YTD leave; CRITICAL Yes PR.142 Itemized deductions (e.g. garnishments, union dues, flower fund, Community Foundation deductions, etc.) CRITICAL Yes PR.143 Other user-defined fields. DESIRED Yes The system has the ability to print multiple messages on pay stubs, specific to any combination of the following: PR.144 City-wide; DESIRED No PR.145 Department; DESIRED No Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.146 Division; DESIRED no PR.147 Job classification; DESIRED No PR.148 Employee; DESIRED No PR.149 Benefits status; DESIRED No PR.150 Health plan; DESIRED No PR.151 Any deduction category; DESIRED No PR.152 Other user-defined categories. DESIRED No PR.153 The system has the ability to provide a user-defined payroll direct deposit pay stubs. DESIRED Yes Although, we will encourage you to pick from one of our templates. PR.154 The system has the ability to provide a user-defined payroll check stub format. CRITICAL Yes PR.155 The system has the ability to print excess pay and deductions on a supplemental report (overflow report) that does not utilize check or voucher stock (e.g. when all pay and deductions will not print on the check stub. CRITICAL Yes PR.156 The system has the ability to send electronic payroll stubs to employees through email. CRITICAL Yes PR.157 The system has the ability to allow employees to view their pay stubs or direct deposit remittance slips on-line, through employee self-service, including current and past pay periods. CRITICAL Yes ESS Req. # Description of Requirement Criticality Response from Vendors Comments PR.158 The system has the ability to issue one paycheck/pay stub for employees holding multiple jobs with the City. DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.159 The system has the ability to automatically produce direct deposit tapes/files for banks. CRITICAL Yes PR.160 The system has the ability to transmit direct deposit funds to more than one account within the same banking institution (e.g. savings, checking and loan accounts). CRITICAL Yes PR.161 The system has the ability to accommodate direct deposit to multiple banking institutions at minimum of four. DESIRED Yes PR.162 The system has the ability to accommodate deposit of paychecks through electronic fund transfer (EFT). CRITICAL Yes PR.163 The system has the ability to reimburse employees for travel and other expenses. DESIRED Yes We don’t have a reimbursement module, but this can be done in Requisitions>PO then the check coming out of AP PR.164 The system has the ability to prevent negative or zero-dollar amount checks from being created. CRITICAL Yes PR.165The system has the ability to accommodate review and approval of payroll prior to production run (e.g. first by department heads, second by the HR and Payroll departments). CRITICALYes PR.166 The system has the ability to generate a hardcopy payroll pre-list prior to final payroll production run. DESIRED Yes PR.167 The system has the ability to do "what-if" scenarios of payroll runs, prior to running the actual payroll. CRITICAL Yes You can run & re-run the process as many time as you need to. PR.168 The system has the ability to produce non-standard payrolls with an automatic update of all employee and employer accumulators. CRITICAL Yes PR.169 The system has the ability to issue manual checks outside of the regular payroll schedule. CRITICAL Yes With proper security. Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to provide a payroll proof list of all payroll calculations, gross-to-net, before checks are produced, including (but not limited to): Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.170 Hours by type; CRITICAL Yes PR.171 Earnings by type; CRITICAL Yes PR.172 Employee tax liabilities; CRITICAL Yes PR.173 Employee deduction amount; CRITICAL Yes PR.174 Employee contribution amount; CRITICAL Yes PR.175 Deductions not taken and set-up in arrears; DESIRED Yes PR.176 Employer portion of taxes; CRITICAL Yes PR.177 Totals by employee, grant, project, cost center, division, department, location, total City; and DESIRED Yes PR.178 User-specified ranges. DESIRED Yes PR.179 The system has the ability to run audit report to reflect that payroll has captured benefit deductions. DESIRED Yes PR.180 The system has the ability to run audit report to reflect discrepancies between benefits and payroll information. DESIRED Yes PR.181 The system has the ability to provide for adjustments to final paycheck. CRITICAL Yes PR.182 The system has the ability to issue payment corrections. CRITICAL Yes PR.183 The system has the ability to perform overpayment adjustments CRITICAL Yes PR.184 The system has the ability to calculate retroactive amounts due on all forms of pay for individual employees for up to 24 months or user defined period of time. DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.185 The system has the ability to apply different separation pay-out rules depending on factors including (but not limited to); contract date; leave balance as of a certain date; other user-defined factors. CRITICAL Yes PR.186 The system has the ability to pay out or convert vacation/sick leave if user-defined number of days have accumulated at specified time of the year.DESIRED Yes PR.187 The system has the ability to accommodate pay rate steps for pay grades (at least at the hourly, bi-monthly, and annual levels). CRITICAL Yes PR.188 The system has the ability to automatically allocate employee benefit costs across multiple funds based on user-defined criteria. DESIRED Yes PR.189 The system has the ability to charge overtime to several different overtime accounts. DESIRED Yes The system has the ability to provide reconciliation functionality, including (but not limited to): PR.190 Changes to employee pay, deductions and taxes; DESIRED Yes PR.191 Changes to employer deductions and taxes; DESIRED Yes PR.192 Gross pay changes; DESIRED Yes PR.193 Number of paychecks/direct deposits per pay cycle; DESIRED Yes PR.194 Supplemental pays; DESIRED Yes PR.195 Federal and State government reporting for each employee; and CRITICAL Yes PR.196 Other user-defined reconciliation. DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.197 The system has the ability to print/reprint W-2s on a laser printer. CRITICAL Yes PR.198 The system has the ability to process the first of the year payroll with the year end W-2 simultaneously in production. CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments PR.199 The system has the ability to accommodate unlimited number of user-defined pay rates. CRITICAL Yes PR.200 The system has the ability to automatically pass cost detail to the Budget system. CRITICAL Yes This is handled in position budgeting, not payroll but it can be done. PR.201 The system has the ability to natively integrate with General Ledger and does not require a separate chart of accounts. CRITICAL Yes General Reporting PR.202 The system has the ability to produce and modify Form 941s in electronic format. CRITICAL Yes PR.203 The system has the ability to produce ad hoc reports. CRITICAL Yes PR.204 The system has the ability to generate a labor utilization report that shows filed and unfiled positions with user-defined dates and position salary information. DESIRED Yes PR.205 The system has the ability to accommodate proper reporting of all taxed and non-taxed employee income. DESIRED Yes PR.206 The system has the ability to generate the monthly and quarterly state taxes reports (e.g. 501N, W-3N, 941N) with ability to submit electronically. CRITICAL Yes WE can create the extract file that then can be uploaded to the state or federal agency. PR.207 The system has the ability to produce all quarterly federal reports (e.g. W-2).CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.208 The system has the ability to produce 941. W-2, Unemployment, Census Bureau and other Federal and State required reports. CRITICAL Yes PR.209 The system has the ability to produce all W-2 information for employees and reporting agencies (e.g. IRS, state, etc). CRITICAL Yes Req. # Description of Requirement Criticality Response from Vendors Comments PR.210 The system has the ability to support electronic submission of reports for certain grants and/or federal requirements (e.g. 1099, W-2, time and effort reporting, etc.) DESIRED Yes PR.211 The system has the ability to track and generate reports on employees paid through Accounts Payable and Payroll (reconciliation of the two modules for "checks and balances"). DESIRED No The system has the ability to generate reconciliation reporting including (but not limited to) the following: PR.212 Biweekly payroll balancing – exception reporting by Department and City wide; CRITICAL Yes PR.213 Biweekly payroll reconciliation to the General Ledger – exception reporting; CRITICAL Yes PR.214 Monthly payroll liability accounts reconciliation – exception reporting; DESIRED Yes PR.215 Ad hoc reconciliation reporting at the department level. DESIRED Yes The system has the ability to generate Payroll reporting, including (but not limited to) the following: PR.216 Payroll balancing, including wages, taxes, withholdings; DESIRED Yes PR.217 Tax reporting for remitting payroll tax deposits; DESIRED Yes PR.218 Employee Labor Distribution Report (by department at the employee level); CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE PR.219 Audit reporting showing journal voucher that passes to the General Ledger; CRITICAL Yes PR.220 Direct deposit report to reconcile ACH and identify potential errors; and CRITICAL Yes PR.221 Emergency time reporting (e.g. FEMA complaint time reporting). DESIRED Yes Req. # Description of Requirement Criticality Response from Vendors Comments PR.222 The system has the ability to provide online screens and reports related to earnings including quarter-to-date, year-to-date (calendar and fiscal), and user-defined period (weekly, bi-weekly, monthly, semi-monthly). CRITICAL Yes PR.223 The system has the ability to query and generate reports for one-time deductions. DESIRED Yes PR.224 The system has the ability to query and generate reports that delineate regular and overtime hours worked per pay period for user-defined period of time. CRITICAL Yes PR.225 The system has the ability to query and generate reports that delineate regular and overtime hours worked per pay period, for a user-defined period of time, on an individual employee basis. CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments General Requirements PI.1 The system has the ability to provide a permitting and inspections module that is integrated with all other system modules CRITICAL Yes PI.2 The system has the ability to allow user-defined tables for the definition. CRITICAL Yes PI.3 The system has the ability to support online entry and maintenance of CRITICAL Yes PI.4 The system has the ability to maintain a Contractor master file. CRITICAL Yes PI.5 The system has the ability to maintain an Architect master file CRITICAL Yes PI.6 The system has the ability to maintain an Engineer master file. CRITICAL Yes PI.7 The system has the ability to maintain a Developer master file. CRITICAL Yes PI.8 The system has the ability to drill down to sub-permits associated with a master permit. CRITICAL Yes PI.9 The system has the ability to prevent deletion of fees that have been receipted. CRITICAL Yes The system has the ability to track the following fees associated with a permit: PI.10 Permit charge; CRITICAL Yes PI.11 Other charges; CRITICAL Yes PI.12 Inspection fee; CRITICAL Yes PI.13 Additional inspection fees; CRITICAL Yes PI.14 Planning fees; CRITICAL Yes PI.15 Pre-paid fees; CRITICAL Yes PI.16 Total charge; CRITICAL Yes PI.17 Total collected; and CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.18 Other, user-defined. DESIRED Yes The system has the ability to accommodate the following types of fee adjustments at any time throughout the permitting processing: PI.19 Refunds with appropriate permissions and supervisor approval.CRITICAL Yes PI.20 Adjustments with appropriate permissions and supervisor approval. CRITICAL Yes PI.21 Ability to mark as no fee; CRITICAL Yes PI.22 Ability to double fee; CRITICAL Yes PI.23 Ability to triple fee; and CRITICAL Yes PI.24 Revision (amendments) fees with appropriate permissions and supervisor approval. CRITICAL Yes PI.25 The system has the ability to store scanned images related to a permit. CRITICAL Yes PI.26 The system has the ability to store documents related to a permit. CRITICAL Yes PI.27 The system has the ability to allow for user-defined permit number structure (minimum of 11 alphanumeric fields). CRITICAL Yes PI.28 The system has the ability for user-defined sub-permit number structure. CRITICAL Yes Permit Application PI.29 The system has the ability to maintain payment history of applicants. CRITICAL Yes PI.30 The system has the ability to allow for the establishment of base information on a frequent application type, and allow for an unlimited number of baseline applications to be established. CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.31 The system has the ability to accept public comments associated with a permit application including date and nameDESIRED No Not from EnerGov CSS, but through Tyler 311. The system has the ability to maintain the following information for each permit application: PI.32 Permit type; CRITICAL Yes PI.33 Class of work; CRITICAL Yes PI.34 Start date; CRITICAL Yes PI.35 Submission date; CRITICAL Yes PI.36 Expected Completion date; CRITICAL Yes PI.37 Expiration date; CRITICAL Yes PI.38 Application date; CRITICAL Yes PI.39 Event date; CRITICAL YesPI.40 Reviewer name; CRITICAL Yes PI.41 Property information; CRITICAL Yes PI.42 Variance; CRITICAL Yes PI.43 Text remarks (unlimited characters); CRITICAL Yes PI.44 Zoning conditions/stipulations; CRITICAL Yes PI.45 Outside source indicator; and CRITICAL Yes PI.46 Other, user defined CRITICAL Yes The system has the ability to maintain the following information for each permit: PI.47 Permit type; CRITICAL Yes PI.48 Class of work; CRITICAL Yes PI.49 Start date; CRITICAL Yes PI.50 Issue date; CRITICAL Yes PI.51 Actual Expiration date; CRITICAL Yes PI.52 Inspector name; CRITICAL Yes PI.53 Inspector zone; CRITICAL Yes PI.54 Property information; CRITICAL Yes PI.55 Inspection date(s) or frequency; CRITICAL Yes PI.56 Text remarks (unlimited characters); CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.57 Violations CRITICAL Yes PI.58 Outside source indicator; CRITICAL Yes PI.59 Occupancy type and date; CRITICAL Yes PI.60 Multiple occupancy type and date; CRITICAL Yes PI.61 Rental property indicator (check box); CRITICAL Yes PI.62 Rental property permits, and CRITICAL Yes PI.63 Other, user defined. CRITICAL Yes The system has the ability to accept application payments from the following sources: PI.64 In person; CRITICAL Yes PI.65 Web, payment portal; and CRITICAL Yes PI.66 Credit card merchant CRITICAL Yes PI.67 The system has the ability to allow multiple addresses to be entered for a permit application (i.e. environmental health needs to have separate for restaurant locations and business locations). DESIRED Yes PI.68 The system has the ability to allow multiple phone numbers to be entered for a permit application. DESIRED Yes PI.69 The system has the ability to accept a permit application with no address by application type.NA Yes PI.70 The system has the ability to duplicate an existing permit application and all associated information to a new permit application at a different location (without manual rekeying of the data). CRITICAL Yes Permit Tracking and Approvals PI.71 The system has the ability to track violations and corrections to violations. CRITICAL Yes PI.72 The system has the ability to track permits by contractor regardless of the permit applicant. CRITICAL Yes PI.73 The system has the ability to track/search permits by any data element within the permit data file. CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.74 The system has the ability to track a permit through the entire permitting process. CRITICAL Yes PI.75 The system has the ability to establish routing tables in workflow for the approval of permits. CRITICAL Yes PI.76 The system has the ability to monitor and track the status of pending approval in workflow. CRITICAL Yes PI.77 The system has the ability to support conditional decisions for the routing of approval of permits. CRITICAL Yes PI.78 The system has the ability to track and notify when permits are soon to expire (based on user-defined number of days). CRITICAL Yes PI.79 The system has the ability to allow project level organization for permit records at any point in the process including the application process (e.g. under the master building permit (user-defined), the ability to allow companion permit records like electrical and mechanical to be linked to the master permit). CRITICAL Yes PI.80 The system has the ability to allow address query based on the master and record. CRITICAL Yes PI.81 The system has the ability to allow address query based on the master and record. CRITICAL Yes PI.82 The system has the ability to allow the user to edit permit application data automatically populated (e.g. data the system returns as a result of user address query to master land record). CRITICAL Yes PI.83 The system has the ability to add additional review actions and inspections to a permit. CRITICAL Yes PI.84 The system has the ability to associate fees with specific permit types. CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.85 The system has the ability to define an unlimited number of fee calculations without custom programming. CRITICAL Yes PI.86 The system has the ability to estimate permit fees via the web for user defined permit types. CRITICAL Yes PI.87 The system has the ability to define an effective date to permit fee calculations. CRITICAL Yes PI.88 The system has the ability to define an effective date associated with an override for permits. CRITICAL Yes PI.89 The system has the ability to associate an expiration date with permit fee quotes calculated upon permit application.CRITICAL No Need more information Permit Issuance PI.90 The system has the ability to maintain online history of all fees billed. CRITICAL Yes PI.91 The system has the ability to allow issued permits to be cancelled with appropriate controls. CRITICAL Yes PI.92 The system has the ability to allow issued permits to be extended. CRITICAL Yes PI.93The system has the ability to maintain tables of the calculation of various fees to accommodate fee changes. CRITICALYes PI.94 The system has the ability to associate an expiration date with permit fee quotes calculated upon permit application. CRITICAL No Need more information PI.95 The system has the ability to provide drill down capability to see attachments to records based on security permissions. CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.96 The system has the ability to calculate fees based upon project/job value. CRITICAL Yes PI.97 The system has the ability to calculate job cost based upon lot acreage (e.g. sewer connections, stormwater fees). DESIRED Yes PI.98 The system has the ability to calculate job cost based upon square footage to provide a valuation.CRITICAL Yes PI.99 The system has the ability to calculate job cost based upon fixtures (e.g. plumbing, mechanical). CRITICAL Yes PI.100 The system has the ability to calculate fees based upon combination. CRITICAL Yes PI.101 The system has the ability to calculate fees based upon discounts or offsets to fees. CRITICAL Yes PI.102 The system has the ability to maintain a history of all permits issued. CRITICAL Yes PI.103 The system has the ability to issue permits to one or more addresses. CRITICAL Yes PI.104 The system has the ability to issue permits by type to parcels with or without an address. CRITICAL Yes PI.105 The system has the ability to generate a permit expiration date based upon an application issuance date. CRITICAL Yes PI.106 The system has the ability to allow the addition of ad-hoc fees to a permit at any time in the process. CRITICAL Yes PI.107 The system has the ability to maintain reoccurring business inspections such as, but not limited to; day care inspections, fire inspections and CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to utilize state, national or user defined construction cost data by the following: PI.108 Construction Type; CRITICAL Yes PI.109 Square footage to help calculate project valuation; and CRITICAL Yes PI.110 Fixtures CRITICAL Yes PI.111 The system has the ability to associate user-defined fields with specific permit types and indicate required fields by permit type. CRITICAL Yes PI.112 The system has the ability to allow automated flagging of permit records at pre-defined milestones/processes to identify special conditions to be resolved prior to allowing subsequent permit processes from taking place. CRITICAL Yes PI.113 The system has the ability to allow user-defined criteria or look-u[ tables involving zoning development standards (e.g. building square footage minimums or maximums to help flag conditions or requirements specific to property location prior to approval). CRITICAL Yes PI.114 The system has the ability to "re-route" permit to appropriate departments so that revisions created by one department can be reviewed by other departments. CRITICAL Yes PI.115 The system has the ability to override calculated fee values with appropriate supervisory clearance. CRITICAL Yes PI.116 The system has the ability to allow review routing based o user-defined reviewing parties and agencies per permit type and sub-type simultaneously. CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.117 The system has the ability to allow for interactive printing of permits using customized permits print format.CRITICAL Yes PI.118 The system has the ability to allow for interactive printing of certificates of occupancy using customized print format. CRITICAL Yes PI.119 The system has the ability to allow for interactive printing of Conditional Use Permits, or any other permit requiring zoning approval, using customized print format. CRITICAL Yes PI.120 The system has the ability to allow notes from the plan review and general application notes to be fluffed to print on the permit.CRITICAL Yes PI.121 The system has the ability to provide the option to print either combination permits (multiple permits per form) or single permits (one permit per form). DESIRED Yes The system has the ability to allow the user to perform editing prior to the printing of permits for items including: PI.122 Fee paid; CRITICAL Yes PI.123 All permits, modified; and CRITICAL Yes PI.124 Other user-defined fields. CRITICAL Yes PI.125 The system has the ability to allow user to override permitting fees with appropriate security permissions. CRITICAL Yes PI.126 The system has the ability to attach standard details such as a traffic control plan information to a permit. DESIRED Yes PI.127 The system has the ability to print supporting documentation when printing a permit (e.g. traffic control plan documentation). DESIRED Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.128 The system has the ability to prompt user to return bonds collected in connection with a temporary certificate of occupancy upon inspection and approval. CRITICAL Yes Inspection Data PI.129 The system has the ability to allow online entry and maintenance of inspection notices. CRITICAL Yes PI.130 The system has the ability to allow online entry and maintenance of second inspection notices. CRITICAL Yes PI.131 The system has the ability to allow online entry and maintenance of inspection renewals. CRITICAL Yes PI.132 The system has the ability to allow online entry and maintenance of multiple inspection types. CRITICAL Yes PI.133 The system has the ability to populate inspection information based upon entering the permit ID number. CRITICAL Yes PI.134 The system has the ability to allow the input of inspection data by handheld devices including laptops and wireless mobile devices. CRITICAL Yes PI.135 The system has the ability to allow for an unlimited number of inspections on each application. CRITICAL Yes The system has the ability to maintain online history of all inspection fees billed including the following information: PI.136 Type; CRITICAL Yes PI.137 Description; CRITICAL Yes PI.138 Date and time; CRITICAL Yes PI.139 Inspector CRITICAL Yes PI.140 Results; CRITICAL Yes PI.141 Status; CRITICAL Yes PI.142 Violations; CRITICAL Yes PI.143 Comments; CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PI.144 Report by inspector of future inspection dates; andCRITICAL Yes PI.145 Inspection frequency.CRITICAL Yes PI.146 The system has the ability to attach photographs with comments.CRITICAL Yes PI.147 The system has the ability to allow for the entry of inspector's notes for each visit.CRITICAL Yes PI.148 The system has the ability to apply fees based on attributes of the permit, parcel, customer or user-defined fields.CRITICAL Yes PI.149 The system has the ability to allow users to override inspection fees with appropriate security permissions.CRITICAL Yes PI.150 The system has the ability to establish sign off authority by user.CRITICAL Yes PI.151 The system has the ability to provide a single screen data entry point for recording inspection results.CRITICAL Yes PI.152 The system has the ability to maintain history regarding review comments and inspection history.CRITICAL Yes The system has the ability to track the following inspection request fields: PI.153 Builder name;CRITICAL Yes PI.154 Associated permit number;CRITICAL Yes PI.155 Owner name;CRITICAL Yes PI.156 Contact name;CRITICAL Yes PI.157 Contact phone number;CRITICAL Yes PI.158 Subdivision name and section;CRITICAL Yes PI.159 Parcel ID;CRITICAL Yes PI.160 Lot block number;CRITICAL Yes PI.161 Street address;CRITICAL Yes PI.162 Time of call;CRITICAL Yes PI.163 Type of inspection requested;CRITICAL Yes PI.164 Internal request checkbox; andCRITICAL Yes PI.165 Other user-identified fields.CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments PI.166 The system has the ability to include user-defined re-inspection penalties.CRITICAL Yes PI.167 The system has the ability to record inspection results remotely (in the field).CRITICAL Yes PI.168 The system has the ability to update inspection data remotely (in the field).CRITICAL Yes PI.169 The system has the ability to provide the software necessary to record and update inspections in the field.CRITICAL Yes PI.170 The system has the ability to interface with electronic inspection devices, allowing inspector to enter findings while at the site.CRITICAL Yes PI.171 The system has the ability to accommodate data download for electronic inspection devices.CRITICAL Yes PI.172 The system has the ability to issue and track letters of completion.CRITICAL Yes PI.173 The system has the ability to automatically notify external agencies the results of an inspection via e-mail (i.e. notification to electric companies).CRITICAL Yes PI.174 The system has the ability to issue and track certificate of occupancy.CRITICAL Yes PI.175 The system has the ability to notify inspector when Temporary CO has expired, for the purpose of re-inspection and issuance of final CO.CRITICAL Yes Inspection Scheduling PI.176 The system has the ability to automate inspector supervisor assignments.DESIRED Yes PI.177 The system has the ability to automate inspection assignments by inspection type.DESIRED Yes PI.178 The system has the ability to automate inspection assignments by geographical area.DESIRED Yes PI.179 The system has the ability to automate inspection assignments by a user-defined data source.DESIRED Yes PI.180 The system has the ability to generate inspection checklists based upon the type of inspection.DESIRED Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments The system has the ability to perform error checking during inspection scheduling to ensure the following, with ability to override with appropriate security permissions: PI.181 Contractors' licenses are valid;DESIRED Yes PI.182 Pre-requisite inspections ae being performed;DESIRED Yes PI.183 Inspections are performed in the proper sequence;DESIRED Yes PI.184 All required fees have been paid;DESIRED Yes PI.185 The permit has not expired;DESIRED Yes PI.186 The type of inspection requested is valid for the permit; andDESIRED Yes PI.187 The permit has not been placed on hold.DESIRED Yes The system has the ability to generate inspection schedules that accommodates entering the following scheduling constraints: PI.188 Normal operating hours;DESIRED Yes PI.189 Observed holidays;DESIRED Yes PI.190 Single occurrence vacations by inspector;DESIRED Yes PI.191 Single occurrence shut-down days;DESIRED Yes PI.192 Other user defined dates; andDESIRED Yes PI.193 Outside normal business hours with associated additional fees.DESIRED Yes PI.194 The system has the ability to reassign inspections to another inspector (i.e. due to absence);DESIRED Yes PI.195 The system has the ability to accommodate the logging of inspection results.DESIRED Yes PI.196 The system has the ability to track and maintain inspection results.DESIRED Yes PI.197 The system has the ability for the set up of user-defined inspection sequences, based on type of work performed.DESIRED Yes PI.198 The system has the ability to allow for customization of inspection sequence, as required on a case-by-case basis.DESIRED Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments Rental Inspection Program The system has the ability to record sufficient property address information at the time of registration to include, but not limited to: PI.199 Property type (e.g. single-family dwelling, duplex, etc.);DESIRED Yes PI.200 Unit location (e.g. within a townhouse or apartment);DESIRED Yes PI.201 Address;DESIRED Yes PI.202 Owner name;DESIRED Yes PI.203 Owner contact information;DESIRED Yes PI.204 Resident name;DESIRED Yes PI.205 Resident contact information;DESIRED Yes PI.206 Resident move-in date;DESIRED Yes PI.207 Proof of Pest Control Inspection Results; andDESIRED Yes PI.208 Other user-defined fields.DESIRED Yes PI.209The system has the ability to set effective dates for tenant information changes.DESIREDYes PI.210The system has the ability to track City rental ID number for each property.DESIREDYes PI.211The system has the ability to support inspection checklists.DESIREDYes PI.212The system has the ability to track inspection history for each rental unit.DESIREDYes PI.213The system has the ability to calculate registration fees based upon dwelling type.DESIREDYes PI.214 The system has the ability to setup recurring notifications of inspections based upon previous inspection results (i.e. a property failed most recent inspection and requires annual inspections as a result).DESIRED Yes Reporting PI.215 The system has the ability to generate ad hoc reports.CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments PI.216 The system has the ability to export reports to Microsoft Office tools.CRITICAL Yes PI.217 The system has the ability to generate a report of the number of days that a permit has been in process, from application to issuance.CRITICAL Yes The system has the ability to generate a report of permit activity including:CRITICAL PI.218 Total elapsed time;CRITICAL Yes PI.219 Times spent by each review level; andCRITICAL Yes PI.220 Other user-defined activities.CRITICAL Yes The system has the ability to generate permit by type for the following: PI.221 Permits issued within a user-defined date range;CRITICAL Yes PI.222 Permits with no activity based upon user-defined threshold;CRITICAL Yes PI.223 Permit activity within a user defined are based upon GIS mappingCRITICAL Yes PI.224 Applications submitted within a user-defined date range;CRITICAL Yes PI.225 Inspections performed within user-defined date range;CRITICAL Yes PI.226 Inspections performed a multi-unit dwelling within a user-defined range;CRITICAL Yes PI.227 Inspector activity within a user-defined date range;CRITICAL Yes PI.228 Plan review processing - number of applications processed;CRITICAL Yes PI.229 Plan review processing - average days to process;CRITICAL Yes PI.230 Plan review processing – other user-defined;CRITICAL Yes PI.231 Certificates of Occupancy activity;CRITICAL Yes PI.232 Rental Inspection Certificate activity;CRITICAL Yes PI.233 Permits listings by contractor;CRITICAL Yes PI.234 Applicant file mailing labels (with option to export);CRITICAL Yes PI.235 Permit expiration reports;CRITICAL Yes Permitting and Inspections– General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of RequirementCriticality Response from Vendors Comments PI.236 Cap and removal; andCRITICAL PI.237 Other, user definedCRITICAL PI.238 The system has the ability to generate inspection schedule workload reports by date and inspector.CRITICAL Planning – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Plan Applications PZ.1 The system has the ability to provide a planning and zoning module that is integrated with all other system modules. CRITICAL Yes PZ.2 The system has the ability to capture basic planning project application information. CRITICAL Yes PZ.3 The system has the ability to track the status of applications. CRITICAL Yes PZ.4 The system has the ability to assign fees for plan project applications. CRITICAL Yes PZ.5 The system has the ability to allow user-defined application types (i.e. annexation, master plan, subdivision, zoning, sign, variance, etc.) CRITICAL Yes PZ.6 The system has the ability to allow user-defined sub-types (preliminary plat; final plat; re-plat, zone change, etc.). CRITICAL Yes The system has the ability to track and maintain application status with dates including the following: PZ.7 Approved; CRITICAL Yes PZ.8 Approved with conditions; CRITICAL Yes PZ.9 Multiple administrative approval; CRITICAL Yes PZ.10 Denied; CRITICAL Yes PZ.11 Withdrawn; and CRITICAL Yes PZ.12 User-defined status codes, which are maintained in a table, by authorized user, with appropriate security. CRITICAL Yes The system has the ability to require the following minimum submittal requirements: PZ.13 Application; CRITICAL Yes PZ.14 Application Fees; CRITICAL Yes PZ.15 Appropriate number of plan copies; and CRITICAL Yes PZ.16 Required documents of Application type. CRITICAL Yes Planning – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PZ.17 The system has the ability to attach comments to plan records to describe status/reason (e.g. approval pending due to waiting on bonds and plats from developer). CRITICAL Yes PZ.18 The system has the ability to track/search project by project name. CRITICAL Yes PZ.19 The system has the ability to track/search project by other user-defined fields. CRITICAL Yes PZ.20 The system has the ability to allow for as many as 99 parcels to be associated with an application. CRITICAL Yes PZ.21 The system has the ability to assign unique application numbering (alpha-numeric with a minimum of 8) and application classification to aid in determining applications/submittal types (i.e. subdivision, variance, zoning, etc.). CRITICAL Yes PZ.22 The system has the ability to allow project level organization for application records at any point in the process. CRITICAL Yes PZ.23 The system has the ability to provide properly information for all properties associated with a project. CRITICAL Yes PZ.24 The system has the ability to allow as many as 99 properties to be associated with a project. CRITICAL Yes PZ.25 The system has the ability to drill down to companion applications associated with master record. CRITICAL Yes PZ.26 The system has the ability to maintain historical data by physical address, parcel or tract location or development name. Data should include project specific details regardless of development aspect. CRITICAL Yes Planning – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PZ.27 The system has the ability to provide capability for GIS browsing that will pinpoint location of projects by number, address, owner name and/or parcel number. CRITICAL Yes PZ.28 The system has the ability to allow checklists and approval requirements to be overridden with appropriate security permissions. CRITICAL Yes PZ.29 The system has the ability to allow system-generated letters to be modified with appropriate security permissions. CRITICAL Yes The system has the ability to provide automated work assignment to assign an application/project to: PZ.30 Planning staff for assignment to specific planner; and CRITICAL Yes PZ.31 Direct planner assignment by type. CRITICAL Yes PZ.32 The system has the ability to provide workflow capability to automatically track and route projects through various user-defined processes. CRITICAL Yes PZ.33 The system has the ability to allow review workflow to be initiated from multiple departments with separate review steps depending on plan review type (i.e. items originating in engineering). CRITICAL Yes PZ.34 The system has the ability to capture comments as part of the review process. CRITICAL Yes PZ.35 The system has the ability to record the time spent at each step of the review process. CRITICAL Yes The system has the ability to lock and hold the review process due to the following conditions with the ability to override with appropriate security permissions: PZ.36 Unacceptable/incomplete submissions; CRITICAL Yes PZ.37 Agreement to Encroach on the City Right of Way; CRITICAL Yes PZ.38 Unpaid fees; and CRITICAL Yes PZ.39 Other user-defined conditions. CRITICAL Yes Planning – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PZ.40 The system has the ability to allow user-defined processes or workflow for each application type. User should be allowed to establish the steps or processed each application type and sub-type should follow from application submittal through approval and filing, if necessary. CRITICAL Yes PZ.41 The system has the ability to allow workflow processes to be modified (with appropriate security permissions). CRITICAL Yes PZ.42 The system has the ability to allow user-defined plan review routing based on type of work performed. CRITICAL Yes PZ.43 The system has the ability to provide automatic standard routing based on user-defined application fields. CRITICAL Yes PZ.44 The system has the ability to track and maintain external reviewer agency information/comments. CRITICAL Yes PZ.45 The system has the ability to track and maintain external reviewer contact information. CRITICAL Yes PZ.46 The system has the ability to allow external agencies access to the application through a secured portal. CRITICAL Yes PZ.47 The system has the ability to allow for the electronic collection of such items as approvers comments and conditions as plan review progresses (assuming appropriate user security). CRITICAL Yes PZ.48 The system has the ability to accommodate City-Defined review checklists for each application type. CRITICAL Yes PZ.49 The system has the ability to accommodate free form text boxes in the review checklists. CRITICAL Yes Planning – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PZ.50 The system has the ability to require that all mandated review steps are completed prior to approval of application. CRITICAL Yes PZ.51 The system has the ability to provide override capabilities with appropriate security to approve application if steps have not been completed. CRITICAL Yes PZ.52 The system has the ability to provide checklists for application review. CRITICAL Yes PZ.53 The system has the ability, through workflow, to selectively notify appropriate departments and referral agencies (City-defined), when a plan has been submitted to the City.CRITICAL Yes PZ.54 The system has the ability to provide user alerts/pop-up reminders to notify users of pending workflow and necessary actions. CRITICAL Yes PZ.55 The system has the ability to accommodate role-based approval capabilities for each review step for each department. CRITICAL Yes PZ.56 The system has the ability to record review actions made by various departments. CRITICAL Yes PZ.57 The system has the ability to allow for entry of unlimited free-form text comments associated with application review. CRITICAL Yes PZ.58 The system has the ability to accommodate user-defined tables for standard comments that can be accessed during application review. CRITICAL Yes PZ.59 The system has the ability to flag entire projects to alert specified groups of special conditions CRITICAL Yes PZ.60 The system has the ability to flag individual projects to alert the counter-personnel of special conditions. CRITICAL Yes Planning – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to record the following date fields: PZ.61 Multiple Received dates; CRITICAL Yes PZ.62 Date Application deemed complete; CRITICAL Yes PZ.63 Multiple Meeting and Hearing dates; CRITICAL Yes PZ.64 Multiple Mail dates; CRITICAL Yes PZ.65 Multiple approval dates; CRITICAL Yes PZ.66 Effective dates (date of ordinance); and CRITICAL Yes PZ.67 Other user defined. CRITICAL Yes PZ.68 The system has the ability to automatically calculate user-defined "key Dates" as part of the view process for projects. CRITICAL No Need more information PZ.69 The system has the ability to associate "key dates" with project review steps. CRITICAL No Need more informationPZ.70 The system has the ability to notify users of key deadlines approaching on a project (as defined by the City). CRITICAL Yes PZ.71 The system has the ability to automatically generate a user-defined application acceptance/decline letter by application type. CRITICAL Yes PZ.72 The system has the ability to automatically generate a user-defined application acceptance/decline email by application type. CRITICAL Yes PZ.73 The system has the ability to automatically generate letters to property owners and others regarding projects (e.g., upcoming meetings). CRITICAL Yes PZ.74 The system has the ability to generate a report of project history showing all events and meeting dates. CRITICAL Yes PZ.75 The system has the ability to track the amount of time (in calendar days) that plans were under review for each plan tracking step. CRITICAL Yes Planning – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PZ.76 The system has the ability to generate statistical reports summarizing the number of days spent in application review for each type of job by each reviewing department. CRITICAL Yes PZ.77 The system has the ability to assess application review fees. CRITICAL Yes PZ.78 The system has the ability to collect payments for application review fees. CRITICAL Yes PZ.79 The system has the ability to accumulate application review and permit charges automatically. CRITICAL Yes PZ.80 The system has the ability to produce cash receipts to validate payments and update projects. CRITICAL Yes Planning Reporting PZ.81 The system has the ability to track and report on time frames associated with each application review step. CRITICAL Yes The system has the ability to provide application review completeness reports from: PZ.82 Planning Division; CRITICAL Yes PZ.83 Other departments; and CRITICAL Yes PZ.84 Other agencies. CRITICAL Yes PZ.85 The system has the ability to generate status reports of items within the review process. CRITICAL Yes PZ.86 The system has the ability to generate notification letters to applicant. CRITICAL Yes PZ.87 The system has the ability to generate relevant meeting documents for any application that results in a meeting being held. CRITICAL Yes The system has the ability to generate reports on the following: PZ.88 Application review processing – number of applications processed. CRITICAL Yes Planning – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PZ.89 Application review proceeding – average days to process; CRITICAL Yes PZ.90 Number of applications by type; CRITICAL Yes PZ.91 Number of application submission by type; CRITICAL Yes PZ.92 Time between submission (number of days); CRITICAL Yes PZ.93 Applications by status; and CRITICAL Yes PZ.94 Applications by assigned staff; CRITICAL Yes PZ.95 The system has the ability to provide drill down capability to see attachments to records based on security permissions. CRITICAL Yes ^ĞĐƚŝŽŶϯ͘ϬͲ&ƵŶĐƚŝŽŶĂůZĞƋƵŝƌĞŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϲϴ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϲϵ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ 7KLVVHFWLRQVKRXOGGHVFULEHWKHSURSRVHGLPSOHPHQWDWLRQSODQ3URSRVHUVVKRXOG UHIHUHQFH6HFWLRQ&IRU OLVWLQJRIOLNHO\*RYHUQPHQWUHVRXUFHVWKDWZLOOFRQWULEXWHWRWKLVSURMHFW 3URYLGHDGHWDLOHGSODQIRULPSOHPHQWLQJWKHSURSRVHGV\VWHP7KLVLQIRUPDWLRQPXVWLQFOXGH x3URSRVHGSKDVLQJIRUUROORXWRISURSRVHGV\VWHP x6FKHGXOHRINH\GDWHV dLJůĞƌ͛ƐŝŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽĐĞƐƐĚĞŵŽŶƐƚƌĂƚĞƐŽƵƌůŽŶŐͲƚĞƌŵĐŽŵŵŝƚŵĞŶƚƚŽŽƵƌĐůŝĞŶƚƐ͕ǁŝƚŚĂŵĞƚŚŽĚŽůŽŐLJ ƚĂŝůŽƌĞĚƐƉĞĐŝĨŝĐĂůůLJƚŽƚŚĞƉƵďůŝĐƐĞĐƚŽƌ͘zŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶďĞŶĞĨŝƚƐĨƌŽŵƚŚĞĨĂĐƚƚŚĂƚǁĞƉĞƌĨŽƌŵŽƵƌŽǁŶ ŝŵƉůĞŵĞŶƚĂƚŝŽŶƐĂŶĚŬŶŽǁŽƵƌƐŽĨƚǁĂƌĞďĞƚƚĞƌƚŚĂŶĂŶLJŽŶĞ͘ƐĂdLJůĞƌĐůŝĞŶƚ͕LJŽƵƌĞĐĞŝǀĞŐƵŝĚĂŶĐĞ ƚŚƌŽƵŐŚŽƵƚŝŵƉůĞŵĞŶƚĂƚŝŽŶĨƌŽŵĞdžƉĞƌŝĞŶĐĞĚdLJůĞƌƉƌŽĨĞƐƐŝŽŶĂůƐǁŚŽŚĂǀĞŝŵƉůĞŵĞŶƚĞĚdLJůĞƌƉƌŽĚƵĐƚƐŝŶ ŵŽƌĞƚŚĂŶϭϬ͕ϬϬϬƉƵďůŝĐƐĞĐƚŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽũĞĐƚƐ͘dLJůĞƌ͛ƐŵĞƚŚŽĚŽůŽŐLJŝƐďĂƐĞĚŽŶƚŚƌĞĞǀŝƚĂů ĨŽƵŶĚĂƚŝŽŶƐ͗ x/ŶĚƵƐƚƌLJĞdžƉĞƌŝĞŶĐĞ xŐůŽďĂůůLJƌĞĐŽŐŶŝnjĞĚƉƌŽũĞĐƚŵĂŶĂŐĞŵĞŶƚĂƉƉƌŽĂĐŚ x/ŶͲŚŽƵƐĞĞdžƉĞƌƚŝƐĞ dLJůĞƌƵƚŝůŝnjĞƐŝƚƐĚĞƉƚŚŽĨŝŵƉůĞŵĞŶƚĂƚŝŽŶĞdžƉĞƌŝĞŶĐĞ͕ǁŽƌŬŝŶŐŝŶƚĂŶĚĞŵǁŝƚŚŽƵƌĐůŝĞŶƚƐƚŽƉƵƚŽƵƌ ŵĞƚŚŽĚŽůŽŐLJŝŶƚŽƉƌĂĐƚŝĐĞ͘tŚŝůĞĞĂĐŚWƌŽũĞĐƚŝƐƵŶŝƋƵĞ͕ĂůůǁŝůůĨŽůůŽǁdLJůĞƌ͛ƐƐŝdžͲƐƚĂŐĞŵĞƚŚŽĚŽůŽŐLJ͘ĂĐŚŽĨ ƚŚĞƐŝdžƐƚĂŐĞƐŝƐĐŽŵƉƌŝƐĞĚŽĨŵƵůƚŝƉůĞǁŽƌŬƉĂĐŬĂŐĞƐ͕ĂŶĚĞĂĐŚǁŽƌŬƉĂĐŬĂŐĞŝŶĐůƵĚĞƐĂŶĂƌƌĂƚŝǀĞ ĚĞƐĐƌŝƉƚŝŽŶ͕ŽďũĞĐƚŝǀĞƐ͕ƚĂƐŬƐ͕ŝŶƉƵƚƐ͕ŽƵƚƉƵƚƐͬĚĞůŝǀĞƌĂďůĞƐ͕ĂƐƐƵŵƉƚŝŽŶƐ͕ĂŶĚĂƌĞƐƉŽŶƐŝďŝůŝƚLJŵĂƚƌŝdž͘ dĂŝůŽƌĞĚƐƉĞĐŝĨŝĐĂůůLJĨŽƌdLJůĞƌ͛ƐƉƵďůŝĐƐĞĐƚŽƌĐůŝĞŶƚƐ͕ƚŚĞƉƌŽũĞĐƚŵĞƚŚŽĚŽůŽŐLJĐŽŶƚĂŝŶƐ^ƚĂŐĞĐĐĞƉƚĂŶĐĞ ŽŶƚƌŽůWŽŝŶƚƐƚŚƌŽƵŐŚŽƵƚĞĂĐŚWŚĂƐĞƚŽĞŶƐƵƌĞĂĚŚĞƌĞŶĐĞƚŽƐĐŽƉĞ͕ďƵĚŐĞƚ͕ƚŝŵĞůŝŶĞĐŽŶƚƌŽůƐ͕ĞĨĨĞĐƚŝǀĞ ĐŽŵŵƵŶŝĐĂƚŝŽŶƐ͕ĂŶĚƋƵĂůŝƚLJƐƚĂŶĚĂƌĚƐ͘ůĞĂƌůLJĚĞĨŝŶĞĚ͕ƚŚĞƉƌŽũĞĐƚŵĞƚŚŽĚŽůŽŐLJƌĞƉĞĂƚƐĐŽŶƐŝƐƚĞŶƚůLJĂĐƌŽƐƐ WŚĂƐĞƐ͕ĂŶĚŝƐƐĐĂůĞĚƚŽŵĞĞƚƚŚĞůŝĞŶƚ͛ƐĐŽŵƉůĞdžŝƚLJĂŶĚŽƌŐĂŶŝnjĂƚŝŽŶĂůŶĞĞĚƐ͘ dŚĞŵĞƚŚŽĚŽůŽŐLJĂĚĂƉƚƐƚŽďŽƚŚƐŝŶŐůĞͲƉŚĂƐĞĂŶĚŵƵůƚŝƉůĞͲƉŚĂƐĞƉƌŽũĞĐƚƐ͘dŽĂĐŚŝĞǀĞWƌŽũĞĐƚƐƵĐĐĞƐƐ͕ŝƚŝƐ ŝŵƉĞƌĂƚŝǀĞƚŚĂƚďŽƚŚůŝĞŶƚĂŶĚdLJůĞƌĐŽŵŵŝƚƚŽŝŶĐůƵĚŝŶŐƚŚĞŶĞĐĞƐƐĂƌLJůĞĂĚĞƌƐŚŝƉĂŶĚŐŽǀĞƌŶĂŶĐĞ͘ƵƌŝŶŐ ĞĂĐŚƐƚĂŐĞŽĨƚŚĞWƌŽũĞĐƚ͕ŝƚŝƐĞdžƉĞĐƚĞĚƚŚĂƚůŝĞŶƚĂŶĚdLJůĞƌWƌŽũĞĐƚƚĞĂŵƐǁŽƌŬĐŽůůĂďŽƌĂƚŝǀĞůLJƚŽĐŽŵƉůĞƚĞ ƚĂƐŬƐ͘ŶƵŶĚĞƌůLJŝŶŐƉƌŝŶĐŝƉůĞŽĨdLJůĞƌ͛Ɛ/ŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽĐĞƐƐŝƐƚŽĞŵƉůŽLJĂŶŝƚĞƌĂƚŝǀĞŵŽĚĞůǁŚĞƌĞ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϬ ůŝĞŶƚ͛ƐďƵƐŝŶĞƐƐƉƌŽĐĞƐƐĞƐĂƌĞĂƐƐĞƐƐĞĚ͕ĐŽŶĨŝŐƵƌĞĚ͕ǀĂůŝĚĂƚĞĚ͕ĂŶĚƌĞĨŝŶĞĚĐLJĐůŝĐĂůůLJŝŶůŝŶĞǁŝƚŚƚŚĞƉƌŽũĞĐƚ ďƵĚŐĞƚ͘dŚŝƐĂƉƉƌŽĂĐŚŝƐƵƐĞĚŝŶŵƵůƚŝƉůĞƐƚĂŐĞƐĂŶĚǁŽƌŬƉĂĐŬĂŐĞƐĂƐŝůůƵƐƚƌĂƚĞĚŝŶƚŚĞŐƌĂƉŚŝĐďĞůŽǁ͘ dŚĞĚĞůŝǀĞƌLJĂƉƉƌŽĂĐŚŝƐƐLJƐƚĞŵĂƚŝĐ͕ǁŚŝĐŚƌĞĚƵĐĞƐǀĂƌŝĂďŝůŝƚLJĂŶĚŵŝƚŝŐĂƚĞƐƌŝƐŬƐƚŽĞŶƐƵƌĞWƌŽũĞĐƚƐƵĐĐĞƐƐ͘Ɛ ŝůůƵƐƚƌĂƚĞĚ͕ƐŽŵĞƐƚĂŐĞƐ͕ĂůŽŶŐǁŝƚŚǁŽƌŬƉĂĐŬĂŐĞƐĂŶĚƚĂƐŬƐ͕ĂƌĞŝŶƚĞŶĚĞĚƚŽďĞŽǀĞƌůĂƉƉŝŶŐďLJŶĂƚƵƌĞƚŽ͕ ĞĨĨŝĐŝĞŶƚůLJĂŶĚĞĨĨĞĐƚŝǀĞůLJĐŽŵƉůĞƚĞƚŚĞWƌŽũĞĐƚ͘ tŽƌŬƌĞĂŬĚŽǁŶ^ƚƌƵĐƚƵƌĞ dŚĞtŽƌŬƌĞĂŬĚŽǁŶ^ƚƌƵĐƚƵƌĞ;t^ͿŝƐĂŚŝĞƌĂƌĐŚŝĐĂůƌĞƉƌĞƐĞŶƚĂƚŝŽŶŽĨĂWƌŽũĞĐƚŽƌWŚĂƐĞďƌŽŬĞŶĚŽǁŶŝŶƚŽ ƐŵĂůůĞƌ͕ŵŽƌĞŵĂŶĂŐĞĂďůĞĐŽŵƉŽŶĞŶƚƐ͘dŚĞƚŽƉͲůĞǀĞůĐŽŵƉŽŶĞŶƚƐĂƌĞĐĂůůĞĚ͞^ƚĂŐĞƐ͟ĂŶĚƚŚĞƐĞĐŽŶĚůĞǀĞů ĐŽŵƉŽŶĞŶƚƐĂƌĞĐĂůůĞĚ͞tŽƌŬWĂĐŬĂŐĞƐ͘͟dŚĞǁŽƌŬƉĂĐŬĂŐĞƐ͕ƐŚŽǁŶďĞůŽǁĞĂĐŚƐƚĂŐĞ͕ĐŽŶƚĂŝŶƚŚĞŚŝŐŚͲůĞǀĞů ǁŽƌŬƚŽďĞĚŽŶĞ͘dŚĞĚĞƚĂŝůĞĚWƌŽũĞĐƚ^ĐŚĞĚƵůĞ͕ĚĞǀĞůŽƉĞĚĚƵƌŝŶŐWƌŽũĞĐƚͬWŚĂƐĞWůĂŶŶŝŶŐĂŶĚĨŝŶĂůŝnjĞĚĚƵƌŝŶŐ ƐƵďƐĞƋƵĞŶƚƐƚĂŐĞƐ͕ůŝƐƚƐƚŚĞƚĂƐŬƐƚŽďĞĐŽŵƉůĞƚĞĚǁŝƚŚŝŶĞĂĐŚǁŽƌŬƉĂĐŬĂŐĞ͘ĂĐŚƐƚĂŐĞĞŶĚƐǁŝƚŚĂ͞ŽŶƚƌŽů WŽŝŶƚ͕͟ĐŽŶĨŝƌŵŝŶŐƚŚĞǁŽƌŬƉĞƌĨŽƌŵĞĚĚƵƌŝŶŐƚŚĂƚƐƚĂŐĞŽĨƚŚĞWƌŽũĞĐƚŚĂƐďĞĞŶĂĐĐĞƉƚĞĚďLJůŝĞŶƚ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϭ /ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ^ƚĂŐĞƐ ^ƚĂŐĞϭ͗/ŶŝƚŝĂƚĞΘWůĂŶ dŚĞ/ŶŝƚŝĂƚĞĂŶĚWůĂŶƐƚĂŐĞŝŶǀŽůǀĞƐWƌŽũĞĐƚŝŶŝƚŝĂƚŝŽŶ͕ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ͕ĂŶĚƉůĂŶŶŝŶŐ͘dŚŝƐƐƚĂŐĞĐƌĞĂƚĞƐĂ ĨŽƵŶĚĂƚŝŽŶĨŽƌƚŚĞWƌŽũĞĐƚďLJŝĚĞŶƚŝĨLJŝŶŐĂŶĚĞƐƚĂďůŝƐŚŝŶŐƐĞƋƵĞŶĐĞĂŶĚƚŝŵŝŶŐĨŽƌĞĂĐŚWŚĂƐĞĂƐǁĞůůĂƐ ǀĞƌŝĨLJŝŶŐƐĐŽƉĞĨŽƌƚŚĞWƌŽũĞĐƚ͘dŚŝƐƐƚĂŐĞǁŝůůďĞĐŽŶĚƵĐƚĞĚĂƚƚŚĞŽŶƐĞƚŽĨƚŚĞWƌŽũĞĐƚ͕ǁŝƚŚĂĨĞǁƵŶŝƋƵĞ ŝƚĞŵƐďĞŝŶŐƌĞƉĞĂƚĞĚĨŽƌƚŚĞĂĚĚŝƚŝŽŶĂůWŚĂƐĞƐĂƐŶĞĞĚĞĚ͘ KďũĞĐƚŝǀĞƐ͗ x&ŽƌŵĂůůLJůĂƵŶĐŚƚŚĞƉƌŽũĞĐƚ͘ xƐƚĂďůŝƐŚƉƌŽũĞĐƚŐŽǀĞƌŶĂŶĐĞ͘ xĞĨŝŶĞĂŶĚĐŽŵŵƵŶŝĐĂƚĞŐŽǀĞƌŶĂŶĐĞĨŽƌdLJůĞƌ͘ x/ĚĞŶƚŝĨLJĐůŝĞŶƚƉƌŽũĞĐƚƚĞĂŵ͘ ^ƚĂŐĞϮ͗ƐƐĞƐƐΘĞĨŝŶĞ dŚĞƐƐĞƐƐΘĞĨŝŶĞƐƚĂŐĞǁŝůůƉƌŽǀŝĚĞĂŶŽƉƉŽƌƚƵŶŝƚLJƚŽŐĂƚŚĞƌŝŶĨŽƌŵĂƚŝŽŶƌĞůĂƚĞĚƚŽĐƵƌƌĞŶƚŝƚLJďƵƐŝŶĞƐƐ ƉƌŽĐĞƐƐĞƐ͘dŚŝƐŝŶĨŽƌŵĂƚŝŽŶǁŝůůďĞƵƐĞĚƚŽŝĚĞŶƚŝĨLJĂŶĚĚĞĨŝŶĞďƵƐŝŶĞƐƐƉƌŽĐĞƐƐĞƐƵƚŝůŝnjĞĚǁŝƚŚdLJůĞƌƐŽĨƚǁĂƌĞ͘ ŝƚLJĐŽůůĂďŽƌĂƚĞƐǁŝƚŚdLJůĞƌƉƌŽǀŝĚŝŶŐĐŽŵƉůĞƚĞĂŶĚĂĐĐƵƌĂƚĞŝŶĨŽƌŵĂƚŝŽŶƚŽdLJůĞƌƐƚĂĨĨĂŶĚĂƐƐŝƐƚŝŶŐŝŶ ĂŶĂůLJƐŝƐ͕ƵŶĚĞƌƐƚĂŶĚŝŶŐĐƵƌƌĞŶƚǁŽƌŬĨůŽǁƐĂŶĚďƵƐŝŶĞƐƐƉƌŽĐĞƐƐĞƐ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϮ KďũĞĐƚŝǀĞƐ͗ xWƌŽǀŝĚĞĂďĂƐŝĐƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨƐLJƐƚĞŵĨƵŶĐƚŝŽŶĂůŝƚLJ͘ xWƌĞƉĂƌĞŝƚLJĨŽƌĐƵƌƌĞŶƚĂŶĚĨƵƚƵƌĞƐƚĂƚĞĂŶĂůLJƐŝƐ͘ ^ƚĂŐĞϯ͗WƌĞƉĂƌĞ^ŽůƵƚŝŽŶ ƵƌŝŶŐƚŚĞWƌĞƉĂƌĞ^ŽůƵƚŝŽŶƐƚĂŐĞ͕ŝŶĨŽƌŵĂƚŝŽŶŐĂƚŚĞƌĞĚĚƵƌŝŶŐƚŚĞ/ŶŝƚŝĂƚĞΘWůĂŶĂŶĚƐƐĞƐƐΘĞĨŝŶĞƐƚĂŐĞƐ ǁŝůůďĞƵƐĞĚƚŽŝŶƐƚĂůůĂŶĚĐŽŶĨŝŐƵƌĞƚŚĞdLJůĞƌƐŽĨƚǁĂƌĞƐŽůƵƚŝŽŶ͘^ŽĨƚǁĂƌĞĐŽŶĨŝŐƵƌĂƚŝŽŶǁŝůůďĞǀĂůŝĚĂƚĞĚďLJ ƚŚĞŝƚLJĂŐĂŝŶƐƚĨƵƚƵƌĞƐƚĂƚĞĚĞĐŝƐŝŽŶƐĚĞĨŝŶĞĚŝŶƉƌĞǀŝŽƵƐƐƚĂŐĞƐĂŶĚƉƌŽĐĞƐƐĞƐƌĞĨŝŶĞĚĂƐŶĞĞĚĞĚƚŽĞŶƐƵƌĞ ďƵƐŝŶĞƐƐƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞŵĞƚ͘ KďũĞĐƚŝǀĞƐ͗ xůůůŝĐĞŶƐĞĚƐŽĨƚǁĂƌĞŝƐŝŶƐƚĂůůĞĚĂŶĚŽƉĞƌĂƚŝŽŶĂů͘ xŝƚLJŝƐĂďůĞƚŽĂĐĐĞƐƐƚŚĞƐŽĨƚǁĂƌĞ͘ ^ƚĂŐĞϰ͗WƌŽĚƵĐƚŝŽŶZĞĂĚŝŶĞƐƐ ĐƚŝǀŝƚŝĞƐŝŶƚŚĞWƌŽĚƵĐƚŝŽŶZĞĂĚŝŶĞƐƐƐƚĂŐĞǁŝůůƉƌĞƉĂƌĞƚŚĞĐůŝĞŶƚƚĞĂŵĨŽƌŐŽͲůŝǀĞƚŚƌŽƵŐŚƐŽůƵƚŝŽŶ ǀĂůŝĚĂƚŝŽŶ͕ƚŚĞĚĞǀĞůŽƉŵĞŶƚŽĨĂĚĞƚĂŝůĞĚŐŽͲůŝǀĞƉůĂŶĂŶĚĞŶĚƵƐĞƌƚƌĂŝŶŝŶŐ͘ƌĞĂĚŝŶĞƐƐĂƐƐĞƐƐŵĞŶƚǁŝůůďĞ ĐŽŶĚƵĐƚĞĚǁŝƚŚƚŚĞŝƚLJƚŽƌĞǀŝĞǁƚŚĞƐƚĂƚƵƐŽĨƚŚĞƉƌŽũĞĐƚĂŶĚƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶƐƌĞĂĚŝŶĞƐƐĨŽƌŐŽͲůŝǀĞ͘ KďũĞĐƚŝǀĞƐ͗ xsĂůŝĚĂƚĞƚŚĂƚƚŚĞƐŽůƵƚŝŽŶƉĞƌĨŽƌŵƐĂƐŝŶĚŝĐĂƚĞĚŝŶƚŚĞƐŽůƵƚŝŽŶǀĂůŝĚĂƚŝŽŶƉůĂŶ͘ xŶƐƵƌĞŝƚLJŽƌŐĂŶŝnjĂƚŝŽŶŝƐƌĞĂĚLJƚŽŵŽǀĞĨŽƌǁĂƌĚǁŝƚŚŐŽͲůŝǀĞĂŶĚƚƌĂŝŶŝŶŐ;ŝĨĂƉƉůŝĐĂďůĞͿ͘ ^ƚĂŐĞϱ͗WƌŽĚƵĐƚŝŽŶ &ŽůůŽǁŝŶŐĞŶĚƵƐĞƌƚƌĂŝŶŝŶŐƚŚĞƉƌŽĚƵĐƚŝŽŶƐLJƐƚĞŵǁŝůůďĞĨƵůůLJĞŶĂďůĞĚĂŶĚŵĂĚĞƌĞĂĚLJĨŽƌĚĂŝůLJŽƉĞƌĂƚŝŽŶĂů ƵƐĞĂƐŽĨƚŚĞƐĐŚĞĚƵůĞĚĚĂƚĞ͘dLJůĞƌĂŶĚŝƚLJǁŝůůĨŽůůŽǁƚŚĞĐŽŵƉƌĞŚĞŶƐŝǀĞĂĐƚŝŽŶƉůĂŶůĂŝĚŽƵƚĚƵƌŝŶŐ'ŽͲ>ŝǀĞ ZĞĂĚŝŶĞƐƐƚŽƐƵƉƉŽƌƚŐŽͲůŝǀĞĂĐƚŝǀŝƚŝĞƐĂŶĚŵŝŶŝŵŝnjĞƌŝƐŬƚŽƚŚĞWƌŽũĞĐƚĚƵƌŝŶŐŐŽͲůŝǀĞ͘&ŽůůŽǁŝŶŐŐŽͲůŝǀĞ͕dLJůĞƌ ǁŝůůǁŽƌŬǁŝƚŚŝƚLJƚŽǀĞƌŝĨLJƚŚĂƚŝŵƉůĞŵĞŶƚĂƚŝŽŶǁŽƌŬŝƐĐŽŶĐůƵĚĞĚ͕ƉŽƐƚŐŽͲůŝǀĞĂĐƚŝǀŝƚŝĞƐĂƌĞƐĐŚĞĚƵůĞĚ͕ĂŶĚ ƚŚĞƚƌĂŶƐŝƚŝŽŶƚŽůŝĞŶƚ^ĞƌǀŝĐĞƐŝƐĐŽŵƉůĞƚĞĨŽƌůŽŶŐͲƚĞƌŵŽƉĞƌĂƚŝŽŶƐĂŶĚŵĂŝŶƚĞŶĂŶĐĞŽĨƚŚĞdLJůĞƌƐŽĨƚǁĂƌĞ͘ KďũĞĐƚŝǀĞƐ͗ xdžĞĐƵƚĞĚĂLJƚŽĚĂLJƉƌŽĐĞƐƐŝŶŐŝŶdLJůĞƌƐŽĨƚǁĂƌĞ͘ xůŝĞŶƚĚĂƚĂĂǀĂŝůĂďůĞŝŶWƌŽĚƵĐƚŝŽŶĞŶǀŝƌŽŶŵĞŶƚ͘ ^ƚĂŐĞϲ͗ůŽƐĞ dŚĞůŽƐĞƐƚĂŐĞƐŝŐŶŝĨŝĞƐĨƵůůŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨĂůůƉƌŽĚƵĐƚƐƉƵƌĐŚĂƐĞĚĂŶĚĞŶĐŽŵƉĂƐƐĞĚŝŶƚŚĞWŚĂƐĞŽƌ WƌŽũĞĐƚ͘ŝƚLJƚƌĂŶƐŝƚŝŽŶƐƚŽƚŚĞŶĞdžƚĐLJĐůĞŽĨƚŚĞŝƌƌĞůĂƚŝŽŶƐŚŝƉǁŝƚŚdLJůĞƌ;ŶĞdžƚWŚĂƐĞŽĨŝŵƉůĞŵĞŶƚĂƚŝŽŶŽƌ ůŽŶŐͲƚĞƌŵƌĞůĂƚŝŽŶƐŚŝƉǁŝƚŚdLJůĞƌůŝĞŶƚ^ĞƌǀŝĐĞƐͿ͘ KďũĞĐƚŝǀĞƐ͗ xŐƌĞĞŵĞŶƚĨƌŽŵdLJůĞƌĂŶĚŝƚLJƚĞĂŵƐƚŚĂƚĂĐƚŝǀŝƚŝĞƐǁŝƚŚŝŶƚŚŝƐƉŚĂƐĞĂƌĞĐŽŵƉůĞƚĞ͘ WƌŽũĞĐƚWůĂŶŶŝŶŐ WƌŽũĞĐƚWůĂŶŶŝŶŐŝƐĂŶŝŵƉŽƌƚĂŶƚƉŝĞĐĞŽĨĂŶLJŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dLJůĞƌƚĂŬĞƐĂĐƵƐƚŽŵĂƉƉƌŽĂĐŚƚŽĞǀĞƌLJƉƌŽũĞĐƚ ǁĞůĞĂĚ͘dŚĞƉƌŽũĞĐƚƐĐŚĞĚƵůĞŝƐĚĞǀĞůŽƉĞĚĐŽůůĂďŽƌĂƚŝǀĞůLJǁŝƚŚďŽƚŚƉƌŽũĞĐƚƚĞĂŵƐŝŶŽƌĚĞƌƚŽŵĞĞƚLJŽƵƌ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϯ ŶĞĞĚƐ͕ǁŚŝůĞŬĞĞƉŝŶŐŝŶŵŝŶĚdLJůĞƌ͛ƐŐƵŝĚĞůŝŶĞƐĨŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘WĞƌŝŽĚŝĐƉƌŽũĞĐƚŵĞĞƚŝŶŐƐǁŝůůďĞ ƐĐŚĞĚƵůĞĚǁŚĞƌĞĐŚĂŶŐĞƐŝŶƐĐŽƉĞ͕ƉƌŽũĞĐƚůĞŶŐƚŚ͕ŽƌĐŽƐƚǁŝůůďĞƌĞǀŝĞǁĞĚ͘ dLJůĞƌŝƐŽƉĞŶƚŽĚŝƐĐƵƐƐŝŶŐƚŚĞƉƌŽũĞĐƚƐĐŚĞĚƵůĞŝŶŵŽƌĞĚĞƚĂŝůĂŶĚǁŽƌŬŝŶŐŽƵƚĂŵƵƚƵĂůůLJĂŐƌĞĞĚƵƉŽŶƉůĂŶ ƚŚĂƚĐŽŶƐŝĚĞƌƐĂůůƉƌŽũĞĐƚƌŝƐŬƐ͕ƌĞƋƵĞƐƚƐĂŶĚƌĞƐŽƵƌĐĞĐŽŶƐƚƌĂŝŶƚƐ͘ dLJůĞƌƌĞĐŽŵŵĞŶĚƐĂƉŚĂƐĞĚŝŵƉůĞŵĞŶƚĂƚŝŽŶĂƉƉƌŽĂĐŚ͕ƐƚĂŐŐĞƌŝŶŐƐƚĂƌƚĂŶĚůŝǀĞĚĂƚĞƐĨŽƌĞĂĐŚƉŚĂƐĞŽĨƚŚĞ ƉƌŽũĞĐƚ͘>ŝǀĞĚĂƚĞƐǁŝůůďĞƚĂƌŐĞƚƐďƵƚƐŚŽƵůĚŶŽƚƉůĂĐĞƵŶŶĞĐĞƐƐĂƌLJĐŽŶƐƚƌĂŝŶƚƐŽŶƚŚĞƉƌŽũĞĐƚ͘dŚĞĨŽůůŽǁŝŶŐ ƐĐŚĞĚƵůĞƚĂŬĞƐŝŶƚŽĐŽŶƐŝĚĞƌĂƚŝŽŶƚŚĞŝƚLJ͛ƐŐŽĂůƐĂŶĚdLJůĞƌ͛ƐƌĞĐŽŵŵĞŶĚĞĚĂƉƉƌŽĂĐŚ͕ĂŶĚĂƐƐƵŵĞƐƚŚĞ ƉƌŽĚƵĐƚǁŝůůďĞƵƐĞĚĂƐŝƐ͕ǁŝƚŚŽƵƚĂĚĚŝƚŝŽŶĂůŐŽͲůŝǀĞĐƵƐƚŽŵŝnjĂƚŝŽŶƐ͘ WƌŽƉŽƐĞĚWƌŽũĞĐƚWŚĂƐĞƐ WƌŽƉƌŝĞƚĂƌLJĂŶĚŽŶĨŝĚĞŶƚŝĂůʹ^ƵďũĞĐƚƚŽZĞƐƚƌŝĐƚŝŽŶƐŽŶŝƐĐůŽƐƵƌĞ /ŶĐŽĚĞ&ŝŶĂŶĐŝĂůDĂŶĂŐĞŵĞŶƚdŝŵĞůŝŶĞ ([SODLQWKHSURSRVHGSODQIRULPSOHPHQWDWLRQ 7KLVLQIRUPDWLRQPXVWLQFOXGH x'HVFULSWLRQRILPSOHPHQWDWLRQWDVNVDQGDFWLYLWLHV x'HVFULSWLRQRINH\GHOLYHUDEOHVDQGKRZWKH\UHODWHWRWKHLPSOHPHQWDWLRQDSSURDFKDQG DFWLYLWLHVPlease note the required deliverables listed in Section C. WůĞĂƐĞƐĞĞdLJůĞƌ͛ƐƌĞƐƉŽŶƐĞƚŽƚŚĞƋƵĞƐƚŝŽŶĂďŽǀĞŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚĞZ&WZĞƐƉŽŶƐĞ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϰ ([SODLQWKHSURSRVHGYHQGRUVWDIILQJIRUWKHSURMHFWLQFOXGLQJ x$SSUR[LPDWHGHGLFDWLRQWRWKHSURMHFWRIHDFKUHVRXUFHDQGDSSUR[LPDWHWLPHZRUNZLOOEH FRPSOHWHGRQVLWHYVRIIVLWH The implementation will be conducted remotely. x,GHQWLI\KRZWKHYHQGRUSODQVWRFRQWUROFRVWVE\XWLOL]LQJUHPRWHPHHWLQJV The entire implementation process will be conducted remotely which can save a significant amount of money for the City. x0DMRUUROHVDQGUHVSRQVLELOLWLHVIRUHDFKUHVRXUFH WƌŽũĞĐƚZĞƐŽƵƌĐĞƐ dLJůĞƌŐƌŽƵƉƐLJŽƵƌƚĞĂŵĂŶĚdLJůĞƌƌĞƐŽƵƌĐĞƐďĂƐĞĚŽŶƚŚĞŝƌĨƵŶĐƚŝŽŶĂůƌŽůĞǁŝƚŚŝŶƚŚĞƉƌŽũĞĐƚ͘dŚŝƐĂůůŽǁƐĨŽƌ ĞĂƐŝĞƌƐƚĂĨĨŝŶŐĂŶĚĐŽŵŵƵŶŝĐĂƚŝŽŶǁŝƚŚŝŶĂŶĚďĞƚǁĞĞŶƉƌŽũĞĐƚƚĞĂŵƐ͘WůĞĂƐĞƌĞĨĞƌĞŶĐĞƚŚĞƉƌŽũĞĐƚƌĞƐŽƵƌĐĞ ƌŽůĞƐŐƌĂƉŚŝĐďĞůŽǁĨŽƌĂƐƵŵŵĂƌLJŽĨƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐĨŽƌĞĂĐŚƌŽůĞ͘KƵƌƉƌŽũĞĐƚĂƉƉƌŽĂĐŚŝƐďĂƐĞĚŽŶŽƵƌ ĞdžƉĞƌŝĞŶĐĞĂŶĚŬŶŽǁůĞĚŐĞĨƌŽŵǁŽƌŬŝŶŐĞdžĐůƵƐŝǀĞůLJǁŝƚŚƉƵďůŝĐƐĞĐƚŽƌĐůŝĞŶƚƐ͘ dLJůĞƌŚĂƐŝŶĐůƵĚĞĚĂƐĂŵƉůĞƚŝŵĞůŝŶĞĂďŽǀĞŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚĞƉƌŽũĞĐƚĚƵƌĂƚŝŽŶ͘tĞŚĂǀĞĂůƐŽŝŶĐůƵĚĞĚ ŝŶĨŽƌŵĂƚŝŽŶŽŶdLJůĞƌ͛ƐƌŽůĞĂŶĚƚŚĞŝƚLJ͛ƐƌŽůĞŝŶĞĂĐŚŽĨƚŚĞƐĞƉŚĂƐĞƐůŝƐƚĞĚŝŶƚŚŝƐ^ĞĐƚŝŽŶŽĨƚŚĞZ&W ZĞƐƉŽŶƐĞ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϱ dLJůĞƌŚĂƐŝŶĐůƵĚĞĚĂƐĂŵƉůĞƚŝŵĞůŝŶĞĂďŽǀĞŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚĞƉƌŽũĞĐƚĚƵƌĂƚŝŽŶ͘tĞŚĂǀĞĂůƐŽŝŶĐůƵĚĞĚ ŝŶĨŽƌŵĂƚŝŽŶŽŶdLJůĞƌ͛ƐƌŽůĞĂŶĚƚŚĞŝƚLJ͛ƐƌŽůĞŝŶĞĂĐŚŽĨƚŚĞƐĞƉŚĂƐĞƐůŝƐƚĞĚŝŶƚŚŝƐ^ĞĐƚŝŽŶŽĨƚŚĞZ&W ZĞƐƉŽŶƐĞ͘ dLJůĞƌŚĂƐĂůŽŶŐƐƚĂŶĚŝŶŐƚƌĂĐŬƌĞĐŽƌĚĚĞůŝǀĞƌŝŶŐǀŝƌƚƵĂůŝŵƉůĞŵĞŶƚĂƚŝŽŶƐĞƌǀŝĐĞƐ͘tŝƚŚŽƵƌƐƚƌŽŶŐǀŝƌƚƵĂů ĐĂƉĂďŝůŝƚŝĞƐ͕dLJůĞƌŚĂƐĂĚũƵƐƚĞĚƚŽƚŚĞĐƵƌƌĞŶƚŽǀŝĚͲϭϵĐůŝŵĂƚĞ͘dLJůĞƌƉůĂŶƐƚŽĐŽŶƚŝŶƵĞƚŽĚĞůŝǀĞƌĂůůƚƌĂŝŶŝŶŐ ǀŝƌƚƵĂůůLJ͕ŝŶĐůƵĚŝŶŐŐŽůŝǀĞƐ͕ƵŶƚŝůŚĞĂůƚŚĂŶĚƚƌĂǀĞůĐŽŶĚŝƚŝŽŶƐƐƚĂďŝůŝnjĞ͘ ƚƚŚŝƐƚŝŵĞůŽĐĂů͕ƐƚĂƚĞ͕ĂŶĚĨĞĚĞƌĂůŐŽǀĞƌŶŵĞŶƚƐǁŝƚŚŝŶƚŚĞh^ĂƌĞůŝŵŝƚŝŶŐƚƌĂǀĞůǁŝƚŚŝŶŽƵƌďŽƌĚĞƌƐĂŶĚ ĂďƌŽĂĚ͘tŚĞŶƚŚĞůŽĐĂůĂŶĚƐƚĂƚĞŐŽǀĞƌŶŵĞŶƚƐƐƚĂƌƚůŝĨƚŝŶŐƌĞƐƚƌŝĐƚŝŽŶƐ͕ǁĞǁŝůůĞǀĂůƵĂƚĞĞĂĐŚƉƌŽũĞĐƚĂŶĚ ĚĞƚĞƌŵŝŶĞǁŚŝĐŚ͕ŝĨĂŶLJ͕ƐĞƐƐŝŽŶƐĐĂŶŶŽƚďĞĚĞůŝǀĞƌĞĚĞĨĨĞĐƚŝǀĞůLJĂŶĚĞĨĨŝĐŝĞŶƚůLJƚŚƌŽƵŐŚǀŝƌƚƵĂůĐŽŶƐƵůƚĂƚŝŽŶ͕ ĂŶĚŽŶůLJƚŚŽƐĞƐĞƐƐŝŽŶƐǁŝůůďĞĐŽŶƐŝĚĞƌĞĚĨŽƌƚƌĂǀĞů͘dLJůĞƌ͛ƐƐƚĂŶĚĂƌĚĂƉƉƌŽĂĐŚ͕ƵŶĚĞƌŶŽƌŵĂůĐŝƌĐƵŵƐƚĂŶĐĞƐ͕ ŝƐƚŽĐŽŶĚƵĐƚƌŽƵŐŚůLJϮϱйŽĨĂůůƉƌŽũĞĐƚĚĂLJƐŽŶͲƐŝƚĞŝŶLJŽƵƌĨĂĐŝůŝƚŝĞƐ͘ ƚLJƉŝĐĂůĚĂLJŽĨƚƌĂŝŶŝŶŐŝƐĨƌŽŵϵ͗ϬϬƚŽϰ͗ϯϬ;Žƌϴ͗ϯϬƚŽϰ͗ϬϬͿ͕ĂůůŽǁŝŶŐĨŽƌĂďƌĞĂŬĨŽƌůƵŶĐŚĂŶĚƐŚŽƌƚďƌĞĂŬƐ ŝŶƚŚĞŵŽƌŶŝŶŐĂŶĚĂĨƚĞƌŶŽŽŶĂƐŶĞĞĚĞĚ͘tĞ͛ǀĞĨŽƵŶĚƚŚĂƚĂůůŽǁŝŶŐƵƐĞƌƐƚŝŵĞƚŽƌĞƚƵƌŶƚŽƚŚĞŝƌĚĂŝůLJ ƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐďĞĨŽƌĞĂŶĚĂĨƚĞƌĐůĂƐƐĞƐŽƌƐĞƐƐŝŽŶƐĂůůŽǁƐĨŽƌŵŽƌĞƉƌŽĚƵĐƚŝǀŝƚLJĚƵƌŝŶŐƚŚĞƐĞƐƐŝŽŶ͘/ƚĂůƐŽ ĂůůŽǁƐƚŚĞdLJůĞƌ/ŵƉůĞŵĞŶƚĂƚŝŽŶƐƚĂĨĨƚŝŵĞƚŽƉƌĞƉĂƌĞƵƉŽŶĂƌƌŝǀĂůĂŶĚĨŽůůŽǁͲƵƉĂĨƚĞƌǁĂƌĚ͘dŚĞƐƚĂƌƚĂŶĚ ƐƚŽƉƚŝŵĞƐĨŽƌƚŚĞƚƌĂŝŶŝŶŐǁŝůůďĞĚŝƐĐƵƐƐĞĚĂŶĚĂŐƌĞĞĚƵƉŽŶďLJƉƌŽũĞĐƚŵĂŶĂŐĞŵĞŶƚĚƵƌŝŶŐƚŚĞƉůĂŶŶŝŶŐ ƉŽƌƚŝŽŶŽĨƚŚĞƉƌŽũĞĐƚĂŶĚǁŝůůďĞƉƵďůŝƐŚĞĚĂƐƐƚĂŶĚĂƌĚƐĞƐƐŝŽŶƚŝŵĞƐƚŚƌŽƵŐŚŽƵƚƚŚĞƉƌŽũĞĐƚ͘ dƌĂŝŶŝŶŐĐůĂƐƐĞƐƐŚŽƵůĚďĞůŝŵŝƚĞĚƚŽďĞƚǁĞĞŶϭϮĂƚƚĞŶĚĞĞƐ͘ĞƌƚĂŝŶƐƵďũĞĐƚĂƌĞĂƐĂŶĚƚŽƉŝĐƐĂůůŽǁĨŽƌŵƵĐŚ ůĂƌŐĞƌƚƌĂŝŶŝŶŐĐůĂƐƐĞƐ͘ WƌŽũĞĐƚDĂŶĂŐĞƌ dLJůĞƌǁŝůůĂƐƐŝŐŶĂĚĞĚŝĐĂƚĞĚWƌŽũĞĐƚDĂŶĂŐĞƌ;dLJůĞƌWDͿƚŽĨĂĐŝůŝƚĂƚĞĂŶĚĐŽŽƌĚŝŶĂƚĞĂůůƉƌŽũĞĐƚĂĐƚŝǀŝƚŝĞƐ͘dŚĞ ŝƚLJǁŝůůŶĞĞĚƚŽĂůƐŽĂƉƉŽŝŶƚĂWƌŽũĞĐƚDĂŶĂŐĞƌ;ŝƚLJWDͿƚŽƉĂƌƚŶĞƌǁŝƚŚƚŚĞdLJůĞƌWDƚŽƐŚĂƌĞŝŶƚŚĞ ƌĞƐƉŽŶƐŝďŝůŝƚLJŽĨĂƐƐƵƌŝŶŐƉƌŽũĞĐƚƚĂƐŬƐĂƌĞĐŽŵƉůĞƚĞĚĂĐĐŽƌĚŝŶŐƚŽƚŚĞŵƵƚƵĂůůLJĂŐƌĞĞĚƵƉŽŶƉƌŽũĞĐƚƐĐŚĞĚƵůĞ ĂƐǁĞůůĂƐƐĐŚĞĚƵůŝŶŐŝƚLJƌĞƐŽƵƌĐĞƐĂŶĚŚŽůĚŝŶŐƚŚĞŵĂĐĐŽƵŶƚĂďůĞĨŽƌƚŚĞŝƌƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐ͖dLJůĞƌWDǁŝůůĚŽ ƚŚĞƐĂŵĞĨŽƌdLJůĞƌƌĞƐŽƵƌĐĞƐ͘ dŚĞdLJůĞƌWDǁŝůůĞdžĞĐƵƚĞƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶƚŽŵĂŬĞƐƵƌĞŝƚŝƐďĞŝŶŐĐŽŶĚƵĐƚĞĚĂƐĚĞĨŝŶĞĚŝŶƚŚĞ^ƚĂƚĞŵĞŶƚ ŽĨtŽƌŬ͘dŚĞdLJůĞƌWDǁŝůůŵŽŶŝƚŽƌƉƌŽŐƌĞƐƐďĂƐĞĚŽŶƚŚĞƉƌŽũĞĐƚƉůĂŶĂŶĚǁŽƌŬƚŽǁĂƌĚƐĚĞůŝǀĞƌŝŶŐŽŶƚŝŵĞ ĂŶĚǁŝƚŚŝŶďƵĚŐĞƚ͘^ŚŽƵůĚĂŶŝŶĐƌĞĂƐĞƚŽƐĐŽƉĞďĞƌĞƋƵŝƌĞĚ͕ƚŚĞdLJůĞƌWDǁŝůůƉƌĞƐĞŶƚƚŚĞŝƐƐƵĞƚŽƚŚĞWƌŽũĞĐƚ dĞĂŵĨŽƌĂĚĞĐŝƐŝŽŶƚŽďĞŵĂĚĞĂƐƚŚĞďĞƐƚĂƉƉƌŽĂĐŚƚŽĂĚĚƌĞƐƐ͘/ŶƌĞǀŝĞǁŝŶŐƚŚĞŝƚĞŵ͕ƚŚĞdLJůĞƌWDǁŝůů ĂƚƚĞŵƉƚƚŽƉƌŽǀŝĚĞŽƉƚŝŽŶƐĨŽƌƚŚĞŝƚLJƚŽĐŽŶƐŝĚĞƌĂŶĚĂĚŽƉƚĂƐƚŚĞƉĂƚŚƚŽŵŽǀĞĨŽƌǁĂƌĚ͘/ĨƚŚĞƌĞƐŽůƵƚŝŽŶŝƐ ŽƵƚŽĨƐĐŽƉĞ͕ƚŚĞŶĂĐŚĂŶŐĞŽƌĚĞƌǁŝůůďĞĞdžĞĐƵƚĞĚĨŽƌƚŚĞŝƚLJƚŽƌĞǀŝĞǁ͘ dŚĞdLJůĞƌWDǁŝůůďĞĐŽŶƐŝƐƚĞŶƚůLJĐŽŵŵƵŶŝĐĂƚŝŶŐǁŝƚŚƚŚĞŝƚLJƚŚƌŽƵŐŚŽƵƚƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dŚĞƌĞǁŝůůďĞ ďŽƚŚƐĐŚĞĚƵůĞĚĂŶĚƵŶƐĐŚĞĚƵůĞĚĐŽŵŵƵŶŝĐĂƚŝŽŶƐ͘^ĐŚĞĚƵůĞĚĐŽŵŵƵŶŝĐĂƚŝŽŶƐǁŝůůďĞƐƵĐŚĂĐƚŝǀŝƚŝĞƐĂƐ ƐƚĞĞƌŝŶŐĐŽŵŵŝƚƚĞĞŵĞĞƚŝŶŐƐ͕ĐŽŶĨĞƌĞŶĐĞĐĂůůƐ͕ĂŶĚƉƌŽũĞĐƚƐƚĂƚƵƐĐĂůůƐƚŽŽĐĐƵƌŽŶĂƌĞĐƵƌƌŝŶŐďĂƐŝƐĂƐ ĚĞĨŝŶĞĚŝŶƚŚĞ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬ͘hŶƐĐŚĞĚƵůĞĚĐŽŵŵƵŶŝĐĂƚŝŽŶƐǁŝůůďĞƉŚŽŶĞĐĂůůƐĂƐŶĞĞĚĞĚ͕ĂŶĚĞŵĂŝůƐ͘/ƚ ŝƐƚŚĞƌŽůĞŽĨƚŚĞdLJůĞƌWDƚŽŬĞĞƉĐŽŵŵƵŶŝĐĂƚŝŽŶůŝŶĞƐŽƉĞŶĨŽƌƚŚĞŝƚLJĂŶĚdLJůĞƌƚŽŚĂǀĞƚŚĞƐĂŵĞ ĞdžƉĞĐƚĂƚŝŽŶƐĂŶĚĂǁĂƌĞŶĞƐƐŽĨƚŚĞƉƌŽũĞĐƚ͘ dŚĞdLJůĞƌWDŝƐƵůƚŝŵĂƚĞůLJƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞƐƵĐĐĞƐƐŽĨƚŚĞƉƌŽũĞĐƚ͘dŚŝƐŝŶĚŝǀŝĚƵĂůŵƵƐƚƚƌĂĐŬƉƌŽũĞĐƚ ƉƌŽŐƌĞƐƐĂŶĚĂĐĐƵƌĂƚĞůLJĐĂůĐƵůĂƚĞƚŚĞƉĞƌĐĞŶƚĂŐĞŽĨĐŽŵƉůĞƚŝŽŶŽŶƚĂƐŬƐŝŶƌĞůĂƚŝŽŶƐŚŝƉƚŽĐŽŵƉůĞƚŝŽŶĚĂƚĞƐ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϲ Ks/ͲϭϵĂŶĚsŝƌƚƵĂů^ŽůƵƚŝŽŶƐ /ŶƌĞĐĞŶƚŵŽŶƚŚƐ͕ŐŽǀĞƌŶŵĞŶƚƐŚĂǀĞĨĂĐĞĚƵŶŝƋƵĞĐŚĂůůĞŶŐĞƐŝŶĐůƵĚŝŶŐƐŚŝĨƚŝŶŐƚŽĂƌĞŵŽƚĞŽƉĞƌĂƚŝŶŐ ĞŶǀŝƌŽŶŵĞŶƚ͕ŶĂǀŝŐĂƚŝŶŐƵŶĐĞƌƚĂŝŶƚLJĂƌŽƵŶĚƌĞǀĞŶƵĞĂŶĚŽƉĞƌĂƚŝŶŐŶĞĞĚƐ͕ĂŶĚĨĂĐŝŶŐĚĞŵĂŶĚƐƚŽĚĞůŝǀĞƌ ƐĞƌǀŝĐĞƐŝŶŶĞǁǁĂLJƐ͘ ^ŚŝĨƚƚŽZĞŵŽƚĞKƉĞƌĂƚŝŽŶƐ ůŵŽƐƚŝŵŵĞĚŝĂƚĞůLJĂƚƚŚĞŽŶƐĞƚŽĨƚŚĞĐŽƌŽŶĂǀŝƌƵƐƉĂŶĚĞŵŝĐ͕ŐŽǀĞƌŶŵĞŶƚƐŶĞĞĚĞĚƚŽŵŽǀĞƚŚĞŝƌǁŽƌŬĨŽƌĐĞ ŽĨĨƐŝƚĞ͘^ŚŝĨƚŝŶŐƚŽĂƌĞŵŽƚĞŽƉĞƌĂƚŝŶŐĞŶǀŝƌŽŶŵĞŶƚŵĞĂŶƚƐƚĂĨĨŶĞĞĚĞĚĂĐĐĞƐƐƚŽƚŚĞĨƵůůĐĂƉĂďŝůŝƚŝĞƐŽĨƚŚĞŝƌ ƐŽĨƚǁĂƌĞƐŽůƵƚŝŽŶƐĨƌŽŵŚŽŵĞ͘/ƚ͛ƐǁŽƌƚŚǁŚŝůĞƚŽŶŽƚĞƚŚĂƚŐŽǀĞƌŶŵĞŶƚƐǁŝƚŚǁĞďͲĂĐĐĞƐƐŝďůĞĐůŽƵĚƐŽůƵƚŝŽŶƐ ŚĂĚĂŶĞĂƐŝĞƌƚŝŵĞǁŝƚŚƚŚŝƐƌĂƉŝĚƐŚŝĨƚ͘ &ŝŶĂŶĐŝĂůĂŶĚtŽƌŬĨŽƌĐĞhŶĐĞƌƚĂŝŶƚLJ WƌŝŽƌƚŽKs/Ͳϭϵ͕ŐŽǀĞƌŶŵĞŶƚƐůĂƌŐĞůLJŵĂŶĂŐĞĚďLJƉĂƚƚĞƌŶƐ͗͞/ƚ͛ƐǁŚĂƚǁĞ͛ǀĞĂůǁĂLJƐĚŽŶĞ͘EĞdžƚLJĞĂƌ͕ǁĞ ĞdžƉĞĐƚƚŽƐĞĞĂĨŝǀĞͲƉĞƌĐĞŶƚŝŶĐƌĞĂƐĞ͕ĞƚĐ͘͟dŚĞƌĞǁĂƐĂůŝŶĞĂƌ͕ƉƌĞĚŝĐƚĂďůĞƉůĂŶŶŝŶŐĂƉƉƌŽĂĐŚ͘EŽǁ͕ ŐŽǀĞƌŶŵĞŶƚƐĨĂĐĞŶĞǁĐŚĂůůĞŶŐĞƐĂƌŽƵŶĚƚŚĞŝƌĂďŝůŝƚLJƚŽĨŽƌĞĐĂƐƚǁŚĞƌĞƚŚĞLJǁŝůůďĞŝŶƚŚƌĞĞ͕Ɛŝdž͕ŽƌŶŝŶĞ ŵŽŶƚŚƐǁŝƚŚĐŚĂŶŐŝŶŐƌĞǀĞŶƵĞ͘dŚĞƌĞŝƐƐŝŐŶŝĨŝĐĂŶƚƵŶĐĞƌƚĂŝŶƚLJĂƌŽƵŶĚůŽƐŝŶŐŵĂũŽƌƌĞǀĞŶƵĞƐŽƵƌĐĞƐŽƌ ƉŽƚĞŶƚŝĂůŝŶĂďŝůŝƚLJƚŽĂĐĐĞƐƐĂĐĞƌƚĂŝŶƉŽƌƚŝŽŶŽĨƚŚĞŝƌǁŽƌŬĨŽƌĐĞ͘ŽŶƐƚŝƚƵĞŶƚƐ͛ŶĞĞĚƐĨŽƌƐĞƌǀŝĐĞƐŵĂLJĂůƐŽ ĐŚĂŶŐĞĚƌĂŵĂƚŝĐĂůůLJĨƌŽŵŽŶĞƉĞƌŝŽĚƚŽƚŚĞŶĞdžƚ͘/ƚ͛ƐĂĐŚĂůůĞŶŐĞƚŽĨŽƌĞĐĂƐƚĨŽƌǁĂƌĚĂŶĚĞŶƐƵƌĞƚŚĞƌŝŐŚƚŵŝdž ŽĨĨŝŶĂŶĐŝĂůĂŶĚŚƵŵĂŶƌĞƐŽƵƌĐĞƐƚŽŵĞĞƚĐŽŵŵƵŶŝƚLJŶĞĞĚƐ͘ EĞǁWƵďůŝĐ^ĞƌǀŝĐĞĞůŝǀĞƌLJ &ŝŶĂůůLJ͕ƉĞŽƉůĞǁĂŶƚĂŶĚŶĞĞĚƚŽŝŶƚĞƌĂĐƚǁŝƚŚŐŽǀĞƌŶŵĞŶƚƌĞŵŽƚĞůLJ͘dŚĞƌĞǁĂƐĂƐĐƌĂŵďůĞǁŚĞŶKs/Ͳϭϵ͛Ɛ ĞĂƌůLJĚĂLJƐĞdžƉŽƐĞĚŚŽůĞƐŝŶŐŽǀĞƌŶŵĞŶƚƐ͛ŽŶůŝŶĞƉƌĞƐĞŶĐĞĂŶĚĂďŝůŝƚŝĞƐƚŽĞdžƉĂŶĚŽŶůŝŶĞŽĨĨĞƌŝŶŐƐĨŽƌƚŚŝŶŐƐ ƚŚĂƚǁĞƌĞŶŽƌŵĂůůLJĂĐĐŽŵƉůŝƐŚĞĚŝŶƉĞƌƐŽŶ͘&ŽƌĞdžĂŵƉůĞ͕ƐŽŵĞŽŶĞĐŽŶƚĞƐƚŝŶŐĂƚƌĂĨĨŝĐƚŝĐŬĞƚǁŽƵůĚŽƌĚŝŶĂƌŝůLJ ĂƉƉĞĂƌďĞĨŽƌĞĂũƵĚŐĞ͘dŽĚĂLJ͕ƚŚĂƚƉĞƌƐŽŶĐĂŶƉĂLJĂƚŝĐŬĞƚŽŶůŝŶĞǁŝƚŚĂŐƵŝůƚLJƉůĞĂ͕ďƵƚƚŚĞƌĞ͛ƐŶŽƚĂŐŽŽĚ ĂŶƐǁĞƌĨŽƌƐŽŵĞŽŶĞƉůĞĂĚŝŶŐŶŽƚŐƵŝůƚLJ͘ 'ŽǀĞƌŶŵĞŶƚƐƌĞĂĐŚĞĚĂƉŝǀŽƚĂůŵŽŵĞŶƚĂŶĚĐƌĞĂƚĞĚĐŚĂŶŐĞƐƚŚĂƚĂƌĞŚĞƌĞƚŽƐƚĂLJ͘dŚĞĚĞŵĂŶĚĨŽƌŽŶůŝŶĞ ƐĞƌǀŝĐĞƐ͕ŝŶƉĂƌƚŝĐƵůĂƌ͕ďĞĐĂŵĞƵƌŐĞŶƚĚƵƌŝŶŐƚŚĞƉĂŶĚĞŵŝĐ͘dŚĞĞdžƉĞĐƚĂƚŝŽŶŝƐƚŚĂƚƚŚŽƐĞƐĞƌǀŝĐĞƐĂƌĞŐŽŝŶŐ ƚŽƌĞŵĂŝŶĂŶĚŬĞĞƉƌŽůůŝŶŐ͘sŝƌƚƵĂůƐŽůƵƚŝŽŶƐƚŚĂƚĞŶĂďůĞƌĞŵŽƚĞǁŽƌŬ͕ŚĞůƉŶĂǀŝŐĂƚĞƵŶĐĞƌƚĂŝŶƚLJ͕ĂŶĚ ĨĂĐŝůŝƚĂƚĞŶĞǁǁĂLJƐƚŽƐĞƌǀĞĂƌĞĐĞƌƚĂŝŶůLJƌĞƐƉŽŶƐĞƐƚŽƚŚĞKs/ͲϭϵĐƌŝƐŝƐĞŶǀŝƌŽŶŵĞŶƚ͘ǀĞŶŵŽƌĞ ŝŵƉŽƌƚĂŶƚ͕ƚŚĞLJĂƌĞŶĞĐĞƐƐĂƌLJĨŽƌŐŽǀĞƌŶŵĞŶƚƐƚŽďĞƐƵƌĞǁŚĞŶƚŚĞŶĞdžƚĐƌŝƐŝƐŚŝƚƐͶǁŚĞƚŚĞƌƌĞĐĞƐƐŝŽŶ͕ ŚƵƌƌŝĐĂŶĞ͕ŽƌƐŽŵĞƚŚŝŶŐĞůƐĞͶƚŚĞŝƌƚĞĐŚŶŽůŽŐLJŝƐŝŶƉůĂĐĞĂŶĚĨůĞdžŝďůĞĞŶŽƵŐŚƚŽƐƵƉƉŽƌƚƚŚĞŵ͘ sŝƌƚƵĂů^ŽůƵƚŝŽŶƐ dŽŝŵƉƌŽǀĞĚĂŝůLJŽƉĞƌĂƚŝŽŶƐŶŽǁĂŶĚǁĞĂƚŚĞƌƚŚĞŶĞdžƚĨƵůůͲďůŽǁŶĐƌŝƐŝƐŽƌĞǀĞŶƐŵĂůůĞƌďƵŵƉŝŶƚŚĞƌŽĂĚ͕ ŐŽǀĞƌŶŵĞŶƚƐƐŚŽƵůĚŝŵƉůĞŵĞŶƚĐŽŵƉƌĞŚĞŶƐŝǀĞ͕ǀŝƌƚƵĂůƐŽůƵƚŝŽŶƐƚŽďĞƚƚĞƌƐĞƌǀĞĂůůƐƚĂŬĞŚŽůĚĞƌƐ͘ ^ƚĂŬĞŚŽůĚĞƌƐŝŶƚŚĞďƌŽĂĚĞƐƚƐĞŶƐĞŽĨƚŚĞƚĞƌŵŝŶĐůƵĚĞŐŽǀĞƌŶŵĞŶƚĞŵƉůŽLJĞĞƐ͕ďƵƐŝŶĞƐƐĞƐ͕ƌĞƐŝĚĞŶƚƐ͕ŽƚŚĞƌ ŐŽǀĞƌŶŵĞŶƚƐĂŶĚĂŐĞŶĐŝĞƐ͕ĂŶĚĚĞĐŝƐŝŽŶͲŵĂŬĞƌƐĂŶĚŽĨĨŝĐŝĂůƐ͘&ŽůůŽǁŝŶŐĂƌĞƐƉĞĐŝĨŝĐǁĂLJƐƚŽŵĞĞƚƚŚĞ ĞǀŽůǀŝŶŐŶĞĞĚƐŽĨƚŚĞƐĞŐƌŽƵƉƐ͘ ĞƚƚĞƌ^ĞƌǀĞ'ŽǀĞƌŶŵĞŶƚŵƉůŽLJĞĞƐ ŵƉůŽLJĞĞƐ͛ĂďŝůŝƚLJƚŽǁŽƌŬƌĞŵŽƚĞůLJƌĞůŝĞƐŽŶƚƌĂŶƐĨŽƌŵŝŶŐĨĂŵŝůŝĂƌ͕ŝŶͲƉĞƌƐŽŶǁŽƌŬĨůŽǁƐƚŽŶĞǁĚŝŐŝƚĂů ƐŽůƵƚŝŽŶƐ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϳ sŝƌƚƵĂůtŽƌŬ^ŽůƵƚŝŽŶƐ tĞďͲďĂƐĞĚ͕ĐůŽƵĚƐŽůƵƚŝŽŶƐĞŶĂďůĞƌĞŵŽƚĞǁŽƌŬĂŶĚĂƌĞĞĂƐŝůLJƐĐĂůĂďůĞǁŚĞŶŶĞĞĚŝŶŐƚŽĂĚĚŶĞǁ ĨƵŶĐƚŝŽŶĂůŝƚLJĂŶĚĞǀŽůǀĞĂƐĐŽŵŵƵŶŝƚLJŶĞĞĚƐĐŚĂŶŐĞ͘ŝŐŝƚĂůĐŽŶƚĞŶƚŵĂŶĂŐĞŵĞŶƚŵĂŬĞƐĂůůƌĞůĞǀĂŶƚ ĚŽĐƵŵĞŶƚƐĂǀĂŝůĂďůĞƚŽƌĞŵŽƚĞǁŽƌŬĞƌƐƚŚƌŽƵŐŚŽƵƚǁŽƌŬĨůŽǁƐ͕ƉƵƚƚŝŶŐŬĞLJŝŶĨŽƌŵĂƚŝŽŶĂƚĞŵƉůŽLJĞĞ ĨŝŶŐĞƌƚŝƉƐƌĂƚŚĞƌƚŚĂŶŝŶŝŶĂĐĐĞƐƐŝďůĞĨŝůĞĐĂďŝŶĞƚƐ͘ ůĞĐƚƌŽŶŝĐdŝŵĞ^ŚĞĞƚƐ ŝŐŝƚĂůǁŽƌŬĨůŽǁƐĞĨĨĞĐƚŝǀĞůLJƌĞƉůĂĐĞŝŶĞĨĨŝĐŝĞŶƚƉĂƉĞƌƉƌŽĐĞƐƐĞƐĂƌŽƵŶĚƚŝŵĞ͕ĂƚƚĞŶĚĂŶĐĞ͕ĂŶĚƐĐŚĞĚƵůŝŶŐ͕ ĞůŝŵŝŶĂƚŝŶŐŝŶͲƉĞƌƐŽŶŚĂŶĚŽĨĨƐĂŶĚƐŝŐŶŽĨĨƐ͘ ŵƉůŽLJĞĞ^ĞůĨͲ^ĞƌǀŝĐĞ /ŵƉƌŽǀŝŶŐĞŵƉůŽLJĞĞĂĐĐĞƐƐƚŽĐƌƵĐŝĂůŝŶĨŽƌŵĂƚŝŽŶĂŶĚƐĞƌǀŝĐĞƐƌĞĚƵĐĞƐŽƚŚĞƌƐƚĂĨĨƚŝŵĞƐƉĞŶƚƌĞƐƉŽŶĚŝŶŐƚŽ ƌŽƵƚŝŶĞƌĞƋƵĞƐƚƐ͘&ƵůůLJĐƵƐƚŽŵŝnjĂďůĞĞŵƉůŽLJĞĞƉŽƌƚĂůƐŚĞůƉƐƚĂĨĨŚĞůƉƚŚĞŵƐĞůǀĞƐʹĨƌŽŵƵƉĚĂƚŝŶŐƉĞƌƐŽŶĂů ŝŶĨŽƌŵĂƚŝŽŶƚŽŵĂŬŝŶŐďĞŶĞĨŝƚƐĞůĞĐƚŝŽŶƐʹŝŶĂǁĂLJƚŚĂƚĂůƐŽĞůŝŵŝŶĂƚĞƐƉĂƉĞƌĨŽƌŵƐĂŶĚƌĞĚƵŶĚĂŶƚĚĂƚĂ ĞŶƚƌLJ͘ ĞƚƚĞƌ^ĞƌǀĞƚŚĞƵƐŝŶĞƐƐŽŵŵƵŶŝƚLJ dĞĐŚŶŽůŽŐLJƚŚĂƚĐŽŶŶĞĐƚƐƚŚĞĐŽƌĞĨƵŶĐƚŝŽŶƐŽĨŐŽǀĞƌŶŵĞŶƚŝŶƚĞƌŶĂůůLJĂŶĚƚŽƚŚĞƉƵďůŝĐĐĂŶĨĂĐŝůŝƚĂƚĞ ĂĚǀĂŶĐĞĚďƵƐŝŶĞƐƐŵĂŶĂŐĞŵĞŶƚĂŶĚďŽůƐƚĞƌĐŽŵŵƵŶŝƚLJĚĞǀĞůŽƉŵĞŶƚ͘ ƵƚŽŵĂƚĞ/ŶƚĞƌŶĂůWƌŽĐĞƐƐĞƐ ^ŽůƵƚŝŽŶƐƚŚĂƚƌĞĂĐŚƚŚĞƉƵďůŝĐ͕ĂƵƚŽŵĂƚĞďƵƐŝŶĞƐƐĨƵŶĐƚŝŽŶƐ͕ĂŶĚĞŶĂďůĞƐĞůĨͲƐĞƌǀŝĐĞĞdžƉĞĚŝƚĞĂĐƚŝŽŶƐ ŶĞĐĞƐƐĂƌLJĨŽƌŐƌŽǁƚŚĂŶĚĞĐŽŶŽŵŝĐĚĞǀĞůŽƉŵĞŶƚ͕ƐƵĐŚĂƐůŝĐĞŶƐŝŶŐ͕ƚĂdžƌĞŵŝƚƚĂŶĐĞ͕ĂŶĚĨĞĞĐŽůůĞĐƚŝŽŶƐ͘ dŚĞƐĞƐŽůƵƚŝŽŶƐĂůƐŽŚĞůƉƚŽĞŶĨŽƌĐĞŽƌĚŝŶĂŶĐĞƐĞǀĞŶǁŚĞŶŽĨĨŝĐĞƐĂƌĞƉŚLJƐŝĐĂůůLJĐůŽƐĞĚ͘ WĂƉĞƌůĞƐƐ͕tĞďͲĂƐĞĚWůĂŶZĞǀŝĞǁƐ /ŶƚĞŐƌĂƚŝŶŐƌĞŐƵůĂƚŽƌLJĂŶĚďƵƐŝŶĞƐƐĚĞǀĞůŽƉŵĞŶƚƌĞƋƵŝƌĞŵĞŶƚƐŽĨƌĞůĞǀĂŶƚĚĞƉĂƌƚŵĞŶƚƐŝŶĂƐŝŶŐůĞƉůĂƚĨŽƌŵ ĐƌĞĂƚĞƐŝŶƚĞƌŶĂůĞĨĨŝĐŝĞŶĐŝĞƐƐŽƐƚĂĨĨĐĂŶƉƌŽĐĞƐƐƉůĂŶƌĞǀŝĞǁƐ͕ƉĞƌŵŝƚƐ͕ĂŶĚŝŶƐƉĞĐƚŝŽŶƐ͕ĨĂƐƚĞƌĂŶĚĨƌŽŵ ƌĞŵŽƚĞůŽĐĂƚŝŽŶƐ͘^ƉĞĐŝĨŝĐĂůůLJ͕ĂďƌŽǁƐĞƌͲďĂƐĞĚƉĂƉĞƌůĞƐƐƉůĂŶƌĞǀŝĞǁĂŶĚƐƵďŵŝƚƚĂůƉƌŽĐĞƐƐƉƌŽǀŝĚĞƐ ĐŽůůĂďŽƌĂƚŝǀĞŝŶƚĞƌĂĐƚŝŽŶďĞƚǁĞĞŶŐŽǀĞƌŶŵĞŶƚĂŶĚĐŽŶƐƚŝƚƵĞŶƚƐǁŝƚŚŽƵƚƌĞƋƵŝƌŝŶŐŝŶͲƉĞƌƐŽŶŝŶƚĞƌĂĐƚŝŽŶ͘ ŽŵŵƵŶŝƚLJĞǀĞůŽƉŵĞŶƚWƵďůŝĐWŽƌƚĂůƐ DŽĚĞƌŶĐŽŵŵƵŶŝƚLJĚĞǀĞůŽƉŵĞŶƚƐŽĨƚǁĂƌĞƉƌŽǀŝĚĞƐŽŶůŝŶĞŽƌŵŽďŝůĞƉĞƌŵŝƚƚŝŶŐ͕ŝŶƐƉĞĐƚŝŽŶ͕ƉĂLJŵĞŶƚ͕ĂŶĚ ĞŶĨŽƌĐĞŵĞŶƚĨƵŶĐƚŝŽŶĂůŝƚŝĞƐ͕Ϯϰͬϳ͘ůůŽǁŝŶŐŽŶůŝŶĞŵŽŶĞƚĂƌLJŽƌƌĞĐŽƌĚƐƌĞƚƌŝĞǀĂůƚƌĂŶƐĂĐƚŝŽŶƐŚĞůƉƐ ĐŽŵŵƵŶŝƚLJŵĞŵďĞƌƐĐŽŶĚƵĐƚŶĞĂƌůLJĂůůďƵƐŝŶĞƐƐǁŝƚŚŐŽǀĞƌŶŵĞŶƚŽŶůŝŶĞ͕ŽŶƚŚĞŝƌŽǁŶƚŝŵĞ͕ĂŶĚŬĞĞƉƐ ĚĞǀĞůŽƉŵĞŶƚŵŽǀŝŶŐĨŽƌǁĂƌĚ͘ ĞƚƚĞƌ^ĞƌǀĞZĞƐŝĚĞŶƚƐ 'ŽǀĞƌŶŵĞŶƚƐƚŚĂƚŝŶĨŽƌŵ͕ĞŶŐĂŐĞ͕ĂŶĚĞŶĂďůĞĂĐƚŝŽŶĨŽƌƚŚĞŝƌƌĞƐŝĚĞŶƚƐĂůůŽǁĐŽŶƐƚŝƚƵĞŶƚƐƚŽďĞĐŽŵĞĂƉĂƌƚ ŽĨƚŚĞŐŽǀĞƌŶŵĞŶƚƉƌŽĐĞƐƐ͘^ƵĐĐĞƐƐĨƵů͕ƵƐĞƌͲĐĞŶƚƌŝĐƉŽůŝĐLJĂŶĚƉƌŽŐƌĂŵĚĞůŝǀĞƌLJŶŽƚŽŶůLJƉƌŽǀŝĚĞĞĂƐLJǁĂLJƐ ĨŽƌƌĞƐŝĚĞŶƚƐƚŽŝŶƚĞƌĂĐƚǁŝƚŚĂŐĞŶĐŝĞƐĂŶĚĐŽŶƐƵŵĞŝŶĨŽƌŵĂƚŝŽŶƚŚĂƚŝƐƌĞůĞǀĂŶƚƚŽƚŚĞŵ͕ƚŚĞLJĂůƐŽƐŽůǀĞƚŚĞ ĐŚĂůůĞŶŐĞŽĨƉĞŽƉůĞŐŽŝŶŐƚŽŵƵůƚŝƉůĞĚĞƉĂƌƚŵĞŶƚƐƚŽĐŽŶĚƵĐƚŐŽǀĞƌŶŵĞŶƚďƵƐŝŶĞƐƐ͘ ZĞŵŽƚĞĐĐĞƐƐŝďŝůŝƚLJ ,ĂǀŝŶŐĂƋƵŝĐŬĂŶĚƌĞůŝĂďůĞĞͲĐŽŵŵĞƌĐĞƐŽůƵƚŝŽŶƚŽƐƵƉƉŽƌƚƚƌĂĚŝƚŝŽŶĂůŝŶͲŽĨĨŝĐĞƚƌĂŶƐĂĐƚŝŽŶƐĞŶƐƵƌĞƐ ƌĞƐŝĚĞŶƚƐĐĂŶ͞ĚŽďƵƐŝŶĞƐƐ͟ǁŝƚŚŐŽǀĞƌŶŵĞŶƚĨƌŽŵĂŶLJǁŚĞƌĞ͘&ĂĐŝůŝƚĂƚŝŶŐĞĂƐLJƌĞŵŽƚĞƚƌĂŶƐĂĐƚŝŽŶƐĂůƐŽ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϴ ĞŶƐƵƌĞƐƚŝŵĞůLJƌĞǀĞŶƵĞĐŽůůĞĐƚŝŽŶ͘ŶĂďůŝŶŐŽŶůŝŶĞƵƚŝůŝƚLJƉĂLJŵĞŶƚƐǀŝĂǁĞďůŝŶŬŽƌƉŚŽŶĞƉĂLJŵĞŶƚƐǀŝĂ/sZ ƐLJƐƚĞŵƐ͕ĨŽƌĞdžĂŵƉůĞ͕ĚƌĂƐƚŝĐĂůůLJƌĞĚƵĐĞƐĚĞůŝŶƋƵĞŶĐŝĞƐ͘ ŽŵŵƵŶŝƚLJŶŐĂŐĞŵĞŶƚ &ĂĐŝůŝƚĂƚŝŶŐŵĂƐƐĐŽŵŵƵŶŝĐĂƚŝŽŶĐĂŶĂůƐŽŚĞůƉƌĞƐŝĚĞŶƚƐĐŽŶĚƵĐƚďƵƐŝŶĞƐƐǁŝƚŚŐŽǀĞƌŶŵĞŶƚŵŽƌĞĞĂƐŝůLJ͘tŝƚŚ ƌĞĂůͲƚŝŵĞŽƌƉƌĞͲƐĐŚĞĚƵůĞĚƉƵƐŚŶŽƚŝĨŝĐĂƚŝŽŶƐ͕ŐŽǀĞƌŶŵĞŶƚƐĐĂŶƋƵŝĐŬůLJĚŝƐƐĞŵŝŶĂƚĞĞŵĞƌŐĞŶĐLJŽƌŽƚŚĞƌ ŝŶĨŽƌŵĂƚŝŽŶƚŽƌĞƐŝĚĞŶƚƐ͕ƚĂƌŐĞƚĞĚďLJůŽĐĂƚŝŽŶ͕ǁŚĞŶĞǀĞƌŶĞĐĞƐƐĂƌLJ͘dŚĞƐĞƚLJƉĞƐŽĨŶŽƚŝĨŝĐĂƚŝŽŶƐĂůƐŽƉůĂLJĂŶ ŝŵƉŽƌƚĂŶƚƌŽůĞŝŶƌĞůĂLJŝŶŐĞŵĞƌŐĞŶĐLJŝŶĨŽƌŵĂƚŝŽŶƚŽƚŚĞŚĞĂƌŝŶŐŝŵƉĂŝƌĞĚ͕ǁŚĞƌĞƚƌĂĚŝƚŝŽŶĂůƉŚŽŶĞĐĂůůƐŽƌ ĞŵĞƌŐĞŶĐLJƐŝƌĞŶƐƉƌŽǀĞŝŶĞĨĨĞĐƚŝǀĞ͘ KĨĨĞƌŝŶŐƉƵďůŝĐͲĨĂĐŝŶŐĞŶŐĂŐĞŵĞŶƚƚŽŽůƐŝŶĂŶĂƉƉĂůůŽǁƐƌĞƐŝĚĞŶƚƐƚŽƉĂƌƚŝĐŝƉĂƚĞŝŶŐŽǀĞƌŶŵĞŶƚŝŶĂ ĐƵƐƚŽŵŝnjĂďůĞŵŽďŝůĞĞdžƉĞƌŝĞŶĐĞ͘hƐŝŶŐĂϯϭϭĂƉƉŽƌǁĞďƐŝƚĞ͕ƌĞƐŝĚĞŶƚƐ͕ĂůůŽǁŝŶŐƚŚĞŵƚŽŵĂŬĞƉĂLJŵĞŶƚƐ͕ ƌĞƉŽƌƚŶŽŶͲĞŵĞƌŐĞŶĐLJŝƐƐƵĞƐ͕ƌĞƋƵĞƐƚƐĞƌǀŝĐĞƐ͕ĂŶĚƌĞƐƉŽŶĚƚŽƐƵƌǀĞLJƐ͘DŽďŝůĞͲĨƌŝĞŶĚůLJǁĞďƐŝƚĞƐƚŚĂƚĂƌĞ ĞĂƐLJƚŽŶĂǀŝŐĂƚĞĂŶĚƉƌŽǀŝĚĞďŽƚŚŝŶĨŽƌŵĂƚŝŽŶĂŶĚƵƐĞĨƵůŝŶƚĞƌĂĐƚŝŽŶĂƌĞĂůƐŽĞƐƐĞŶƚŝĂůŝŶƉƌŽǀŝĚŝŶŐ ĐŽŵŵƵŶŝƚLJŶĞǁƐ͘/ŶƚĞƌĂĐƚŝǀĞŵĂƉƐŚĞůƉƌĞƐŝĚĞŶƚƐĂĐĐĞƐƐŐĞŽƐƉĂƚŝĂůǀŝĞǁƐĨŽƌŶĞŝŐŚďŽƌŚŽŽĚͲůĞǀĞůŝŶĨŽƌŵĂƚŝŽŶ ĂŶĚƚƌĞŶĚĂŶĂůLJƐŝƐŽƌĂůĞƌƚŶŽƚŝĨŝĐĂƚŝŽŶ͘ZĞŵŽƚĞŐŽǀĞƌŶŵĞŶƚĞŵƉůŽLJĞĞƐĐĂŶĂĚĚŝƚŝŽŶĂůůLJĐŽŶǀĞLJŶĞǁƐ ĂƵƚŽŵĂƚŝĐĂůůLJƚŽƌĞƐŝĚĞŶƚƐǀŝĂƉŚŽŶĞ͕ƚĞdžƚ͕ŽƌĞŵĂŝůŝŶĂƐĞĐƵƌĞ͕ĂƵĚŝƚĞĚĞŶǀŝƌŽŶŵĞŶƚ͘dĞĐŚŶŽůŽŐLJƚŚĂƚ ĨĂĐŝůŝƚĂƚĞƐƌĞŵŽƚĞŵĞĞƚŝŶŐŵĂŶĂŐĞŵĞŶƚĂůůŽǁƐƌĞƐŝĚĞŶƚƐƚŽƉĂƌƚŝĐŝƉĂƚĞŝŶǀŝƌƚƵĂůƚŽǁŶŚĂůůŽƌĐŽƵŶĐŝů ŵĞĞƚŝŶŐƐ͕ǁŝƚŚŽŶůŝŶĞĂŐĞŶĚĂƐ͕ŵŝŶƵƚĞƐ͕ĂŶĚƌĞĂůͲƚŝŵĞŵĞĞƚŝŶŐŝŶƚĞƌĂĐƚŝŽŶ͘dŚŝƐŶŽƚŽŶůLJŚĞůƉƐŝŶƚĞƌŶĂů ŽƌŐĂŶŝnjĂƚŝŽŶĂůŐƵŝĚĞůŝŶĞƐďƵƚĂůƐŽŝŶĐƌĞĂƐĞƐƚƌĂŶƐƉĂƌĞŶĐLJ͘ dŚĞ&ƵƚƵƌĞ tŚĞŶĐŽŶƐŝĚĞƌŝŶŐĞdžŝƐƚŝŶŐĂŶĚŶĞǁĐŚĂůůĞŶŐĞƐĨĂĐŝŶŐŐŽǀĞƌŶŵĞŶƚƐ͕ŝƚŝƐŝŵƉŽƌƚĂŶƚƚŽƌĞĐŽŐŶŝnjĞƚŚĂƚ ƚĞĐŚŶŽůŽŐLJĂůŽŶĞŝƐŶŽƚƚŚĞƐŽůƵƚŝŽŶƚŽŵŽƐƚƉƌŽďůĞŵƐ͘WŽůŝĐLJĐŚĂŶŐĞƐĂƌĞƚŚĞƐŽůƵƚŝŽŶƐ͘dŚĂƚƐĂŝĚ͕ƐƵĐĐĞƐƐĨƵů ƉŽůŝĐŝĞƐĂƌĞŶĞĂƌůLJŝŵƉŽƐƐŝďůĞƚŽŝŵƉůĞŵĞŶƚǁŝƚŚŽƵƚĞŶĂďůŝŶŐƚĞĐŚŶŽůŽŐLJďĞŚŝŶĚƚŚĞŵ͘ 'ŽǀdĞĐŚ^ƚĂĐŬƐ dĂŬĞŶƚŽŐĞƚŚĞƌ͕ƚŚĞŵĂŶLJĞůĞŵĞŶƚƐŽĨĂŐŽǀĞƌŶŵĞŶƚ͛ƐƚĞĐŚŶŽůŽŐLJŝŶĨƌĂƐƚƌƵĐƚƵƌĞĐĂŶƐĞĞŵůŝŬĞĂŶ ŝŵƉĞŶĞƚƌĂďůĞŵŽŶŽůŝƚŚ͕ĞƐƉĞĐŝĂůůLJƚŽŶŽŶͲƚĞĐŚŶŽůŽŐŝƐƚƐ͘ƐƚƌĂƚĞŐLJŽƌƌŽĂĚŵĂƉůĂLJŝŶŐŽƵƚǁŚĂƚĂŵŽĚĞƌŶ ŐŽǀĞƌŶŵĞŶƚƚĞĐŚŶŽůŽŐLJƐƚĂĐŬ;ŝ͘Ğ͕͘'ŽǀdĞĐŚ^ƚĂĐŬͿĞŶƚĂŝůƐĂůůŽǁƐůĞĂĚĞƌƐƚŽƐƚƌĂƚĞŐŝnjĞƚŚƌŽƵŐŚƚŚĞǀĂƌŝŽƵƐ ĐŽŵƉŽŶĞŶƚƐŽĨĂŐŽǀĞƌŶŵĞŶƚ͛ƐĚŝŐŝƚĂůĨŽƵŶĚĂƚŝŽŶŽǀĞƌƚŝŵĞ͕ƐŽƚŚĞĞŶƚĞƌƉƌŝƐĞďĞĐŽŵĞƐŵŽƌĞĐŽŵƉƌĞŚĞŶƐŝǀĞ ĂŶĚŝŶƚĞŐƌĂƚĞĚǁŝƚŚĞĂĐŚƐƚĞƉ͘ ŵŽĚĞƌŶ'ŽǀdĞĐŚ^ƚĂĐŬƌĞƋƵŝƌĞƐŐŽǀĞƌŶŵĞŶƚƐƚŚŝŶŬďĞLJŽŶĚƚŚĞĚĞƉĂƌƚŵĞŶƚůĞǀĞůƚŽĚĞƚĞƌŵŝŶĞŚŽǁĂŶLJ ƐLJƐƚĞŵƐĞƌǀĞƐďƵƐŝŶĞƐƐƉĂƌƚŶĞƌƐ͕ƐĞƌǀĞƐƚŚĞƉƵďůŝĐ͕ĂŶĚƉƌŽǀŝĚĞƐŝŶƚĞƌŶĂůĂŶĚĞdžƚĞƌŶĂůĚĞĐŝƐŝŽŶͲŵĂŬĞƌƐǁŝƚŚ ĂĐƚŝŽŶĂďůĞŝŶƐŝŐŚƚ͕ĂƐƚŚĞǀŝƌƚƵĂůƐŽůƵƚŝŽŶƐŚŝŐŚůŝŐŚƚĂďŽǀĞ͘ĐŽŵƉůĞƚĞ'ŽǀdĞĐŚ^ƚĂĐŬĂĐĐŽƵŶƚƐĨŽƌƚŚŝƐ ĞdžƉĂŶĚĞĚĚĞĨŝŶŝƚŝŽŶŽĨ͞ƐƚĂŬĞŚŽůĚĞƌ͟ĂŶĚĐŽŶƚĂŝŶƐ͗ x/ŶƚĞŐƌĂƚĞĚĂĚŵŝŶŝƐƚƌĂƚŝǀĞĂŶĚďƵƐŝŶĞƐƐŵĂŶĂŐĞŵĞŶƚƐLJƐƚĞŵƐ xdǁŽͲǁĂLJĐŝƚŝnjĞŶĞŶŐĂŐĞŵĞŶƚƚŽŽůƐ xDŽĚĞƌŶĚĂƚĂƐƚŽƌĂŐĞĂŶĚŝŶƚĞŐƌĂƚŝŽŶ xĂƚĂĂŶĂůLJƚŝĐƐĨŽƌĂĐƚŝŽŶĂďůĞŝŶƐŝŐŚƚ dŚŝƐŝƐĂůŽŶŐͲƚĞƌŵƐƚƌĂƚĞŐLJƚŽƉŽƐŝƚŝŽŶĂŶŽƌŐĂŶŝnjĂƚŝŽŶ͛ƐƚĞĐŚŶŽůŽŐLJƚŽƐƵƉƉŽƌƚƚŚĞĞǀŽůǀŝŶŐŶĞĞĚƐŽĨ ŐŽǀĞƌŶŵĞŶƚ͘dŚĞƌŽĂĚŵĂƉĐŽŶƐŝƐƚƐŽĨĚŝŵĞŶƐŝŽŶƐƚŽďĞďƵŝůƚŽƵƚŽǀĞƌŵƵůƚŝƉůĞďƵĚŐĞƚĐLJĐůĞƐĂŶĚǁŝƚŚŽƵƚ ĚŝƐƌƵƉƚŝŽŶ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϳϵ dŚĞůŽƵĚ ŶĐŝƌĐůŝŶŐƚŚĞ'ŽǀdĞĐŚ^ƚĂĐŬĞůĞŵĞŶƚƐĂƌĞƌŽďƵƐƚĐLJďĞƌƐĞĐƵƌŝƚLJĂŶĚƉƌŝǀĂĐLJĐŽŶƚƌŽůƐĂůŽŶŐǁŝƚŚĂŶĞŶƚĞƌƉƌŝƐĞͲ ǁŝĚĞĐůŽƵĚĂƌĐŚŝƚĞĐƚƵƌĞ͘ĐĐĞůĞƌĂƚŝŶŐĂŵŽǀĞƚŽƚŚĞĐůŽƵĚĂůůŽǁƐŐŽǀĞƌŶŵĞŶƚƐƚŽƚĂŬĞĂĚǀĂŶƚĂŐĞŽĨŝƚƐŵĂŶLJ ĐĂƉĂďŝůŝƚŝĞƐƚŚĂƚďŽůƐƚĞƌĂůůĐŽƌĞĂƌĞĂƐ͘ƵƌŝŶŐƚŚĞKs/ͲϭϵĐƌŝƐŝƐ͕ŝƚǁĂƐĂďŝŐƉƌŽďůĞŵƚŽŚĂǀĞĂĐƌŝƚŝĐĂůƐĞƌǀĞƌ ůŽĐŬĞĚŝŶĂŶŽĨĨŝĐĞǁŚĞƌĞƐƚĂĨĨĐŽƵůĚŶ͛ƚŐŽ͘ƐǁĞŵŽǀĞŽƵƚŽĨƚŚĂƚĐƌŝƐŝƐĂŶĚŝŶƚŽƚŚĞĨƵƚƵƌĞ͕ƚŚĞƌĞĂƌĞŽƚŚĞƌ ďĞŶĞĨŝƚƐ͘EŽƚŽŶůLJĚŽĞƐƚŚĞĐůŽƵĚŵŝƚŝŐĂƚĞƐĞĐƵƌŝƚLJƌŝƐŬʹǁŝƚŚďƵŝůƚͲŝŶĚŝƐĂƐƚĞƌƌĞĐŽǀĞƌLJ͕ƐĞĐƵƌŝƚLJĐŽŵƉůŝĂŶĐĞ͕ ĂŶĚƌĞŵŽƚĞƵƉĚĂƚĞƐʹďƵƚŝƚĐĂŶĂůƐŽŝŵƉƌŽǀĞƚŚĞĂŐŝůŝƚLJŽĨŐŽǀĞƌŶŵĞŶƚƚŽƌĞƐƉŽŶĚƋƵŝĐŬůLJƚŽŽƚŚĞƌƌĂƉŝĚůLJ ĞǀŽůǀŝŶŐƐŝƚƵĂƚŝŽŶƐ͘'ŽǀĞƌŶŵĞŶƚƐŽƉĞƌĂƚŝŶŐŝŶƚŚĞĐůŽƵĚĞŶǀŝƌŽŶŵĞŶƚƚĞŶĚƚŽŬĞĞƉƐŽĨƚǁĂƌĞĂŶĚ ĞŶǀŝƌŽŶŵĞŶƚƐƵƉƚŽĚĂƚĞ͘'ŽǀĞƌŶŵĞŶƚƐǁŝƚŚŽŶͲƉƌĞŵŝƐĞƐƐŽůƵƚŝŽŶƐĐĂŶĨĂůůďĞŚŝŶĚŽŶŵƵůƚŝƉůĞƐŽĨƚǁĂƌĞ ƌĞůĞĂƐĞƐ͘>ĞĂĚĞƌƐŵƵƐƚĞŶƐƵƌĞƚŚĞŝƌŽƌŐĂŶŝnjĂƚŝŽŶƐĂƌĞŶ͛ƚƚƌLJŝŶŐƚŽŵŽǀĞĂĚĞĐĂĚĞƐͲŽůĚƐLJƐƚĞŵŝŶƚŽƚŚĞĐůŽƵĚ ďƵƚĂƌĞŝŶƐƚĞĂĚĂĚŽƉƚŝŶŐŵŽĚĞƌŶƐŽĨƚǁĂƌĞĂƐƚŚĞLJŵŝŐƌĂƚĞ͘KŶĐĞŝŶƚŚĞĐůŽƵĚ͕ŐŽǀĞƌŶŵĞŶƚƐĐĂŶĞƐƐĞŶƚŝĂůůLJ ĂĚĚƌĞƐƐƚŚĞŝƌĨƵƚƵƌĞƚĞĐŚŶŽůŽŐLJƌŽĂĚŵĂƉǁŝƚŚŽƵƚŝŶĚĞƉĞŶĚĞŶƚůLJƐŽůǀŝŶŐƌĞƐŽƵƌĐŝŶŐƉƌŽďůĞŵƐ͘dŽŬĞĞƉ ĐŽŵŵƵŶŝƚŝĞƐĐŽŶŶĞĐƚĞĚĂŶĚƐĞƌǀĞĚĚƵƌŝŶŐĐƌŝƐĞƐĂŶĚŝŶƚŝŵĞƐŽĨĐŚĂŶŐĞ͕ŐŽǀĞƌŶŵĞŶƚƐŵƵƐƚĂƚƚĞŶĚƚŽĂůŽŶŐͲ ƚĞƌŵĚŝŐŝƚĂůŝŶĨƌĂƐƚƌƵĐƚƵƌĞ͘dŚĞǀŝƌƚƵĂůƐŽůƵƚŝŽŶƐŶŽƚĞĚĂďŽǀĞŶŽƚŽŶůLJďĞƚƚĞƌƐĞƌǀĞĂůůŬĞLJƐƚĂŬĞŚŽůĚĞƌƐ͕ďƵƚ ƚŚĞLJĂůƐŽƉƌŽǀŝĚĞŐŽǀĞƌŶŵĞŶƚƐǁŝƚŚƌĞƐŽƵƌĐĞͲƐĂǀŝŶŐĞĨĨŝĐŝĞŶĐŝĞƐ͘/ŶƚŚĞĐŽŶƚĞdžƚŽĨƵŶĐĞƌƚĂŝŶĨŝƐĐĂůŝŵƉĂĐƚĂŶĚ ĞǀŽůǀŝŶŐĐŽŵŵƵŶŝƚLJŶĞĞĚƐ͕ƐƚƌĂƚĞŐŝĞƐŵĂŬŝŶŐŽƉĞƌĂƚŝŽŶƐƐŵĂƌƚĞƌĂŶĚŵŽƌĞƐƵƐƚĂŝŶĂďůĞĂƌĞĐƌŝƚŝĐĂůƚŽŵŽǀĞ ŐŽǀĞƌŶŵĞŶƚƐƐŽůŝĚůLJŝŶƚŽƚŚĞĨƵƚƵƌĞ͘dŚĞĨŽĐƵƐŽŶǀŝƌƚƵĂůƐŽůƵƚŝŽŶƐŝƐĞƐƉĞĐŝĂůůLJŝŵƉŽƌƚĂŶƚĂƐŐŽǀĞƌŶŵĞŶƚƐ ƌĞĂůŝnjĞƚŚĞǀĂůƵĞŽĨŵŽďŝůŝƚLJ͕ŽŶůŝŶĞĞŶŐĂŐĞŵĞŶƚ͕ĂŶĚƌĞŵŽƚĞĐŝƚŝnjĞŶŝŶƚĞƌĂĐƚŝŽŶ͘dŚĞĐŽŶƚŝŶƵĂƚŝŽŶŽĨƌĞŵŽƚĞ ǁŽƌŬ͕ŝŶǀĞƐƚŵĞŶƚŝŶƐĞĐƵƌĞŶĞƚǁŽƌŬƐ͕ĂŶĚŝŵƉƌŽǀĞĚĞŶŐĂŐĞŵĞŶƚĂŶĚĐŽŵŵƵŶŝĐĂƚŝŽŶǁŝůůĚƌŝǀĞŽŶŐŽŝŶŐ ŝŶŶŽǀĂƚŝŽŶƚŽƐƚƌĞŶŐƚŚĞŶŐŽǀĞƌŶŵĞŶƚƐĂŶĚĐŽŵŵƵŶŝƚŝĞƐƚŚĞLJƐĞƌǀĞǁĞůůŝŶƚŽƚŚĞĨƵƚƵƌĞ͘ sŝĞǁĂĚĚŝƚŝŽŶĂůƌĞƐŽƵƌĐĞƐĂŶĚƚŽŽůƐƚŽŝŵƉƌŽǀĞƐĞƌǀŝĐĞĂŶĚƐƵƉƉŽƌƚĐŽŵŵƵŶŝƚŝĞƐĂƚ ŚƚƚƉƐ͗ͬͬǁǁǁ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵͬĐŽǀŝĚͲϭϵͲƌĞƐŽƵƌĐĞƐ͘ ZŽůĞƐĂŶĚZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ dŚĞĨŽůůŽǁŝŶŐĚĞĨŝŶĞƐƚŚĞƌŽůĞƐĂŶĚƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐŽĨĞĂĐŚWƌŽũĞĐƚƌĞƐŽƵƌĐĞĨŽƌƚŚĞŝƚLJĂŶĚdLJůĞƌ͘ZŽůĞƐĂŶĚ ƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐŵĂLJŶŽƚĨŽůůŽǁƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶĂůĐŚĂƌƚŽƌƉŽƐŝƚŝŽŶĚĞƐĐƌŝƉƚŝŽŶƐĂƚƚŚĞŝƚLJ͕ďƵƚĂƌĞƌŽůĞƐ ĚĞĨŝŶĞĚǁŝƚŚŝŶƚŚĞWƌŽũĞĐƚ͘/ƚŝƐĐŽŵŵŽŶĨŽƌŝŶĚŝǀŝĚƵĂůƌĞƐŽƵƌĐĞƐŽŶďŽƚŚƚŚĞdLJůĞƌĂŶĚĐůŝĞŶƚƉƌŽũĞĐƚƚĞĂŵƐƚŽ ĨŝůůŵƵůƚŝƉůĞƌŽůĞƐ͘^ŝŵŝůĂƌůLJ͕ŝƚŝƐĐŽŵŵŽŶĨŽƌƐŽŵĞƌŽůĞƐƚŽďĞĨŝůůĞĚďLJŵƵůƚŝƉůĞƉĞŽƉůĞ͘ dLJůĞƌZŽůĞƐΘZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ dLJůĞƌĂƐƐŝŐŶƐƉƌŽũĞĐƚŵĂŶĂŐĞƌƐƉƌŝŽƌƚŽƚŚĞƐƚĂƌƚŽĨĞĂĐŚƉŚĂƐĞŽĨƚŚĞƉƌŽũĞĐƚ͘dŚĞƉƌŽũĞĐƚŵĂŶĂŐĞƌĂƐƐŝŐŶƐ ŽƚŚĞƌdLJůĞƌƌĞƐŽƵƌĐĞƐĂƐƚŚĞƐĐŚĞĚƵůĞĚĞǀĞůŽƉƐ͘KŶĞƉĞƌƐŽŶŵĂLJĨŝůůŵƵůƚŝƉůĞƉƌŽũĞĐƚƌŽůĞƐ͘ dLJůĞƌdžĞĐƵƚŝǀĞ^ƉŽŶƐŽƌ dLJůĞƌĞdžĞĐƵƚŝǀĞŵĂŶĂŐĞŵĞŶƚŚĂƐŝŶĚŝƌĞĐƚŝŶǀŽůǀĞŵĞŶƚǁŝƚŚƚŚĞƉƌŽũĞĐƚĂŶĚŝƐƉĂƌƚŽĨƚŚĞdLJůĞƌĞƐĐĂůĂƚŝŽŶ ƉƌŽĐĞƐƐ͕ŚĞůƉŝŶŐƚŽĨĂĐŝůŝƚĂƚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽũĞĐƚƚĂƐŬƐĂŶĚĚĞĐŝƐŝŽŶƐŝĨŶĞĞĚĞĚ͘ dLJůĞƌ/ŵƉůĞŵĞŶƚĂƚŝŽŶDĂŶĂŐĞƌ dLJůĞƌŝŵƉůĞŵĞŶƚĂƚŝŽŶŵĂŶĂŐĞŵĞŶƚŝƐĐŽŶƐƵůƚĞĚŽŶŝƐƐƵĞƐĂŶĚŽƵƚƐƚĂŶĚŝŶŐĚĞĐŝƐŝŽŶƐĐƌŝƚŝĐĂůƚŽƚŚĞƉƌŽũĞĐƚ ŽŶůLJŝĨŶĞĞĚĞĚ͘ dLJůĞƌWƌŽũĞĐƚDĂŶĂŐĞƌ dŚĞdLJůĞƌƉƌŽũĞĐƚŵĂŶĂŐĞƌ;ƐͿƉƌŽǀŝĚĞƐŽǀĞƌƐŝŐŚƚŽĨƚŚĞƉƌŽũĞĐƚ͕ĐŽŽƌĚŝŶĂƚŝŽŶŽĨdLJůĞƌƌĞƐŽƵƌĐĞƐďĞƚǁĞĞŶ ĚĞƉĂƌƚŵĞŶƚƐ͕ŵĂŶĂŐĞŵĞŶƚŽĨƚŚĞƉƌŽũĞĐƚďƵĚŐĞƚĂŶĚƐĐŚĞĚƵůĞ͕ĞĨĨĞĐƚŝǀĞƌŝƐŬ͕ĂŶĚŝƐƐƵĞŵĂŶĂŐĞŵĞŶƚ͕ĂŶĚŝƐ ƚŚĞƉƌŝŵĂƌLJƉŽŝŶƚŽĨĐŽŶƚĂĐƚĨŽƌĂůůWƌŽũĞĐƚƌĞůĂƚĞĚŝƚĞŵƐ͘ƐƌĞƋƵĞƐƚĞĚďLJƚŚĞŝƚLJ͕ƚŚĞdLJůĞƌWƌŽũĞĐƚDĂŶĂŐĞƌ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϬ ƉƌŽǀŝĚĞƐƌĞŐƵůĂƌƵƉĚĂƚĞƐƚŽƚŚĞŝƚLJ^ƚĞĞƌŝŶŐŽŵŵŝƚƚĞĞĂŶĚŽƚŚĞƌdLJůĞƌŐŽǀĞƌŶĂŶĐĞŵĞŵďĞƌƐ͘dLJůĞƌWƌŽũĞĐƚ DĂŶĂŐĞƌ͛ƐƌŽůĞŝŶĐůƵĚĞƐƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐŝŶĐŽŶƚƌĂĐƚ͕ŝŵƉůĞŵĞŶƚĂƚŝŽŶ͕ĂŶĚƌĞƐŽƵƌĐĞŵĂŶĂŐĞŵĞŶƚĂŶĚ ƉůĂŶŶŝŶŐ͘ dLJůĞƌ/ŵƉůĞŵĞŶƚĂƚŝŽŶŽŶƐƵůƚĂŶƚ ŽĐƵŵĞŶƚĂĐƚŝǀŝƚŝĞƐĨŽƌƐĞƌǀŝĐĞƐƉĞƌĨŽƌŵĞĚďLJdLJůĞƌ͘dŚĞLJŚĞůƉŐƵŝĚĞƚŚĞŝƚLJƚŚƌŽƵŐŚƐŽĨƚǁĂƌĞǀĂůŝĚĂƚŝŽŶ ƉƌŽĐĞƐƐĨŽůůŽǁŝŶŐĐŽŶĨŝŐƵƌĂƚŝŽŶĂŶĚĨĂĐŝůŝƚĂƚĞƚƌĂŝŶŝŶŐƐĞƐƐŝŽŶƐ͘/ƐĂůƐŽĂƐƐŝƐƚĚƵƌŝŶŐŐŽůŝǀĞƉƌŽĐĞƐƐŝŶŐ͘ dLJůĞƌ^ĂůĞƐ ^ƵƉƉŽƌƚƐ^ĂůĞƐƚŽ/ŵƉůĞŵĞŶƚĂƚŝŽŶŬŶŽǁůĞĚŐĞƚƌĂŶƐĨĞƌĚƵƌŝŶŐƐƚĂŐĞϭͲŝŶŝƚŝĂƚĞĂŶĚƉůĂŶͲĂŶĚƉƌŽǀŝĚĞƐ ŚŝƐƚŽƌŝĐĂůŝŶĨŽƌŵĂƚŝŽŶ͕ĂƐŶĞĞĚĞĚ͕ƚŚƌŽƵŐŚŽƵƚŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘ dLJůĞƌdĞĐŚŶŝĐĂů^ĞƌǀŝĐĞƐ DĂŝŶƚĂŝŶƐdLJůĞƌŝŶĨƌĂƐƚƌƵĐƚƵƌĞƌĞƋƵŝƌĞŵĞŶƚƐĂŶĚĚĞƐŝŐŶĚŽĐƵŵĞŶƚ;ƐͿĂŶĚĂƌĞŝŶǀŽůǀĞĚŝŶƐLJƐƚĞŵ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞƉůĂŶŶŝŶŐͬƌĞǀŝĞǁ;ƐͿ͘dŚĞLJĚĞƉůŽLJdLJůĞƌƉƌŽĚƵĐƚƐ͘ ŝƚLJZŽůĞƐΘZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ ůŝĞŶƚƌĞƐŽƵƌĐĞƐǁŝůůďĞĂƐƐŝŐŶĞĚƉƌŝŽƌƚŽƚŚĞƐƚĂƌƚŽĨĞĂĐŚƉŚĂƐĞŽĨƚŚĞƉƌŽũĞĐƚ͘KŶĞƉĞƌƐŽŶŵĂLJďĞĂƐƐŝŐŶĞĚ ƚŽŵƵůƚŝƉůĞƉƌŽũĞĐƚƌŽůĞƐ͘ ŝƚLJdžĞĐƵƚŝǀĞ^ƉŽŶƐŽƌ dŚĞŝƚLJĞdžĞĐƵƚŝǀĞƐƉŽŶƐŽƌƉƌŽǀŝĚĞƐƐƵƉƉŽƌƚƚŽƚŚĞƉƌŽũĞĐƚďLJƉƌŽǀŝĚŝŶŐƐƚƌĂƚĞŐŝĐĚŝƌĞĐƚŝŽŶĂŶĚ ĐŽŵŵƵŶŝĐĂƚŝŶŐŬĞLJŝƐƐƵĞƐĂďŽƵƚƚŚĞƉƌŽũĞĐƚĂŶĚŝƚƐŽǀĞƌĂůůŝŵƉŽƌƚĂŶĐĞƚŽƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶ͘tŚĞŶĐĂůůĞĚ ƵƉŽŶ͕ƚŚĞĞdžĞĐƵƚŝǀĞƐƉŽŶƐŽƌĂůƐŽĂĐƚƐĂƐƚŚĞĨŝŶĂůĂƵƚŚŽƌŝƚLJŽŶĂůůĞƐĐĂůĂƚĞĚƉƌŽũĞĐƚŝƐƐƵĞƐ͘dŚĞĞdžĞĐƵƚŝǀĞ ƐƉŽŶƐŽƌĞŶŐĂŐĞƐŝŶƚŚĞWƌŽũĞĐƚ͕ĂƐŶĞĞĚĞĚ͕ŝŶŽƌĚĞƌƚŽƉƌŽǀŝĚĞŶĞĐĞƐƐĂƌLJƐƵƉƉŽƌƚ͕ŽǀĞƌƐŝŐŚƚ͕ŐƵŝĚĂŶĐĞ͕ĂŶĚ ĞƐĐĂůĂƚŝŽŶ͕ďƵƚĚŽĞƐŶŽƚƉĂƌƚŝĐŝƉĂƚĞŝŶĚĂLJͲƚŽͲĚĂLJWƌŽũĞĐƚĂĐƚŝǀŝƚŝĞƐ͘dŚĞĞdžĞĐƵƚŝǀĞƐƉŽŶƐŽƌĞŵƉŽǁĞƌƐƚŚĞŝƚLJ ƐƚĞĞƌŝŶŐĐŽŵŵŝƚƚĞĞ͕ƉƌŽũĞĐƚŵĂŶĂŐĞƌ;ƐͿ͕ĂŶĚĨƵŶĐƚŝŽŶĂůůĞĂĚƐƚŽŵĂŬĞĐƌŝƚŝĐĂůďƵƐŝŶĞƐƐĚĞĐŝƐŝŽŶƐĨŽƌƚŚĞŝƚLJ͘ ŝƚLJ^ƚĞĞƌŝŶŐŽŵŵŝƚƚĞĞ dŚĞŝƚLJƐƚĞĞƌŝŶŐĐŽŵŵŝƚƚĞĞƵŶĚĞƌƐƚĂŶĚƐĂŶĚƐƵƉƉŽƌƚƐƚŚĞĐƵůƚƵƌĂůĐŚĂŶŐĞŶĞĐĞƐƐĂƌLJĨŽƌƚŚĞƉƌŽũĞĐƚĂŶĚ ĨŽƐƚĞƌƐĂŶĂƉƉƌĞĐŝĂƚŝŽŶĨŽƌƚŚĞƉƌŽũĞĐƚ͛ƐǀĂůƵĞƚŚƌŽƵŐŚŽƵƚƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶ͘dŚĞƐƚĞĞƌŝŶŐĐŽŵŵŝƚƚĞĞŽǀĞƌƐĞĞƐ ƚŚĞŝƚLJƉƌŽũĞĐƚŵĂŶĂŐĞƌĂŶĚƉƌŽũĞĐƚĂƐĂǁŚŽůĞƚŚƌŽƵŐŚƉĂƌƚŝĐŝƉĂƚŝŽŶŝŶƌĞŐƵůĂƌŝŶƚĞƌŶĂůŵĞĞƚŝŶŐƐ͘dŚĞŝƚLJ ƐƚĞĞƌŝŶŐĐŽŵŵŝƚƚĞĞĂůƐŽƐĞƌǀĞƐĂƐƉƌŝŵĂƌLJůĞǀĞůŽĨŝƐƐƵĞƌĞƐŽůƵƚŝŽŶĨŽƌƚŚĞƉƌŽũĞĐƚ͘ ŝƚLJWƌŽũĞĐƚDĂŶĂŐĞƌ;WDͿ dŚĞŝƚLJƐŚĂůůĂƐƐŝŐŶWD;ƐͿƉƌŝŽƌƚŽƚŚĞƐƚĂƌƚŽĨƚŚŝƐƉƌŽũĞĐƚǁŝƚŚŽǀĞƌĂůůƌĞƐƉŽŶƐŝďŝůŝƚLJĂŶĚĂƵƚŚŽƌŝƚLJƚŽŵĂŬĞ ĚĞĐŝƐŝŽŶƐƌĞůĂƚĞĚƚŽƉƌŽũĞĐƚƐĐŽƉĞ͕ƐĐŚĞĚƵůŝŶŐ͕ĂŶĚƚĂƐŬĂƐƐŝŐŶŵĞŶƚ͘dŚĞŝƚLJWDƐŚŽƵůĚĐŽŵŵƵŶŝĐĂƚĞ ĚĞĐŝƐŝŽŶƐĂŶĚĐŽŵŵŝƚŵĞŶƚƐƚŽƚŚĞdLJůĞƌWD;ƐͿŝŶĂƚŝŵĞůLJĂŶĚĞĨĨŝĐŝĞŶƚŵĂŶŶĞƌ͘tŚĞŶdŚĞŝƚLJƉƌŽũĞĐƚ ŵĂŶĂŐĞƌ;ƐͿĚŽŶŽƚŚĂǀĞƚŚĞŬŶŽǁůĞĚŐĞŽƌĂƵƚŚŽƌŝƚLJƚŽŵĂŬĞĚĞĐŝƐŝŽŶƐ͕ƚŚĞŶĞĐĞƐƐĂƌLJƌĞƐŽƵƌĐĞƐĂƌĞĞŶŐĂŐĞĚ ƚŽƉĂƌƚŝĐŝƉĂƚĞŝŶĚŝƐĐƵƐƐŝŽŶƐĂŶĚŵĂŬĞĚĞĐŝƐŝŽŶƐŝŶĂƚŝŵĞůLJĨĂƐŚŝŽŶƚŽĂǀŽŝĚƉƌŽũĞĐƚĚĞůĂLJƐ͘dŚĞŝƚLJWD;ƐͿĂƌĞ ƌĞƐƉŽŶƐŝďůĞĨŽƌƌĞƉŽƌƚŝŶŐƚŽĐůŝĞŶƚƐƚĞĞƌŝŶŐĐŽŵŵŝƚƚĞĞĂŶĚĚĞƚĞƌŵŝŶŝŶŐĂƉƉƌŽƉƌŝĂƚĞĞƐĐĂůĂƚŝŽŶƉŽŝŶƚƐ͘ dŚĞŝƚLJWDĂĐƚƐĂƐƉƌŝŵĂƌLJƉŽŝŶƚŽĨĐŽŶƚĂĐƚĨŽƌĂůůĐŽŶƚƌĂĐƚĂŶĚŝŶǀŽŝĐŝŶŐƋƵĞƐƚŝŽŶƐ͖ĂŶĚĐŽůůĂďŽƌĂƚĞƐŽŶĂŶĚ ĂƉƉƌŽǀĞƐĐŚĂŶŐĞƌĞƋƵĞƐƚƐ͕ŝĨŶĞĞĚĞĚ͕ƚŽĞŶƐƵƌĞƉƌŽƉĞƌƐĐŽƉĞĂŶĚďƵĚŐĞƚĂƌLJĐŽŵƉůŝĂŶĐĞ͘dŚĞŝƚLJWDĂůƐŽ ŚĂŶĚůĞƐĂůůƐŝƚĞƌĞƐŽƵƌĐĞŵĂŶĂŐĞŵĞŶƚŝƚĞŵƐ͘dŚĞŝƚLJWDĐŽůůĂďŽƌĂƚĞƐǁŝƚŚdLJůĞƌWD;ƐͿƚŽƉůĂŶĂŶĚͬŽƌ ĞƐƚĂďůŝƐŚ͗ xƉƌŽũĞĐƚƚŝŵĞůŝŶĞƐƚŽĂĐŚŝĞǀĞŽŶͲƚŝŵĞŝŵƉůĞŵĞŶƚĂƚŝŽŶ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϭ xƉƌŽĐĞƐƐĂŶĚĂƉƉƌŽǀĂůŵĂƚƌŝdžƚŽĞŶƐƵƌĞƚŚĂƚƐĐŽƉĞĐŚĂŶŐĞƐĂŶĚďƵĚŐĞƚĂƌĞƚƌĂŶƐƉĂƌĞŶƚĂŶĚ ŚĂŶĚůĞĚĞĨĨĞĐƚŝǀĞůLJĂŶĚĞĨĨŝĐŝĞŶƚůLJ ƌŝƐŬĂŶĚŝƐƐƵĞƚƌĂĐŬŝŶŐĂŶĚƌĞƉŽƌƚŝŶŐƉƌŽĐĞƐƐďĞƚǁĞĞŶƚŚĞŝƚLJĂŶĚdLJůĞƌĂŶĚƚĂŬĞƐĂůů ŶĞĐĞƐƐĂƌLJƐƚĞƉƐƚŽƉƌŽĂĐƚŝǀĞůLJŵŝƚŝŐĂƚĞƚŚĞƐĞŝƚĞŵƐ ŬĞLJďƵƐŝŶĞƐƐĚƌŝǀĞƌƐĂŶĚƐƵĐĐĞƐƐŝŶĚŝĐĂƚŽƌƐƚŚĂƚǁŝůůŚĞůƉƚŽŐŽǀĞƌŶƉƌŽũĞĐƚĂĐƚŝǀŝƚŝĞƐĂŶĚŬĞLJ ĚĞĐŝƐŝŽŶƐ ĐŽŵŵƵŶŝĐĂƚŝŽŶĐŚĂŶŶĞůƐĂƚĐůŝĞŶƚƐŝƚĞƚŽĂŝĚŝŶƚŚĞƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨŐŽĂůƐ͕ŽďũĞĐƚŝǀĞƐ͕ĐƵƌƌĞŶƚ ƐƚĂƚƵƐ͕ĂŶĚŚĞĂůƚŚŽĨƚŚĞƉƌŽũĞĐƚďLJĂůůƚĞĂŵŵĞŵďĞƌƐ ƌĞƋƵŝƌĞŵĞŶƚƐŐĂƚŚĞƌŝŶŐƉƌŽĐĞƐƐ ŝƚLJ&ƵŶĐƚŝŽŶĂů>ĞĂĚƐ dŚĞŝƚLJĨƵŶĐƚŝŽŶĂůůĞĂĚƐŵĂŬĞďƵƐŝŶĞƐƐƉƌŽĐĞƐƐĐŚĂŶŐĞĚĞĐŝƐŝŽŶƐ͕ĐŽŵŵƵŶŝĐĂƚĞĐƵƌƌĞŶƚƉƌŽĐĞƐƐĞƐĂŶĚ ƉƌŽĐĞĚƵƌĞƐĂŶĚĚĞƐŝƌĞĚĐŚĂŶŐĞƐĚƵƌŝŶŐĐƵƌƌĞŶƚĂŶĚĨƵƚƵƌĞƐƚĂƚĞĂŶĂůLJƐŝƐ͘DŽƐƚŝŵƉŽƌƚĂŶƚůLJ͕ĨƵŶĐƚŝŽŶĂůůĞĂĚƐ ĂĐƚĂƐĂŶĂŵďĂƐƐĂĚŽƌͬĐŚĂŵƉŝŽŶŽĨĐŚĂŶŐĞĨŽƌƚŚĞŶĞǁƉƌŽĐĞƐƐĂŶĚƉƌŽǀŝĚĞďƵƐŝŶĞƐƐƉƌŽĐĞƐƐĐŚĂŶŐĞƐƵƉƉŽƌƚ͘ &ŝŶĂůůLJ͕ƚŚĞLJĂĐƚŝǀĞůLJƉĂƌƚŝĐŝƉĂƚĞŝŶĂůůĂƐƉĞĐƚƐŽĨƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘ ŝƚLJWŽǁĞƌhƐĞƌƐ dŚĞŝƚLJƉŽǁĞƌƵƐĞƌƐƉĂƌƚŝĐŝƉĂƚĞŝŶƉƌŽũĞĐƚĂĐƚŝǀŝƚŝĞƐĂƐƌĞƋƵŝƌĞĚďLJƚŚĞƉƌŽũĞĐƚƚĞĂŵĂŶĚƉŵ;ƐͿ͘dŚĞLJĂĐƚĂƐ ^DƐ͕ĂƐŶĞĞĚĞĚ͕ĂƚƚĞŶĚĂůůƐĐŚĞĚƵůĞĚƚƌĂŝŶŝŶŐƐĞƐƐŝŽŶƐ͕ǀĂůŝĚĂƚĞĂůůĐŽŶĨŝŐƵƌĂƚŝŽŶ͕ĂŶĚƉƌŽǀŝĚĞŬŶŽǁůĞĚŐĞ ƚƌĂŶƐĨĞƌƚŽĐůŝĞŶƚƐƚĂĨĨĚƵƌŝŶŐĂŶĚĂĨƚĞƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘ ŝƚLJŶĚhƐĞƌƐ ůŝĞŶƚĞŶĚƵƐĞƌƐĂůůƐĐŚĞĚƵůĞĚƚƌĂŝŶŝŶŐƐĞƐƐŝŽŶƐĂŶĚďĞĐŽŵĞƉƌŽĨŝĐŝĞŶƚŝŶĂƉƉůŝĐĂƚŝŽŶĨƵŶĐƚŝŽŶƐƌĞůĂƚĞĚƚŽũŽď ĚƵƚŝĞƐ͘dŚĞLJĂĚŽƉƚĂŶĚƵƚŝůŝnjĞĐŚĂŶŐĞĚƉƌŽĐĞĚƵƌĞƐƌĞůĂƚĞĚƚŽƚŚĞŝƌũŽďĨƵŶĐƚŝŽŶƐ͘ ŝƚLJdĞĐŚŶŝĐĂů>ĞĂĚ dŚĞŝƚLJƚĞĐŚŶŝĐĂůůĞĂĚ;ƐͿĐŽŽƌĚŝŶĂƚĞƵƉĚĂƚĞƐĂŶĚƌĞůĞĂƐĞƐ͕ĐŽƉLJŝŶŐŽĨƐŽƵƌĐĞĚĂƚĂďĂƐĞƐƚŽƚƌĂŝŶŝŶŐͬƚĞƐƚŝŶŐ ĚĂƚĂďĂƐĞƐ͕ĂĚĚƐŶĞǁƵƐĞƌƐͬƉƌŝŶƚĞƌƐĞƚĐ͕͘ĂƐǁĞůůĂƐŝŶƚĞƌĨĂĐĞĚĞǀĞůŽƉŵĞŶƚĨŽƌƚŚŝƌĚƉĂƌƚLJŝŶƚĞƌĨĂĐĞƐ͘dŚĞLJ ǀĂůŝĚĂƚĞƚŚĂƚĂůůƵƐĞƌƐƵŶĚĞƌƐƚĂŶĚůŽŐͲŽŶƉƌŽĐĞƐƐĂŶĚŚĂǀĞŶĞĐĞƐƐĂƌLJƉĞƌŵŝƐƐŝŽŶĨŽƌĂůůƚƌĂŝŶŝŶŐƐĞƐƐŝŽŶƐĂŶĚ ĚĞǀĞůŽƉͬĂƐƐŝƐƚŝŶĐƌĞĂƚŝŶŐƌĞƉŽƌƚƐĂƐŶĞĞĚĞĚ͘dŚĞLJŵĂLJĂůƐŽďĞƌĞƐƉŽŶƐŝďůĞĨŽƌ ĞdžƚƌĂĐƚŝŶŐĂŶĚƐƵďŵŝƚƚŝŶŐĐŽŶǀĞƌƐŝŽŶĚĂƚĂĂŶĚĐŽŶƚƌŽůƌĞƉŽƌƚƐĨƌŽŵƚŚĞŝƚLJ͛ƐůĞŐĂĐLJƐLJƐƚĞŵƉĞƌƚŚĞ ĐŽŶǀĞƌƐŝŽŶƐĐŚĞĚƵůĞƐĞƚĨŽƌƚŚŝŶƚŚĞƉƌŽũĞĐƚƐĐŚĞĚƵůĞ͘ ŝƚLJhƉŐƌĂĚĞŽŽƌĚŝŶĂƚŝŽŶ dŚĞŝƚLJƵƉŐƌĂĚĞĐŽŽƌĚŝŶĂƚŽƌƵƚŝůŝnjĞƐdLJůĞƌŽŵŵƵŶŝƚLJƚŽƐƚĂLJĂďƌĞĂƐƚŽĨƚŚĞůĂƚĞƐƚdLJůĞƌƌĞůĞĂƐĞƐĂŶĚ ƵƉĚĂƚĞƐ͕ĂƐǁĞůůĂƐƚŚĞůĂƚĞƐƚŚĞůƉĨƵůƚŽŽůƐƚŽŵĂŶĂŐĞƚŚĞŝƚLJ͛ƐƐŽĨƚǁĂƌĞƵƉŐƌĂĚĞƉƌŽĐĞƐƐ͘dŚĞLJŵĂŶĂŐĞ ƐŽĨƚǁĂƌĞƵƉŐƌĂĚĞĂĐƚŝǀŝƚŝĞƐƉŽƐƚͲŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘ ŝƚLJŚĂŶŐĞDĂŶĂŐĞŵĞŶƚ>ĞĂĚ dŚĞŝƚLJĐŚĂŶŐĞŵĂŶĂŐĞŵĞŶƚůĞĂĚǀĂůŝĚĂƚĞƐƚŚĂƚƵƐĞƌƐƌĞĐĞŝǀĞƚŝŵĞůLJĂŶĚƚŚŽƌŽƵŐŚĐŽŵŵƵŶŝĐĂƚŝŽŶƌĞŐĂƌĚŝŶŐ ƉƌŽĐĞƐƐĐŚĂŶŐĞƐĂŶĚƉƌŽǀŝĚĞƐĐŽĂĐŚŝŶŐƚŽƐƵƉĞƌǀŝƐŽƌƐƚŽƉƌĞƉĂƌĞƚŚĞŵƚŽƐƵƉƉŽƌƚƵƐĞƌƐƚŚƌŽƵŐŚƚŚĞƉƌŽũĞĐƚ ĐŚĂŶŐĞƐ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϮ ([SODLQSURSRVHGSURMHFWPDQDJHPHQWVHUYLFHVLQFOXGLQJ x5ROHRIWKHYHQGRUSURMHFWPDQDJHU x8VHRISURMHFWFROODERUDWLRQVLWH x([SHFWHGUROHRIWKH*RYHUQPHQWSURMHFWPDQDJHU x2Q6LWHSUHVHQFHRIYHQGRUSURMHFWPDQDJHU x3URSRVHGTXDOLW\DVVXUDQFHSURFHGXUHV WƌŽũĞĐƚDĂŶĂŐĞŵĞŶƚ KƵƌĂƉƉƌŽĂĐŚƚŽƉƌŽũĞĐƚŐŽǀĞƌŶĂŶĐĞŚĂƐďĞĞŶĐŽŶƚŝŶƵŽƵƐůLJŝŵƉƌŽǀĞĚĚƵƌŝŶŐdLJůĞƌ͛ƐŵŽƌĞƚŚĂŶϯϱLJĞĂƌƐŽĨ ĞdžƉĞƌŝĞŶĐĞŝŵƉůĞŵĞŶƚŝŶŐƐŽĨƚǁĂƌĞĞdžĐůƵƐŝǀĞůLJǁŝƚŚƉƵďůŝĐƐĞĐƚŽƌĐůŝĞŶƚƐ͘EŽŽŶĞŬŶŽǁƐƚŚĞƐLJƐƚĞŵďĞƚƚĞƌ ƚŚĂŶdLJůĞƌƐƚĂĨĨ͘dŚĂƚ͛ƐĞdžĂĐƚůLJǁŚLJǁĞĚŽŶ͛ƚĐŽŶƚƌĂĐƚƚŚŝƌĚƉĂƌƚŝĞƐƚŽĚŽŽƵƌŝŵƉůĞŵĞŶƚĂƚŝŽŶĨŽƌƵƐ͘tĞĚŽŝƚ ďĞƐƚ͘WƌŽũĞĐƚŵĂŶĂŐĞƌƐǁŝůůďĞĂƐƐŝŐŶĞĚƚŽĞĂĐŚƉŚĂƐĞŽĨLJŽƵƌƉƌŽũĞĐƚŝŶŽƌĚĞƌƚŽƐƚĂĨĨƚŚĞƉƌŽũĞĐƚǁŝƚŚƐƵďũĞĐƚ ŵĂƚƚĞƌĞdžƉĞƌƚƐĚƵƌŝŶŐĞĂĐŚƉĂƌƚŽĨƚŚĞƉƌŽũĞĐƚ͘KƵƌƐƚĂĨĨĐŽŶƐŝƐƚƐŽĨƐĞĂƐŽŶĞĚƉƌŽĨĞƐƐŝŽŶĂůƐǁŝƚŚƵŶŝƋƵĞĂŶĚ ƉƌŽƉƌŝĞƚĂƌLJƐŬŝůůƐĂŶĚLJĞĂƌƐŽĨĞdžƉĞƌŝĞŶĐĞ͕ĨŽĐƵƐĞĚŝŶƚŽĚĞĚŝĐĂƚĞĚĚĞƉĂƌƚŵĞŶƚƐ͘ WƌŽũĞĐƚŽŵŵƵŶŝĐĂƚŝŽŶ dLJůĞƌƵŶĚĞƌƐƚĂŶĚƐƚŚĞŝŵƉŽƌƚĂŶĐĞŽĨŚĂǀŝŶŐĐƵƌƌĞŶƚ͕ĂĐĐƵƌĂƚĞ͕ĞĂƐŝůLJĂĐĐĞƐƐŝďůĞĚƵƌŝŶŐĂŶ/ŵƉůĞŵĞŶƚĂƚŝŽŶ WƌŽũĞĐƚ͘ƐƉĂƌƚŽĨ/ŵƉůĞŵĞŶƚĂƚŝŽŶ͕ĞĂĐŚŶĞǁdLJůĞƌĐůŝĞŶƚǁŝůůďĞƉƌŽǀŝĚĞĚĂƉƌŽũĞĐƚƉŽƌƚĂů͘dŚĞƉƵƌƉŽƐĞŽĨƚŚŝƐ ƐŝƚĞŝƐƚŽĨƵƌŶŝƐŚƚŚĞƉƌŽũĞĐƚƚĞĂŵƐǁŝƚŚĂĐĞŶƚƌĂůůŽĐĂƚŝŽŶƚŽƉůĂŶ͕ƐƚŽƌĞĂŶĚĂĐĐĞƐƐƉĞƌƚŝŶĞŶƚĚŽĐƵŵĞŶƚĂƚŝŽŶ ĂŶĚŝŶĨŽƌŵĂƚŝŽŶƌĞůĂƚŝŶŐƚŽLJŽƵƌ/ŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽũĞĐƚ͘ dŚŝƐƐŝƚĞǁŝůůďĞũŽŝŶƚůLJŵĂŝŶƚĂŝŶĞĚďLJƚŚĞƉƌŽũĞĐƚƚĞĂŵƐĨŽƌƚŚĞĚƵƌĂƚŝŽŶŽĨƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘KŶĐĞƚŚĞ ĐůŝĞŶƚŚĂƐŐŽŶĞůŝǀĞ͕ƚŚĞƉŽƌƚĂůǁŝůůďĞŵĂŝŶƚĂŝŶĞĚďLJdLJůĞƌ͛ƐĐůŝĞŶƚƐĞƌǀŝĐĞƐƚĞĂŵĨŽƌƚŚĞĨŝƌƐƚLJĞĂƌŽĨůŝǀĞ ƉƌŽĐĞƐƐŝŶŐ͘ DĂŶĂŐĞŵĞŶƚĂŶĚ^ĐŽƉĞ dŚĞdLJůĞƌƉƌŽũĞĐƚŵĂŶĂŐĞƌĂŶĚŝŵƉůĞŵĞŶƚĂƚŝŽŶƚĞĂŵƐǁŝůůĐŽŵŵƵŶŝĐĂƚĞƌĞŐƵůĂƌůLJǁŝƚŚLJŽƵƌƉƌŽũĞĐƚƚĞĂŵ͘ůů ŝŵƉůĞŵĞŶƚĂƚŝŽŶĚĞůŝǀĞƌĂďůĞƐŐĞŶĞƌĂƚĞƌĞƉŽƌƚƐǁŚŝĐŚĐŽŶƚĂŝŶĚĞƚĂŝůĞĚĂƐƐĞƐƐŵĞŶƚƐŽĨƚĂƐŬĐŽŵƉůĞƚŝŽŶ͕ƐƚĂĨĨ ƉĂƌƚŝĐŝƉĂƚŝŽŶĂŶĚŵĂƚĞƌŝĂůĂďƐŽƌƉƚŝŽŶ͘dŚĞdLJůĞƌƉƌŽũĞĐƚŵĂŶĂŐĞƌ;ƐͿǁŝůůĞǀĂůƵĂƚĞĂŶĚŵĞĂƐƵƌĞƚŚĞƌĞƉŽƌƚ ƌĞƐƵůƚƐ͕ĐŽŵŵƵŶŝĐĂƚŝŶŐƚŚĞŐĂƉƐĂŶĚĂĚũƵƐƚŝŶŐƚŚĞƉůĂŶĂĐĐŽƌĚŝŶŐůLJ͘^ŚŽƵůĚŝƐƐƵĞƐĂƌŝƐĞĚƵƌŝŶŐƚŚĞƉƌŽũĞĐƚ͕ ƚŚĞƌĞĂƌĞƐĞǀĞƌĂůĞƐĐĂůĂƚŝŽŶƉĂƚŚƐƚŚĂƚĐĂŶďĞƵƐĞĚůĂŝĚŽƵƚŝŶƚŚĞĐŽŵŵƵŶŝĐĂƚŝŽŶƉůĂŶ͘ WƌŽũĞĐƚKƌŐĂŶŝnjĂƚŝŽŶĂůŚĂƌƚ ǀĞƌLJŝŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽũĞĐƚŝƐĐŽŵƉƌŝƐĞĚŽĨďŽƚŚĐůŝĞŶƚƌĞƐŽƵƌĐĞƐĂŶĚdLJůĞƌƌĞƐŽƵƌĐĞƐǁŽƌŬŝŶŐƚŽŐĞƚŚĞƌĂƚ ǀĂƌLJŝŶŐůĞǀĞůƐŽĨŝŶǀŽůǀĞŵĞŶƚƚŽĞŶƐƵƌĞĂƐƵĐĐĞƐƐĨƵůŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dŚĞĐŚĂƌƚďĞůŽǁŽƵƚůŝŶĞƐĞĂĐŚŽĨƚŚŽƐĞ ƌĞƐŽƵƌĐĞŐƌŽƵƉƐ͘WůĞĂƐĞŬĞĞƉŝŶŵŝŶĚƚŚĂƚƐŽŵĞƌĞƐŽƵƌĐĞƐŝŶLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶƐŵĂLJĨĂůůŝŶƚŽŵƵůƚŝƉůĞŐƌŽƵƉƐ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϯ WƌŽũĞĐƚ'ŽǀĞƌŶĂŶĐĞ ŽŵŵƵŶŝĐĂƚŝŽŶĂŶĚƚƌĂŶƐƉĂƌĞŶĐLJĂƌĞĞƐƐĞŶƚŝĂůƚŽĂŶLJƐƵĐĐĞƐƐĨƵůŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dLJůĞƌĂŶĚŝƚLJƌĞƐŽƵƌĐĞƐ ĐŽůůĂďŽƌĂƚĞƚŽĚĞƚĞƌŵŝŶĞĐŽƌĞďƵƐŝŶĞƐƐŶĞĞĚƐ͕ŽďũĞĐƚŝǀĞƐĂŶĚƉƌŝŽƌŝƚŝĞƐ͘WƌŽũĞĐƚƚĞĂŵƐǁŽƌŬƚŽŐĞƚŚĞƌƚŽ ŶĂǀŝŐĂƚĞĐŚĂůůĞŶŐĞƐĂƐƚŚĞLJĂƌŝƐĞĂĐĐŽƌĚŝŶŐƚŽƚŚĞĞƐĐĂůĂƚŝŽŶƉĂƚŚƐŽƵƚůŝŶĞĚŝŶƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶĐŚĂƌƚƐ͘ dŚĞĐŚĂƌƚďĞůŽǁŝůůƵƐƚƌĂƚĞƐĂŶŽǀĞƌĂůůƚĞĂŵƉĞƌƐƉĞĐƚŝǀĞǁŚĞƌĞdLJůĞƌĂŶĚŝƚLJĐŽůůĂďŽƌĂƚĞƚŽƌĞƐŽůǀĞƉƌŽũĞĐƚ ĐŚĂůůĞŶŐĞƐĂĐĐŽƌĚŝŶŐƚŽĚĞĨŝŶĞĚĞƐĐĂůĂƚŝŽŶƉĂƚŚƐ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚƉƌŽũĞĐƚŵĂŶĂŐĞƌƐĚŽŶŽƚƉŽƐƐĞƐƐĂƵƚŚŽƌŝƚLJ ƚŽĚĞƚĞƌŵŝŶĞĂƐŽůƵƚŝŽŶ͕ƌĞƐŽůǀĞĂŶŝƐƐƵĞ͕ŽƌŵŝƚŝŐĂƚĞĂƌŝƐŬ͕dLJůĞƌŝŵƉůĞŵĞŶƚĂƚŝŽŶŵĂŶĂŐĞŵĞŶƚĂŶĚŝƚLJ ƐƚĞĞƌŝŶŐĐŽŵŵŝƚƚĞĞďĞĐŽŵĞƚŚĞĞƐĐĂůĂƚŝŽŶƉŽŝŶƚƐƚŽƚƌŝĂŐĞƌĞƐƉŽŶƐĞƐƉƌŝŽƌƚŽĞƐĐĂůĂƚŝŽŶƚŽŝƚLJĂŶĚdLJůĞƌ ĞdžĞĐƵƚŝǀĞƐƉŽŶƐŽƌƐ͘ƐƉĂƌƚŽĨƚŚĞĞƐĐĂůĂƚŝŽŶƉƌŽĐĞƐƐ͕ĞĂĐŚƉƌŽũĞĐƚŐŽǀĞƌŶĂŶĐĞƚŝĞƌƉƌĞƐĞŶƚƐ ƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐĂŶĚƐƵƉƉŽƌƚŝŶŐŝŶĨŽƌŵĂƚŝŽŶƚŽĨĂĐŝůŝƚĂƚĞŬŶŽǁůĞĚŐĞƚƌĂŶƐĨĞƌĂŶĚŝƐƐƵĞƌĞƐŽůƵƚŝŽŶ͘ŝƚLJĂŶĚ dLJůĞƌĞdžĞĐƵƚŝǀĞƐƉŽŶƐŽƌƐƐĞƌǀĞĂƐƚŚĞĨŝŶĂůĞƐĐĂůĂƚŝŽŶƉŽŝŶƚ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϰ ƵƐŝŶĞƐƐWƌŽĐĞƐƐŽŶƐƵůƚŝŶŐKǀĞƌǀŝĞǁ dLJůĞƌƵŶĚĞƌƐƚĂŶĚƐƚŚĂƚƐŽĨƚǁĂƌĞŝŵƉůĞŵĞŶƚĂƚŝŽŶƐƚĂŬĞƐĞdžƚĞŶƐŝǀĞƉůĂŶŶŝŶŐĂŶĚĂŶĂůLJƐŝƐŽĨďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐ͕ ƚŚĂƚ͛ƐǁŚLJǁĞ͛ǀĞĐƌĞĂƚĞĚŽƵƌƵƐŝŶĞƐƐWƌŽĐĞƐƐŽŶƐƵůƚŝŶŐ;WͿƐĞƌǀŝĐĞĚĞƐŝŐŶĞĚĨŽƌĐůŝĞŶƚƐǁŚŽĐŽƵůĚďĞŶĞĨŝƚ ĨƌŽŵŵŽƌĞƌŽďƵƐƚĂŶĂůLJƐŝƐĂŶĚĚŝƐĐƵƐƐŝŽŶŝŶĚĞƚĞƌŵŝŶŝŶŐďĞƐƚďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐĂŶĚĚĞƐŝŐŶŝŶŐƉŽůŝĐŝĞƐƚŽ ŵĂŬĞƚŚĞŵŽƐƚŽĨLJŽƵƌŶĞǁƐŽůƵƚŝŽŶ͘ dLJůĞƌ͛ƐWƐĞƌǀŝĐĞŝƐĚĞƐŝŐŶĞĚƚŽĂƐƐŝƐƚLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶǁŝƚŚƚŚĞƌĞĚĞƐŝŐŶŽĨƉƌĂĐƚŝĐĞƐĂŶĚƉŽůŝĐŝĞƐƚŽďĞƐƚ ůĞǀĞƌĂŐĞLJŽƵƌŝŶǀĞƐƚŵĞŶƚŝŶLJŽƵƌdLJůĞƌƐŽĨƚǁĂƌĞƐŽůƵƚŝŽŶ͘dŚŝƐŝŶͲĚĞƉƚŚĂŶĂůLJƐŝƐƚĂŬĞƐŝŶƚŽĐŽŶƐŝĚĞƌĂƚŝŽŶůŽĐĂů ƉŽůŝĐŝĞƐ͕ĐůŝĞŶƚͲƐƉĞĐŝĨŝĐŐŽĂůƐ͕ŽƉƉŽƌƚƵŶŝƚŝĞƐĨŽƌĞĨĨŝĐŝĞŶĐŝĞƐ͕ŝŵƉƌŽǀĞĚƌĞƉŽƌƚŝŶŐͬŝŶƋƵŝƌLJ͕ĂƵĚŝƚĐŽŵƉůŝĂŶĐĞ͕ĂŶĚ ƌĞƐƵůƚƐŝŶƚŚƌĞĞĚŝƐƚŝŶĐƚĚĞůŝǀĞƌĂďůĞƐ͗ďƵƐŝŶĞƐƐƉƌŽĐĞƐƐƌĞĚĞƐŝŐŶ͕ĐŚĂƌƚŽĨĂĐĐŽƵŶƚƐƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐ͕ĂŶĚ ĐƵƐƚŽŵĚŽĐƵŵĞŶƚĂƚŝŽŶ͘ dLJůĞƌĐŽŶƐƵůƚĂŶƚƐǁŽƌŬǁŝƚŚLJŽƵƌƚĞĂŵĂƚƚŚĞďĞŐŝŶŶŝŶŐŽĨƚŚĞƉƌŽũĞĐƚƚŽĐŽŶĚƵĐƚĂƚŚŽƌŽƵŐŚĐƵƌƌĞŶƚͬĨƵƚƵƌĞ ƐƚĂƚĞĂŶĂůLJƐŝƐ͘KŶĐĞŐŽĂůƐĂŶĚŽďũĞĐƚŝǀĞƐĂƌĞĚŝƐĐƵƐƐĞĚĂŶĚƚŚĞĂŶĂůLJƐŝƐŝƐĐŽŵƉůĞƚĞĚ͕ďĞƐƚƉƌĂĐƚŝĐĞ ƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐĂƌĞƉƌŽǀŝĚĞĚǁŝƚŚŽƉƚŝŽŶƐŽƵƚůŝŶĞĚĨŽƌĞĂĐŚƉƌŽĐĞƐƐ͕ŝŶĐůƵĚŝŶŐĂƌĂŶŬŝŶŐŽĨƚŚĞŽƉƚŝŽŶƐĂŶĚ ŶŽƚĞƐĂƐƚŽǁŚLJĞĂĐŚŝƐƌĞĐŽŵŵĞŶĚĞĚ͘ dLJůĞƌǁŝůůƚŚĞŶĐŽŶĚƵĐƚĂĨŽƌŵĂůƌĞǀŝĞǁŽĨƚŚĞƐĞŽƉƚŝŽŶƐǁŝƚŚLJŽƵƌƉƌŽũĞĐƚƚĞĂŵĂŶĚƚŚĞƐLJƐƚĞŵǁŝůůďĞ ĐŽŶĨŝŐƵƌĞĚƚŽŵĂƚĐŚƚŚĞĂŐƌĞĞĚƵƉŽŶďƵƐŝŶĞƐƐƉƌĂĐƚŝĐĞƐ͘zŽƵƌdLJůĞƌĐŽŶƐƵůƚĂŶƚ;ƐͿǁŝůůƚŚĞŶĐƌĞĂƚĞĐƵƐƚŽŵ ƉƌŽĐĞƐƐĚŽĐƵŵĞŶƚĂƚŝŽŶďĂƐĞĚŽŶĐŽŶĨŝŐƵƌĂƚŝŽŶĚĞĐŝƐŝŽŶƐ͘dŚŝƐĚŽĐƵŵĞŶƚĂƚŝŽŶŝƐƵƐĞĚĨŽƌĂŶƵŵďĞƌŽĨƉƌŽũĞĐƚ ĂĐƚŝǀŝƚŝĞƐŝŶĐůƵĚŝŶŐƚƌĂŝŶŝŶŐĂŶĚƚĞƐƚŝŶŐ͘ ƵƐƚŽŵŝnjĞĚĚŽĐƵŵĞŶƚƐŽƵƚůŝŶĞƐƚĞƉͲďLJͲƐƚĞƉƉƌŽĐĞƐƐĞƐĨŽƌƚŚĞĚĂLJͲƚŽͲĚĂLJƵƐĞŽĨdLJůĞƌ͛ƐĂƉƉůŝĐĂƚŝŽŶƐ͘dŚĞƐĞ ŵĂŶƵĂůƐĂƌĞĐƵƐƚŽŵŝnjĞĚĨŽƌĞĂĐŚĐůŝĞŶƚ͕ĞdžĐĞƉƚĨŽƌƚŚĞŐĞŶĞƌĂůƐLJƐƚĞŵŶĂǀŝŐĂƚŝŽŶƐĞĐƚŝŽŶ͕ǁŚŝĐŚŝƐƐƚĂŶĚĂƌĚ ĨŽƌĂůůĐůŝĞŶƚƐ͘^ĞƚƵƉƚĂďůĞƐĂƌĞŶŽƚĚŽĐƵŵĞŶƚĞĚǁŝƚŚŝŶƚŚĞƐĞŵĂŶƵĂůƐƵŶůĞƐƐƚŚĞŵĂŝŶƚĞŶĂŶĐĞŽĨƚŚĞƚĂďůĞŝƐ ƌĞƋƵŝƌĞĚŽŶĂƌĞŐƵůĂƌďĂƐŝƐ;ŝ͘Ğ͘ŽŶĞͲƚŝŵĞƐĞƚƵƉƚĂďůĞƐĂƌĞŶŽƚƉĂƌƚŽĨƉƌŽĐĞĚƵƌĂůĚŽĐƵŵĞŶƚĂƚŝŽŶͿ͘ dŚĞŽƵƚƉƵƚŽĨWŝƐĂŶĞǁĐŚĂƌƚŽĨĂĐĐŽƵŶƚƐ͕ĂƐLJƐƚĞŵĚĞƐŝŐŶĚŽĐƵŵĞŶƚƚŚĂƚƐĞƌǀĞƐĂƐĂ͚ƌŽĂĚŵĂƉ͛ĂŶĚŐƵŝĚĞ ĨŽƌƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶ͕ĂŶĚĐƵƐƚŽŵŝnjĞĚĚĞƐŬƚŽƉĚŽĐƵŵĞŶƚƐŽƵƚůŝŶŝŶŐŶĞǁƉƌŽĐĞƐƐĞƐ͘ ^ŽůƵƚŝŽŶsĂůŝĚĂƚŝŽŶ DĂŬŝŶŐƐƵƌĞLJŽƵƌŶĞǁƐLJƐƚĞŵǁŽƌŬƐƚŚĞǁĂLJLJŽƵŶĞĞĚŝƚƚŽŝƐƉĂƌĂŵŽƵŶƚƚŽƚŚĞƐƵĐĐĞƐƐŽĨƚŚĞ ŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dLJůĞƌ͛ƐƋƵĂůŝƚLJŵĂŶĂŐĞŵĞŶƚĂŶĚǀĂůŝĚĂƚŝŽŶƉůĂŶĂĚĚƌĞƐƐĞƐďŽƚŚƚŚĞƉƌŽũĞĐƚĂŶĚƚŚĞƉƌŽĚƵĐƚ͕ ǁŚŝůĞĞŶƐƵƌŝŶŐƉƌŽũĞĐƚŽďũĞĐƚŝǀĞƐĂƌĞŵĞƚ͘dŚĞƉƌŽũĞĐƚƚĞĂŵƐǀĂůŝĚĂƚĞƚŚĞƐŽůƵƚŝŽŶƚŚƌŽƵŐŚŽƵƚƚŚĞůŝĨĞŽĨƚŚĞ ƉƌŽũĞĐƚƚŽĞdžƉŽƐĞŝƐƐƵĞƐƚŚĂƚǁŽƵůĚŶŽƌŵĂůůLJŽŶůLJďĞƌĞǀĞĂůĞĚŝŶĂƉƌŽĚƵĐƚŝŽŶĞŶǀŝƌŽŶŵĞŶƚ͘ĐŽŵƉƌĞŚĞŶƐŝǀĞ ǀĂůŝĚĂƚŝŽŶƉůĂŶŝƐƐĞƚŝŶƉůĂĐĞĂŶĚŵĂLJŝŶĐůƵĚĞƐLJƐƚĞŵŝŶĨƌĂƐƚƌƵĐƚƵƌĞĂƵĚŝƚƐ͕ĐŽŶǀĞƌƐŝŽŶƐ͕ĂŶĚŵŽĚŝĨŝĐĂƚŝŽŶ ĚĞůŝǀĞƌLJ͘ ĐŽŶƚƌŽůůĞĚĞŶǀŝƌŽŶŵĞŶƚŝƐĐƌĞĂƚĞĚĨŽƌŚŝŐŚͲůĞǀĞůƉƌŽĚƵĐƚŵŽĚŝĨŝĐĂƚŝŽŶǀĂůŝĚĂƚŝŽŶ͕ŝŵƉŽƌƚĂŶĚĞdžƉŽƌƚ ŝŶƚĞƌĨĂĐĞ͕ĨƵŶĐƚŝŽŶĂůĨůŽǁ͕ĂŶĚƌĞůŝĂďŝůŝƚLJ͘ dŚĞŐŽĂůŽĨǀĂůŝĚĂƚŝŽŶŝƐĨŽƌĞŶĚƵƐĞƌƐƚŽŐĂŝŶĞdžƚĞŶƐŝǀĞƉƌŽĚƵĐƚĞdžƉĞƌŝĞŶĐĞ͕ĚĞǀĞůŽƉĂŚŝŐŚůĞǀĞůŽĨĐŽŶĨŝĚĞŶĐĞ ŝŶdLJůĞƌ͛ƐƉƌŽĚƵĐƚƐ͕ĂŶĚƵŶĚĞƌƐƚĂŶĚƚŚĞŝƌƐƉĞĐŝĨŝĐĨƵŶĐƚŝŽŶƐǁŝƚŚŝŶƚŚĞƐŽůƵƚŝŽŶ͘ džƉĞĐƚĞĚďĞŶĞĨŝƚƐĨƌŽŵƚŚĞĐŽŵƉůĞƚŝŽŶŽĨǀĂůŝĚĂƚŝŽŶĂůƐŽŝŶĐůƵĚĞ͗ xdŚĞŝŶĨƌĂƐƚƌƵĐƚƵƌĞŽĨŚĂƌĚǁĂƌĞĂŶĚŶĞƚǁŽƌŬĚĞƐŝŐŶŝƐƚŚŽƌŽƵŐŚůLJǀĞƚƚĞĚ xDŽĚŝĨŝĐĂƚŝŽŶƐĂƌĞĚĞůŝǀĞƌĞĚĂŶĚĨƵůůLJŝŶƚĞŐƌĂƚĞĚŝŶƚŽƚŚĞƐŽůƵƚŝŽŶ xŵĂŶĂŐĞĚŝƐƐƵĞƐůŝƐƚŝƐĨƵůůLJƋƵĂŶƚŝĨŝĞĚ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϱ /ƐƐƵĞƚƌĂĐŬŝŶŐ͕ƌĞƐŽůƵƚŝŽŶĂĐĐŽƵŶƚĂďŝůŝƚLJ͕ĂŶĚĐŽŵƉůĞƚĞĚŝƐƐƵĞƌĞƐŽůƵƚŝŽŶĂƌĞŶĞĐĞƐƐĂƌLJŝŶĂƐƵĐĐĞƐƐĨƵůůLJ ĐŽŵƉůĞƚĞĚƉƌŽũĞĐƚ͘dŚĞǀĂůŝĚĂƚŝŽŶƉŚĂƐĞŝƐĂƐŚĂƌĞĚƌĞƐƉŽŶƐŝďŝůŝƚLJĂŶĚŵƵƐƚďĞƌĞĐŽŐŶŝnjĞĚĂƐƐƵĐŚ͘ ([SODLQWKHH[SHFWHG*RYHUQPHQWVWDIILQJIRUWKHSURMHFWLQFOXGLQJ x$VVXPHGSDUWLFLSDWLRQLQWKHSURMHFWDYHUDJHSRUWLRQRI)7(7KLVVKRXOGLQFOXGHDOOWLPH VSHQWZRUNLQJRQWKHSURMHFWLQFOXGLQJWLPHVSHQWZLWKDQGZLWKRXWYHQGRUFRQVXOWDQWV x$VVXPSWLRQVDERXWSULRUVNLOOVFRPSHWHQFLHVRIUHVRXUFHV x&RPSOHWH$WWDFKPHQW6WDIILQJ5HIHUWR6HFWLRQ&RIWKH5)3IRUSURMHFWVWDIILQJ DVVXPSWLRQV WůĞĂƐĞƐĞĞdLJůĞƌ͛ƐZŽůĞƐĂŶĚZĞƐƉŽŶƐŝďŝůŝƚLJŝŶĨŽƌŵĂƚŝŽŶůŝƐƚĞĚĂďŽǀĞŝŶƚŚŝƐ^ĞĐƚŝŽŶŽĨƚŚĞZ&WZĞƐƉŽŶƐĞ͘dLJůĞƌ ƵƚŝůŝnjĞĚƚƚĂĐŚŵĞŶƚϭϮĂƐŝŶĨŽƌŵĂƚŝŽŶƚŽďĞƐƚƉƌŽǀŝĚĞĂƌĞƐƉŽŶƐĞďĞůŽǁŝŶƚŚŝƐ^ĞĐƚŝŽŶŽĨƚŚĞZĞƐƉŽŶƐĞ͘ dLJůĞƌZĞƐŽƵƌĐĞƐ dLJůĞƌĂĐƚŝǀĞůLJƐĞĞŬƐƚŚĞďĞƐƚƚĂůĞŶƚƚŽŚĞůƉƵƐŝŵƉůĞŵĞŶƚŽƵƌƐŽůƵƚŝŽŶƐĨŽƌŽƵƌĐůŝĞŶƚƐ͘KƵƌƐƚĂĨĨĐŽŶƐŝƐƚƐŽĨ ƐĞĂƐŽŶĞĚƉƌŽĨĞƐƐŝŽŶĂůƐǁŝƚŚƵŶŝƋƵĞĂŶĚƉƌŽƉƌŝĞƚĂƌLJƐŬŝůůƐ͕ĂŶĚLJĞĂƌƐŽĨŝŶĚƵƐƚƌLJĞdžƉĞƌŝĞŶĐĞ͕ǁŚŽĂƌĞĨŽĐƵƐĞĚ ŽŶƐƉĞĐŝĨŝĐƉƌŽĚƵĐƚƐĂŶĚŝŶĚĞĚŝĐĂƚĞĚƌĞŐŝŽŶƐ ƐƐĞŵďůŝŶŐĂƋƵĂůŝƚLJƉƌŽũĞĐƚƚĞĂŵƚŚĂƚƐƵŝƚƐĨŽƌƉƌŽũĞĐƚŶĞĞĚƐŝƐŝŵƉŽƌƚĂŶƚ͘tĞĂƉƉƌĞĐŝĂƚĞLJŽƵƌƉĂƚŝĞŶĐĞĂƐ ǁĞŵĂŬĞĂƌƌĂŶŐĞƐƚŽĂůůŽĐĂƚĞƌĞƐŽƵƌĐĞƐĨŽƌLJŽƵƌƉƌŽũĞĐƚƉŚĂƐĞƐ͘hƉŽŶĂǁĂƌĚŽĨĐŽŶƚƌĂĐƚ͕dLJůĞƌĂƐƐŝŐŶƐĂ ƉƌŽũĞĐƚŵĂŶĂŐĞƌĂŶĚƋƵĂůŝƚLJƉƌŽũĞĐƚƚĞĂŵƚŽĞŶƐƵƌĞLJŽƵƌŝŵƉůĞŵĞŶƚĂƚŝŽŶƐƵĐĐĞƐƐ͘dLJůĞƌƐƚĂĨĨƉĞƌĨŽƌŵ ƐĞƌǀŝĐĞƐŝŶĂƉƌŽĨĞƐƐŝŽŶĂů͕ǁŽƌŬŵĂŶͲůŝŬĞŵĂŶŶĞƌ͕ĐŽŶƐŝƐƚĞŶƚǁŝƚŚŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚƐ͘ dŚĞƌĞƐƵŵĞƐƉƌĞƐĞŶƚĞĚŝŶƚŚŝƐƉƌŽƉŽƐĂůƌĞĨůĞĐƚƚŚĞĐĂůŝďĞƌĂŶĚĞdžƉĞƌŝĞŶĐĞƚŚĂƚdLJůĞƌǁŝůůĂƐƐŝŐŶƚŽƚŚŝƐƉƌŽũĞĐƚ͘ ƵĞƚŽƚŚĞǀĂƌŝĂďůĞĚƵƌĂƚŝŽŶŽĨƐĞůĞĐƚŝŽŶĂŶĚĐŽŶƚƌĂĐƚƉƌŽĐĞƐƐĞƐ͕ŝƚŝƐĚŝĨĨŝĐƵůƚĨŽƌƵƐƚŽƉƌĞĚŝĐƚƌĞƐŽƵƌĐĞƐƚŚĂƚ ǁŽƵůĚďĞĂǀĂŝůĂďůĞĂƚƉƌŽũĞĐƚĐŽŵŵĞŶĐĞŵĞŶƚ͘ ^ĂŵƉůĞZĞƐƵŵĞƐ ƌŝƚƚĂŶLJd͕͘WƌŽũĞĐƚDĂŶĂŐĞƌʹ/ŶĐŽĚĞWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ dĞŶƵƌĞŵƉůŽLJĞĞƐŝŶĐĞDĂLJϮϬϭϳ džƉĞƌŝĞŶĐĞƐĂWƌŽũĞĐƚDĂŶĂŐĞƌ͕ƌŝƚƚĂŶLJƵƐĞƐŚĞƌƚǁŽLJĞĂƌƐŽĨhƚŝůŝƚLJŝůůŝŶŐĂŶĚ ZDŝŵƉůĞŵĞŶƚĂƚŝŽŶĞdžƉĞƌŝĞŶĐĞ͕ĂŶĚĂŶĂĚĚŝƚŝŽŶĂůLJĞĂƌŽĨĐŽŵďŝŶĞĚ hƚŝůŝƚLJŝůůŝŶŐĂŶĚ&ŝŶĂŶĐŝĂůƐͬWĂLJƌŽůůŝŵƉůĞŵĞŶƚĂƚŝŽŶƐ͕ƚŽŐƵŝĚĞƉƌŽũĞĐƚƐƚŽ ƚŚĞŝƌĐŽŵƉůĞƚŝŽŶ͘ ĚƵĐĂƚŝŽŶdĞdžĂƐdĞĐŚhŶŝǀĞƌƐŝƚLJ͕ĂĐŚĞůŽƌŽĨƵƐŝŶĞƐƐĚŵŝŶŝƐƚƌĂƚŝŽŶʹƵƐŝŶĞƐƐ DĂŶĂŐĞŵĞŶƚ ZĞĨĞƌĞŶĐĞWƌŽũĞĐƚƐĞůůĂsŝƐƚĂWƌŽƉĞƌƚLJKǁŶĞƌƐƐƐŽĐŝĂƚŝŽŶ ŚĂŵƉůŝŶ͕DE tĞƐƚsĂůůĞLJtĂƚĞƌŝƐƚƌŝĐƚ͕ 'Ğƌŝd͕͘WƌŽũĞĐƚDĂŶĂŐĞƌʹ/ŶĐŽĚĞWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ dĞŶƵƌĞŵƉůŽLJĞĞƐŝŶĐĞ^ĞƉƚĞŵďĞƌϮϬϬϰ džƉĞƌŝĞŶĐĞ'ĞƌŝŚĂƐŵŽƌĞƚŚĂŶϮϱLJĞĂƌƐŽĨĐŽŵƉƵƚĞƌŽƉĞƌĂƚŝŽŶƐ͕ŐŽǀĞƌŶŵĞŶƚĨŝŶĂŶĐĞ ĂŶĚdLJůĞƌƐŽĨƚǁĂƌĞĞdžƉĞƌŝĞŶĐĞ͘ ĚƵĐĂƚŝŽŶ/ŽǁĂ^ƚĂƚĞhŶŝǀĞƌƐŝƚLJ͕ĂĐŚĞůŽƌŽĨƵƐŝŶĞƐƐĚŵŝŶŝƐƚƌĂƚŝŽŶʹ/ŶĨŽƌŵĂƚŝŽŶ ^LJƐƚĞŵƐDĂŶĂŐĞŵĞŶƚ ZĞĨĞƌĞŶĐĞWƌŽũĞĐƚƐƵďůŝŶ͕' ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϲ ŚŽĐƚĂǁ͕K< tĞƐƚĐŚĞƐƚĞƌWĂƌŬŝƐƚƌŝĐƚ͕/> <ĂƚŚLJt͕͘WƌŽũĞĐƚDĂŶĂŐĞƌʹ/ŶĐŽĚĞWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ dĞŶƵƌĞŵƉůŽLJĞĞƐŝŶĐĞ&ĞďƌƵĂƌLJϮϬϮϬ džƉĞƌŝĞŶĐĞDŽƌĞƚŚĂŶϮϬLJĞĂƌƐŽĨĞdžƉĞƌŝĞŶĐĞŝŶƉƌŽũĞĐƚŵĂŶĂŐĞŵĞŶƚ͕ĂĐĐŽƵŶƚŝŶŐ͕ ĂŶĚůŽĐĂůŐŽǀĞƌŶŵĞŶƚĞŶŚĂŶĐĞ<ĂƚŚLJ͛ƐĂďŝůŝƚLJƚŽŐƵŝĚĞŚĞƌĐůŝĞŶƚƐƚŚŽƵŐŚ ƚŚĞŝƌƉƌŽũĞĐƚŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘ ĚƵĐĂƚŝŽŶhŶŝǀĞƌƐŝƚLJŽĨƵďƵƋƵĞʹDĂƐƚĞƌŽĨƵƐŝŶĞƐƐĚŵŝŶŝƐƚƌĂƚŝŽŶ ůƉŚŽŶnjŽ͕͘WƌŽũĞĐƚDĂŶĂŐĞƌʹ/ŶĐŽĚĞWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ dĞŶƵƌĞŵƉůŽLJĞĞƐŝŶĐĞKĐƚŽďĞƌϮϬϭϵ džƉĞƌŝĞŶĐĞtŝƚŚϱLJĞĂƌƐ͛ĞdžƉĞƌŝĞŶĐĞĂƐĂWƌŽũĞĐƚDĂŶĂŐĞƌ͕ůƉŚŽŶnjŽƵƐĞƐŚŝƐƐƚƌŽŶŐ ďĂĐŬŐƌŽƵŶĚƚŽƐƚƌĞĂŵůŝŶĞƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽĐĞƐƐ͕ĂŶĂůLJnjĞĐŽŵƉůĞdž ŝƐƐƵĞƐĂŶĚƋƵŝĐŬůLJĚĞǀĞůŽƉĞĨĨĞĐƚŝǀĞƐŽůƵƚŝŽŶƐ͘ůƉŚŽŶnjŽ͛ƐƐŽůŝĚ ƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨƐŽĨƚǁĂƌĞĨƵŶĐƚŝŽŶĂůŝƚLJŚĞůƉƐŚŝŵĐŽŵŵƵŶŝĐĂƚĞ ĞĨĨĞĐƚŝǀĞůLJǁŝƚŚĐůŝĞŶƚĞdžĞĐƵƚŝǀĞƐĂŶĚƚŚĞŝƌƌĞƐƉĞĐƚŝǀĞƚĞĂŵƐ͘ ĚƵĐĂƚŝŽŶDŽƌĞŚŽƵƐĞŽůůĞŐĞ͕ĂĐŚĞůŽƌŽĨƵƐŝŶĞƐƐĚŵŝŶŝƐƚƌĂƚŝŽŶʹDĂƌŬĞƚŝŶŐ ZĞĨĞƌĞŶĐĞWƌŽũĞĐƚƐ'ĂƌĚĞŶŝƚLJ͕K ŽƌŶŝŶŐ͕Ez ZŝŽŽŵŵƵŶŝƚŝĞƐ <ĞůůĞLJD͕͘WƌŽũĞĐƚDĂŶĂŐĞƌʹ/ŶĐŽĚĞWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ dĞŶƵƌĞŵƉůŽLJĞĞƐŝŶĐĞ&ĞďƌƵĂƌLJϮϬϭϯ džƉĞƌŝĞŶĐĞ<ĞůůĞLJŚĂƐĂƚŚŽƌŽƵŐŚƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨ/ŶĐŽĚĞĂŶĚƚŚĞĞŶĚƵƐĞƌ ĞdžƉĞƌŝĞŶĐĞ͘ƐĂWƌŽũĞĐƚDĂŶĂŐĞƌ͕<ĞůůĞLJƵƐĞƐŚĞƌŬŶŽǁůĞĚŐĞĂŶĚ ďĂĐŬŐƌŽƵŶĚƚŽŐƵŝĚĞŚĞƌĐůŝĞŶƚƐƚŚƌŽƵŐŚƚŚĞŝƌƉƌŽũĞĐƚŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘ ĚƵĐĂƚŝŽŶ/ŽǁĂ^ƚĂƚĞhŶŝǀĞƌƐŝƚLJ͕ĂĐŚĞůŽƌŽĨ^ĐŝĞŶĐĞʹ,ĞĂůƚŚĂŶĚ,ƵŵĂŶ WĞƌĨŽƌŵĂŶĐĞ ZĞĨĞƌĞŶĐĞWƌŽũĞĐƚƐZŝŶŐŐŽůĚŝƚLJ͕/ ^ŝŽƵdžŝƚLJ͕/ 'ƌĂƐƐsĂůůĞLJ͕ :ĞŶŶŝĨĞƌ>͕͘WƌŽũĞĐƚDĂŶĂŐĞƌʹ/ŶĐŽĚĞWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ dĞŶƵƌĞŵƉůŽLJĞĞƐŝŶĐĞ&ĞďƌƵĂƌLJϮϬϬϴ džƉĞƌŝĞŶĐĞtŝƚŚĐŽŵďŝŶĞĚĞdžƉĞƌŝĞŶĐĞĂƐdLJůĞƌ^ƵƉƉŽƌƚ^ƉĞĐŝĂůŝƐƚĂŶĚĚǀŝƐŽƌ͕ ŽŶǀĞƌƐŝŽŶĂŶĚ/ŵƉůĞŵĞŶƚĂƚŝŽŶŶĂůLJƐƚ͕ĂŶĚWƌŽũĞĐƚDĂŶĂŐĞƌ͕:ĞŶŶŝĨĞƌ ďƌŝŶŐƐĂŐƌĞĂƚŵŝdžƚƵƌĞŽĨĐƵƐƚŽŵĞƌƐĞƌǀŝĐĞĂŶĚŬŶŽǁůĞĚŐĞŽĨdLJůĞƌ ƉƌŽĐĞƐƐĞƐ͘,ĞƌĞdžƉĞƌŝĞŶĐĞĂƐĂWƌŽũĞĐƚDĂŶĂŐĞƌĂƚdLJůĞƌŝƐĞŶŚĂŶĐĞĚďLJ ƚŚĞƐƚƵĚLJĂŶĚĂĐŚŝĞǀĞŵĞŶƚŽĨŚĞƌWƌŽũĞĐƚDĂŶĂŐĞŵĞŶƚWƌŽĨĞƐƐŝŽŶĂů ;WDWͿĐĞƌƚŝĨŝĐĂƚŝŽŶ͘ ĚƵĐĂƚŝŽŶdĞdžĂƐdĞĐŚhŶŝǀĞƌƐŝƚLJʹĂĐŚĞůŽƌŽĨƵƐŝŶĞƐƐĚŵŝŶŝƐƚƌĂƚŝŽŶʹ&ŝŶĂŶĐĞ͕ WDWĞƌƚŝĨŝĞĚ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϳ ZĞĨĞƌĞŶĐĞWƌŽũĞĐƚƐZĂLJŝƚLJ͕DK EŽƌƚŚĂƐƚŽƌŽƵŐŚ͕W tĂƐŚŝŶŐƚŽŶ͕/> ůĞĚŽ͕dy :ŽůĞŶĞ,͕͘WƌŽũĞĐƚDĂŶĂŐĞƌʹ/ŶĐŽĚĞWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ dĞŶƵƌĞŵƉůŽLJĞĞƐŝŶĐĞKĐƚϮϬϭϵ džƉĞƌŝĞŶĐĞƐĂWƌŽũĞĐƚDĂŶĂŐĞƌ͕:ŽůĞŶĞƵƐĞƐŚĞƌŬŶŽǁůĞĚŐĞĂŶĚďĂĐŬŐƌŽƵŶĚƚŚĂƚ ƐŚĞŚĂƐĂĐƋƵŝƌĞĚƚŚƌŽƵŐŚĞdžƉĞƌŝĞŶĐĞĨŽƌƚŚĞƉĂƐƚϭϬLJĞĂƌƐǁŝƚŚǁŽƌŬŝŶŐ ĂƐĂŶ/ŵƉůĞŵĞŶƚĂƚŝŽŶŶĂůLJƐƚĂŶĚĂWƌŽũĞĐƚDĂŶĂŐĞƌǁŝƚŚĨŝŶĂŶĐŝĂů ƐŽĨƚǁĂƌĞ͘,ĞƌĞdžƉĞƌŝĞŶĐĞŝƐŚĞůƉĨƵůŝŶŶĂǀŝŐĂƚŝŶŐƚŚƌŽƵŐŚƚŚĞĞŶƚŝƌĞ ƉƌŽĐĞƐƐĨƌŽŵŝŶƐƚĂůůĂƚŝŽŶŽĨƚŚĞƐŽĨƚǁĂƌĞƚŽŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨƚŚĞ ĂƉƉůŝĐĂƚŝŽŶƐŝŶĂƉƌŽĚƵĐƚŝŽŶĞŶǀŝƌŽŶŵĞŶƚ ZĞĨĞƌĞŶĐĞWƌŽũĞĐƚƐƌĂƚŚŝƚLJ͕dy ŽůůŝŶŐĞƌŝƚLJ͕DK 3URYLGHDQRYHUYLHZRISURSRVHGWUDLQLQJSODQVWUDWHJ\VSHFLI\LQJKRZDQGZKHQWUDLQLQJLVWREH GHOLYHUHGIRUERWKRQVLWHDQGRIIVLWHWUDLQLQJDQGZHEWUDLQLQJVHUYLFHVIRUWKHFRUHSURMHFW WHDP HQGXVHUVDQGWHFKQRORJ\SHUVRQQHOLIUHTXLUHG x([SODLQDQ\UROHVDQGUHVSRQVLELOLWLHVWKH*RYHUQPHQWLVH[SHFWHGWRSURYLGHIRUWKH WUDLQLQJHIIRUWLQFOXGLQJEXWQRWOLPLWHGWRWUDLQLQJFRRUGLQDWLRQWUDLQLQJPDWHULDO GHYHORSPHQWWUDLQLQJGHOLYHU\HWF dLJůĞƌdƌĂŝŶŝŶŐWůĂŶ ǀĞƌLJŽŶĞ͛ƐůĞĂƌŶŝŶŐƐƚLJůĞŝƐĚŝĨĨĞƌĞŶƚ͘dŚĂƚ͛ƐǁŚLJdLJůĞƌŽĨĨĞƌƐƐĞǀĞƌĂůƚƌĂŝŶŝŶŐĨŽƌŵĂƚƐƚŽĂĐĐŽŵŵŽĚĂƚĞŽƵƌ ĚŝǀĞƌƐĞĐůŝĞŶƚƐ͛ŶĞĞĚƐ͘dƌĂŝŶŝŶŐďLJdLJůĞƌƐƚĂĨĨƉƌŽǀŝĚĞƐŚĂŶĚƐͲŽŶůĞĂƌŶŝŶŐŝŶLJŽƵƌŽǁŶůĂďƐ͘zŽƵƌƌĞƐŽƵƌĐĞƐ ƌĞĐĞŝǀĞĐŽŶƐƵůƚĂƚŝǀĞŬŶŽǁůĞĚŐĞƚƌĂŶƐĨĞƌƐĞƐƐŝŽŶƐƚŚĂƚĂƌĞĂĐŽŵďŝŶĂƚŝŽŶŽĨůĞĐƚƵƌĞĂŶĚŚĂŶĚƐͲŽŶĞĚƵĐĂƚŝŽŶ͕ ƵƐŝŶŐLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶ͛ƐŽǁŶĚĂƚĂ͘ ŵƵƚƵĂůůLJĚĞǀĞůŽƉĞĚĞĚƵĐĂƚŝŽŶƉůĂŶůĂLJƐŽƵƚƚŚĞƉƌŽĐĞƐƐŽĨƚƌĂŶƐĨĞƌƌŝŶŐŬŶŽǁůĞĚŐĞďĞƚǁĞĞŶLJŽƵĂŶĚdLJůĞƌ͘ dŚĞƉƵƌƉŽƐĞŽĨƚŚĞĞĚƵĐĂƚŝŽŶƉůĂŶŝƐƚŽ͗ xŽŵŵƵŶŝĐĂƚĞƚŚĞƉƌŽĐĞƐƐƚŽƐƚĂŬĞŚŽůĚĞƌƐĂŶĚĨƵŶĐƚŝŽŶĂůůĞĂĚĞƌƐ xŶƐǁĞƌƐƉĞĐŝĨŝĐƋƵĞƐƚŝŽŶƐ;ǁŚĞƌĞĐůĂƐƐƌŽŽŵƐǁŝůůďĞĞƐƚĂďůŝƐŚĞĚ͕ǁŚĂƚĚĂƚĂďĂƐĞĞŶǀŝƌŽŶŵĞŶƚǁŝůůďĞ ƵƚŝůŝnjĞĚ͕ĞƚĐ͘Ϳ xƐƚĂďůŝƐŚĂĐƚŝŽŶŝƚĞŵƐĂŶĚůŝŶŬƉƌŽũĞĐƚƉĞƌƐŽŶŶĞůĂƐŽǁŶĞƌƐ xĞĨŝŶĞŵĞĂƐƵƌĞŵĞŶƚĐƌŝƚĞƌŝĂƚŽĞŶƐƵƌĞƚŚĞƉůĂŶŚĂƐďĞĞŶƐƵĐĐĞƐƐĨƵůůLJĨŽůůŽǁĞĚ zŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶŝƐƐĞƚƵƉĨŽƌƐƵĐĐĞƐƐǁŝƚŚdLJůĞƌ͛ƐƚƌĂŝŶƚŚĞƚƌĂŝŶĞƌĂƉƉƌŽĂĐŚƚŽƚƌĂŝŶŝŶŐĂŶĚĞĚƵĐĂƚŝŽŶƉůĂŶ ĚĞǀĞůŽƉĞĚŽǀĞƌLJĞĂƌƐŽĨŝŶĚƵƐƚƌLJĞdžƉĞƌŝĞŶĐĞ͘ ^ĐŚĞĚƵůŝŶŐĂŶĚƚƚĞŶĚĂŶĐĞ dLJůĞƌƉƌĞĨĞƌƐĂĐůĂƐƐƌŽŽŵĂŶĚĐƵƌƌŝĐƵůƵŵĂƉƉƌŽĂĐŚĨŽƌƚƌĂŝŶŝŶŐƚŽĞŶƐƵƌĞŬŶŽǁůĞĚŐĞƚƌĂŶƐĨĞƌ͕ ĐŽŵƉƌĞŚĞŶƐŝŽŶ͕ĂŶĚƌĞƚĞŶƚŝŽŶ͘ƐƵĐĐĞƐƐĨƵůƵƐĞƌƚƌĂŝŶŝŶŐƐĞƐƐŝŽŶŝƐŝŶĂĐůĂƐƐƌŽŽŵĞŶǀŝƌŽŶŵĞŶƚǁŝƚŚĂ ĐŽŵƉƵƚĞƌĨŽƌĞĂĐŚƵƐĞƌ͕ǁŚŝƚĞďŽĂƌĚ͕ƉƌŝŶƚĞƌŝŶƚŚĞƌŽŽŵŽƌŶĞĂƌďLJ͕ĂŶĚŽŶĞĐŽŵƉƵƚĞƌĐŽŶŶĞĐƚĞĚƚŽĂ ƉƌŽũĞĐƚŽƌ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϴ ůĂƐƐƐŝnjĞƐŚŽƵůĚďĞůŝŵŝƚĞĚƚŽƚǁĞůǀĞ;ϭϮͿƵƐĞƌƐŝŶĂƚƚĞŶĚĂŶĐĞƚŽƚŚĞƚƌĂŝŶŝŶŐŝƐĐƌŝƚŝĐĂůƚŽŐĂŝŶŚĂŶĚƐͲŽŶ ĞdžƉĞƌŝĞŶĐĞǁŝƚŚƚŚĞƐLJƐƚĞŵ͘ ZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ dLJůĞƌŬŶŽǁƐƚŚĞǀĂůƵĞŽĨďĞŝŶŐƉƌĞƉĂƌĞĚĨŽƌƚŚĞƵƐĞŽĨŽƵƌƐŽĨƚǁĂƌĞŝŶƉƌŽĚƵĐƚŝŽŶ͘KƵƌŐŽĂůŝƐƚŽƉĂƌƚŶĞƌǁŝƚŚ LJŽƵĂŶĚůĞŶĚŽƵƌĞdžƉĞƌƚŝƐĞďĂƐĞĚŽŶĞdžƉĞƌŝĞŶĐĞ͕ŝŶŽƌĚĞƌƚŽĂůůŽǁLJŽƵƌƌĞƐŽƵƌĐĞƐƚŽďĞƐƵĐĐĞƐƐĨƵůĂƚŐŽͲůŝǀĞ͘ ŽƚŚƚĞĂŵƐĐŽůůĂďŽƌĂƚĞŽŶĂůůĂƐƉĞĐƚƐŽĨƚƌĂŝŶŝŶŐ͕ĚŝƐĐƵƐƐĞĚ͕ĂŶĚĚŽĐƵŵĞŶƚĞĚĚƵƌŝŶŐƚŚĞƉůĂŶŶŝŶŐƐƚĂŐĞŽĨƚŚĞ ƉƌŽũĞĐƚ͘dŚĞĞdžƉĞĐƚĂƚŝŽŶŝƐĨŽƌdLJůĞƌƚŽƉƌŽǀŝĚĞŽŶĞŽƌŵŽƌĞŽĐĐƵƌƌĞŶĐĞŽĨĞĂĐŚƐĐŚĞĚƵůĞĚƚƌĂŝŶŝŶŐ͘zŽƵǁŝůů ďĞƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞůŽŐŝƐƚŝĐƐŽĨƚŚĞƚƌĂŝŶŝŶŐďLJĐŽŵƉůĞƚŝŶŐƐƵĐŚƚĂƐŬƐĂƐƐĐŚĞĚƵůŝŶŐƌĞƐŽƵƌĐĞƐĂŶĚĞŶƐƵƌŝŶŐ ĨĂĐŝůŝƚŝĞƐĂƌĞĂǀĂŝůĂďůĞ͘dŚĞƐĞƐĞƐƐŝŽŶƐĂƌĞƚŽďĞĂƚƚĞŶĚĞĚďLJLJŽƵƌŬĞLJƐƚĂĨĨŵĞŵďĞƌƐ;ŝ͘Ğ͘ĨƵŶĐƚŝŽŶĂůůĞĂĚƐĂŶĚ ƉŽǁĞƌƵƐĞƌƐͿƐŽƚŚĂƚƚŚĞLJĐĂŶƚŚĞŶĚŝƐƐĞŵŝŶĂƚĞƚŚĞŝŶĨŽƌŵĂƚŝŽŶƚŚĞLJůĞĂƌŶƚŽŽƚŚĞƌƐŝŶLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶŝĨŽƌ ǁŚĞŶŶĞĐĞƐƐĂƌLJ͘ dƌĂŝŶŝŶŐDĂƚĞƌŝĂůƐ dLJůĞƌŵĂŝŶƚĂŝŶƐĂĐŽŵƉůĞƚĞƐĞƚŽĨĚŽĐƵŵĞŶƚĂƚŝŽŶƚŚĂƚŝƐĂǀĂŝůĂďůĞƚŽĂůůƵƐĞƌƐƚŚƌŽƵŐŚƚŚĞ<ŶŽǁůĞĚŐĞĂƐĞ͘ dŚĞ<ŶŽǁůĞĚŐĞĂƐĞƉƌŽǀŝĚĞƐƵƐĞƌƐǁŝƚŚĂƐŝŶŐůĞ͕ĞĂƐŝůLJĂĐĐĞƐƐŝďůĞůŽĐĂƚŝŽŶƚŽĨŝŶĚĂůůĞdžŝƐƚŝŶŐĚŽĐƵŵĞŶƚĂƚŝŽŶ ŽŶdLJůĞƌƉƌŽĚƵĐƚƐĂŶĚŽƚŚĞƌǁŝĚĞůLJƵƐĞĚƚĞĐŚŶŽůŽŐLJƉƌŽĚƵĐƚƐ͘/ŶĐůƵĚĞĚĂƌĞƉƌŽĐĞĚƵƌĞĚŽĐƵŵĞŶƚƐ͕ĨŝůĞ ůĂLJŽƵƚƐ͕ƵƐĞƌŐƵŝĚĞƐ͕ŝŶƐƚĂůůĂƚŝŽŶŵĂŶƵĂůƐ͕ƐĞƚƵƉĚŽĐƵŵĞŶƚƐ͕ƐLJƐƚĞŵĂĚŵŝŶŝƐƚƌĂƚŽƌĚŽĐƵŵĞŶƚƐ͕ĚĂƚĂƐĐŚĞŵĂƐ͕ ƚƌĂŝŶŝŶŐĞdžĞƌĐŝƐĞƐĂŶĚŵƵĐŚŵŽƌĞ͘ůŝĞŶƚƐĂůƐŽŚĂǀĞƚŚĞĂďŝůŝƚLJƚŽĚŽǁŶůŽĂĚĚŽĐƵŵĞŶƚĂƚŝŽŶŝŶƚŽDŝĐƌŽƐŽĨƚ tŽƌĚĨŽƌŵĂƚƚŽĞĚŝƚƚŽŵĂƚĐŚŝŶƚĞƌŶĂůƉŽůŝĐŝĞƐĂŶĚƉƌŽĐĞĚƵƌĞƐ͘ dƌĂŝŶŝŶŐKƉƚŝŽŶƐĨŽƌWƵďůŝĐ,ĞĂůƚŚ dLJůĞƌŚĂƐĂůŽŶŐƐƚĂŶĚŝŶŐƚƌĂĐŬƌĞĐŽƌĚĚĞůŝǀĞƌŝŶŐǀŝƌƚƵĂůŝŵƉůĞŵĞŶƚĂƚŝŽŶƐĞƌǀŝĐĞƐ͘tŝƚŚŽƵƌƐƚƌŽŶŐǀŝƌƚƵĂů ĐĂƉĂďŝůŝƚŝĞƐ͕dLJůĞƌŚĂƐĂĚũƵƐƚĞĚƚŽƚŚĞĐƵƌƌĞŶƚŽǀŝĚͲϭϵĐůŝŵĂƚĞ͘dLJůĞƌƉůĂŶƐƚŽĐŽŶƚŝŶƵĞƚŽĚĞůŝǀĞƌĂůůƚƌĂŝŶŝŶŐ ǀŝƌƚƵĂůůLJ͕ŝŶĐůƵĚŝŶŐ'Ž>ŝǀĞƐ͕ƵŶƚŝůŚĞĂůƚŚĂŶĚƚƌĂǀĞůĐŽŶĚŝƚŝŽŶƐƐƚĂďŝůŝnjĞ͘^ŝŶĐĞtŽƌŬĨƌŽŵ,ŽŵĞKƌĚĞƌƐŚĂǀĞ ďĞĞŶŝŶƉůĂĐĞĂĐƌŽƐƐƚŚĞh͘^͕͘dLJůĞƌŚĂƐĚĞůŝǀĞƌĞĚĂƉƉƌŽdžŝŵĂƚĞůLJϳϱ͕ϬϬϬŚŽƵƌƐŽĨ/ŵƉůĞŵĞŶƚĂƚŝŽŶ^ĞƌǀŝĐĞƐ ƌĞŵŽƚĞůLJĂŶĚďƌŽƵŐŚƚŽǀĞƌϮϱĐůŝĞŶƚƐůŝǀĞǀŝƌƚƵĂůůLJ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϴϵ ƚƚŚŝƐƚŝŵĞůŽĐĂů͕ƐƚĂƚĞ͕ĂŶĚĨĞĚĞƌĂůŐŽǀĞƌŶŵĞŶƚƐǁŝƚŚŝŶƚŚĞhŶŝƚĞĚ^ƚĂƚĞƐ;h^ͿĂƌĞůŝŵŝƚŝŶŐƚƌĂǀĞůǁŝƚŚŝŶŽƵƌ ďŽƌĚĞƌƐĂŶĚĂďƌŽĂĚ͘tŚĞŶƚŚĞůŽĐĂůĂŶĚƐƚĂƚĞŐŽǀĞƌŶŵĞŶƚƐƐƚĂƌƚůŝĨƚŝŶŐƌĞƐƚƌŝĐƚŝŽŶƐ͕ǁĞǁŝůůĞǀĂůƵĂƚĞĞĂĐŚ ƉƌŽũĞĐƚĂŶĚĚĞƚĞƌŵŝŶĞǁŚŝĐŚ͕ŝĨĂŶLJ͕ƐĞƐƐŝŽŶƐĐĂŶŶŽƚďĞĚĞůŝǀĞƌĞĚĞĨĨĞĐƚŝǀĞůLJĂŶĚĞĨĨŝĐŝĞŶƚůLJƚŚƌŽƵŐŚǀŝƌƚƵĂů ĐŽŶƐƵůƚĂƚŝŽŶ͕ĂŶĚŽŶůLJƚŚŽƐĞƐĞƐƐŝŽŶƐǁŝůůďĞĐŽŶƐŝĚĞƌĞĚĨŽƌƚƌĂǀĞů͘dLJůĞƌ͛ƐƐƚĂŶĚĂƌĚĂƉƉƌŽĂĐŚ͕ƵŶĚĞƌŶŽƌŵĂů ĐŝƌĐƵŵƐƚĂŶĐĞƐ͕ŝƐƚŽĐŽŶĚƵĐƚƌŽƵŐŚůLJϮϱйŽĨĂůůƉƌŽũĞĐƚĚĂLJƐŽŶͲƐŝƚĞŝŶLJŽƵƌĨĂĐŝůŝƚŝĞƐ͘ ƚLJƉŝĐĂůĚĂLJŽĨƚƌĂŝŶŝŶŐŝƐĨƌŽŵϵ͗ϬϬƚŽϰ͗ϯϬ;Žƌϴ͗ϯϬƚŽϰ͗ϬϬͿ͕ĂůůŽǁŝŶŐĨŽƌĂďƌĞĂŬĨŽƌůƵŶĐŚĂŶĚƐŚŽƌƚďƌĞĂŬƐ ŝŶƚŚĞŵŽƌŶŝŶŐĂŶĚĂĨƚĞƌŶŽŽŶĂƐŶĞĞĚĞĚ͘tĞ͛ǀĞĨŽƵŶĚƚŚĂƚĂůůŽǁŝŶŐƵƐĞƌƐƚŝŵĞƚŽƌĞƚƵƌŶƚŽƚŚĞŝƌĚĂŝůLJ ƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐďĞĨŽƌĞĂŶĚĂĨƚĞƌĐůĂƐƐĞƐŽƌƐĞƐƐŝŽŶƐĂůůŽǁƐĨŽƌŵŽƌĞƉƌŽĚƵĐƚŝǀŝƚLJĚƵƌŝŶŐƚŚĞƐĞƐƐŝŽŶ͘/ƚĂůƐŽ ĂůůŽǁƐƚŚĞdLJůĞƌ/ŵƉůĞŵĞŶƚĂƚŝŽŶƐƚĂĨĨƚŝŵĞƚŽƉƌĞƉĂƌĞƵƉŽŶĂƌƌŝǀĂůĂŶĚĨŽůůŽǁͲƵƉĂĨƚĞƌǁĂƌĚ͘dŚĞƐƚĂƌƚĂŶĚ ƐƚŽƉƚŝŵĞƐĨŽƌƚŚĞƚƌĂŝŶŝŶŐǁŝůůďĞĚŝƐĐƵƐƐĞĚĂŶĚĂŐƌĞĞĚƵƉŽŶďLJWƌŽũĞĐƚDĂŶĂŐĞŵĞŶƚĚƵƌŝŶŐƚŚĞƉůĂŶŶŝŶŐ ƉŽƌƚŝŽŶŽĨƚŚĞƉƌŽũĞĐƚĂŶĚǁŝůůďĞƉƵďůŝƐŚĞĚĂƐƐƚĂŶĚĂƌĚƐĞƐƐŝŽŶƚŝŵĞƐƚŚƌŽƵŐŚŽƵƚƚŚĞƉƌŽũĞĐƚ͘ dƌĂŝŶŝŶŐĐůĂƐƐĞƐƐŚŽƵůĚďĞůŝŵŝƚĞĚƚŽďĞƚǁĞĞŶϭϮĂƚƚĞŶĚĞĞƐ͘ĞƌƚĂŝŶƐƵďũĞĐƚĂƌĞĂƐĂŶĚƚŽƉŝĐƐĂůůŽǁĨŽƌŵƵĐŚ ůĂƌŐĞƌƚƌĂŝŶŝŶŐĐůĂƐƐĞƐ͘ <ŶŽǁůĞĚŐĞdƌĂŶƐĨĞƌƉƉƌŽĂĐŚ ƵƌŝŶŐŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨŽƵƌƉƌŽĚƵĐƚƐ͕dLJůĞƌ͛ƐŐŽĂůŝƐƚŽĞĚƵĐĂƚĞLJŽƵƌƌĞƐŽƵƌĐĞƐƐŽƚŚĂƚƚŚĞLJĂƌĞƐĞůĨͲ ƐƵĨĨŝĐŝĞŶƚƵƐĞƌƐŽĨƚŚĞƐŽůƵƚŝŽŶ͘dLJůĞƌƵƐĞƐĂƚƌĂŝŶͲƚŚĞͲƚƌĂŝŶĞƌŵŽĚĞůƚŽƚƌĂŶƐĨĞƌŬŶŽǁůĞĚŐĞ͘dLJůĞƌ͛ƐƉƌŽũĞĐƚ ƚĞĂŵǁŝůůƉƌŽǀŝĚĞĐŽŵƉƌĞŚĞŶƐŝǀĞƚƌĂŝŶŝŶŐƚŽLJŽƵƌƚĞĂŵ͕ǁŚŝĐŚŝŶĐůƵĚĞƐƚŚĞƉƌŽũĞĐƚŵĂŶĂŐĞƌ͕ĨƵŶĐƚŝŽŶĂůůĞĂĚƐ͕ ĂŶĚƉŽǁĞƌƵƐĞƌƐ͘dLJůĞƌƉƌŽǀŝĚĞƐŽŶĞŽĐĐƵƌƌĞŶĐĞ͕ŽƌŵŽƌĞ͕ŽĨĞĂĐŚƐĐŚĞĚƵůĞĚƚƌĂŝŶŝŶŐŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ ƚŽƉŝĐ͘dŚĞĨŝƌƐƚƚŝŵĞĨŽĐƵƐĞƐŽŶƚŚĞƉƌŽĐĞƐƐƐƚĞƉƐ͕ǁŚŝůĞƚŚĞƐĞĐŽŶĚƚŝŵĞ͕ƚŚĞƚƌĂŝŶŝŶŐŝƐŵŽƌĞĂĚǀĂŶĐĞĚ͘ ^ĞƐƐŝŽŶƐĨŽƌĞĂĐŚƚŽƉŝĐǁŝůůĂůƐŽĐŽǀĞƌĐŽŶĨŝŐƵƌĂƚŝŽŶĨŽƌĨƵŶĐƚŝŽŶĂůůĞĂĚƐĂŶĚƉŽǁĞƌƵƐĞƌƐ͕ƐŽƚŚĂƚĨƵƚƵƌĞ ĐŚĂŶŐĞƐĐĂŶďĞĞĂƐŝůLJŵĂĚĞ͘ ŶƐƵƌŝŶŐĐŽŵƉƌĞŚĞŶƐŝŽŶŽĨĚĂŝůLJũŽďĨƵŶĐƚŝŽŶƐŝƐĞƐƐĞŶƚŝĂůƚŽĂƐƵĐĐĞƐƐĨƵůŐŽͲůŝǀĞĂŶĚƉƌŽĚƵĐƚ ĂĚŽƉƚŝŽŶ͘dŚĞŐŽĂůŽĨŽƵƌƚƌĂŝŶͲƚŚĞͲƚƌĂŝŶĞƌĂƉƉƌŽĂĐŚŝƐƚŽĞdžƉŽƐĞƚŚĞŵŽƐƚƐŽƉŚŝƐƚŝĐĂƚĞĚƵƐĞƌƐƚŽƚŚĞ ƐLJƐƚĞŵĨŝƌƐƚ͕ƐŽƐLJƐƚĞŵĐŽŶĨŝŐƵƌĂƚŝŽŶ͕ĐŽŶǀĞƌƚĞĚĚĂƚĂ͕ĂŶĚŶĞǁƉƌŽĐĞĚƵƌĞƐĂƌĞƚŚŽƌŽƵŐŚůLJǀĞƚƚĞĚďLJ LJŽƵƌƚĞĂŵďĞĨŽƌĞďĞŝŶŐŝŶƚƌŽĚƵĐĞĚƚŽĞŶĚƵƐĞƌƐ͘ƵƌŝŶŐƚƌĂŝŶŝŶŐ͕dLJůĞƌŝŵƉůĞŵĞŶƚĂƚŝŽŶĐŽŶƐƵůƚĂŶƚƐ ŵĞĂƐƵƌĞŬŶŽǁůĞĚŐĞƚƌĂŶƐĨĞƌƐƚŚƌŽƵŐŚĂƐƐĞƐƐŵĞŶƚƐĂŶĚůĞĂĚŵŝŶŝƉĂƌĂůůĞůƉƌŽĐĞƐƐĞƐĂŶĚǀĂůŝĚĂƚŝŽŶƐ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϬ &RPSOHWH$WWDFKPHQW&RQYHUVLRQV7KH*RYHUQPHQWH[SHFWVSURSRVHUVWRLQFOXGHDOO FRQYHUVLRQVOLVWHGLQWKH5)3 dLJůĞƌƵƚŝůŝnjĞĚƚƚĂĐŚŵĞŶƚϭϭĂƐŝŶĨŽƌŵĂƚŝŽŶƚŽďĞƐƚƉƌŽǀŝĚĞĂƌĞƐƉŽŶƐĞďĞůŽǁŝŶƚŚŝƐ^ĞĐƚŝŽŶŽĨƚŚĞZĞƐƉŽŶƐĞ͘ ĂƚĂŽŶǀĞƌƐŝŽŶ dŚĞĚĂƚĂĐŽŶǀĞƌƐŝŽŶƉƌŽĐĞƐƐĐĂŶďĞƚŚĞŵŽƐƚƚŝŵĞͲĐƌŝƚŝĐĂůĞůĞŵĞŶƚŽĨLJŽƵƌƉƌŽũĞĐƚƉůĂŶ͘dLJůĞƌĚĞǀĞůŽƉƐĐƌƵĐŝĂů ƐƚĞƉƐŝŶŽƵƌŝŵƉůĞŵĞŶƚĂƚŝŽŶƉƌŽĐĞƐƐƚŽƐƵƉƉŽƌƚĂƐƵĐĐĞƐƐĨƵůĚĂƚĂĐŽŶǀĞƌƐŝŽŶƐƉůĂŶ͘KƵƌĚĂƚĂĞdžƉĞƌƚƐĐŽŶĚƵĐƚ ŚƵŶĚƌĞĚƐŽĨĚĂƚĂĐŽŶǀĞƌƐŝŽŶƐĞǀĞƌLJLJĞĂƌŵĂƉƉŝŶŐůĞŐĂĐLJĚĂƚĂƚŚƌŽƵŐŚĐƵƐƚŽŵǁƌŝƚƚĞŶƉƌŽŐƌĂŵƐ͘ dŚĞƉƵƌƉŽƐĞŽĨƚŚŝƐƚĂƐŬŝƐƚŽƚƌĂŶƐŝƚŝŽŶŝƚLJ͛ƐĚĂƚĂĨƌŽŵLJŽƵƌƐŽƵƌĐĞ;͞ůĞŐĂĐLJ͟ͿƐLJƐƚĞŵ;ƐͿƚŽƚŚĞdLJůĞƌ ƐLJƐƚĞŵ;ƐͿ͘dŚĞĚĂƚĂǁŝůůŶĞĞĚƚŽďĞŵĂƉƉĞĚĨƌŽŵƚŚĞůĞŐĂĐLJƐLJƐƚĞŵŝŶƚŽƚŚĞŶĞǁdLJůĞƌƐLJƐƚĞŵĨŽƌŵĂƚ͘ǁĞůůͲ ĞdžĞĐƵƚĞĚĚĂƚĂĐŽŶǀĞƌƐŝŽŶŝƐŬĞLJƚŽĂƐƵĐĐĞƐƐĨƵůĐƵƚŽǀĞƌƚŽƚŚĞŶĞǁƐLJƐƚĞŵ;ƐͿ͘ tŝƚŚŐƵŝĚĂŶĐĞĨƌŽŵdLJůĞƌ͕ŝƚLJǁŝůůƌĞǀŝĞǁƐƉĞĐŝĨŝĐĚĂƚĂĞůĞŵĞŶƚƐǁŝƚŚŝŶƚŚĞƐLJƐƚĞŵĂŶĚŝĚĞŶƚŝĨLJĂŶĚͬŽƌƌĞƉŽƌƚ ĚŝƐĐƌĞƉĂŶĐŝĞƐ͘/ƚĞƌĂƚŝǀĞůLJ͕dLJůĞƌǁŝůůĐŽůůĂďŽƌĂƚĞǁŝƚŚŝƚLJƚŽĂĚĚƌĞƐƐĐŽŶǀĞƌƐŝŽŶĚŝƐĐƌĞƉĂŶĐŝĞƐ͘dŚŝƐƉƌŽĐĞƐƐǁŝůů ĂůůŽǁĨŽƌĐůĞĂŶ͕ƌĞĐŽŶĐŝůĞĚĚĂƚĂƚŽƚƌĂŶƐĨĞƌĨƌŽŵƚŚĞƐŽƵƌĐĞƐLJƐƚĞŵ;ƐͿƚŽƚŚĞdLJůĞƌƐLJƐƚĞŵ;ƐͿ͘ ĂƚĂŽŶǀĞƌƐŝŽŶ^ƚĂŶĚĂƌĚƐΘZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ tŚŝůĞdLJůĞƌ͛ƐĚĂƚĂĞdžƉĞƌƚƐŚĂǀĞĞdžƚĞŶƐŝǀĞĞdžƉĞƌŝĞŶĐĞǁŝƚŚĚĂƚĂŵŝŶŝŶŐ͕ĐŽŶǀĞƌƐŝŽŶ͕ĂŶĚŵŝŐƌĂƚŝŽŶ͕ŝƚŝƐLJŽƵƌ ƌĞƐƉŽŶƐŝďŝůŝƚLJƚŽƉƌŽǀŝĚĞdLJůĞƌǁŝƚŚƌĞĂĚĂďůĞĐŽŶǀĞƌƐŝŽŶĚĂƚĂĂŶĚƚŽƌĞǀŝĞǁƚŚĞĐŽŶǀĞƌƚĞĚĚĂƚĂĨŽƌĂĐĐƵƌĂĐLJ ĂŶĚĐŽŵƉůĞƚĞŶĞƐƐ͘dLJůĞƌƌĞĐŽŵŵĞŶĚƐƚŚĂƚLJŽƵĐŽŶĚƵĐƚĚƵĞĚŝůŝŐĞŶĐĞƚŽĞŶƐƵƌĞƚŚĂƚLJŽƵƌƚĞĂŵĚĞůŝǀĞƌƐĐůĞĂŶ ĚĂƚĂ͕ƚŽŵĂŬĞĚĂƚĂǀĂůŝĚĂƚŝŽŶĞĨĨŽƌƚƐƐĞĂŵůĞƐƐƌĞƐƵůƚŝŶŐŝŶĂŚŝŐŚͲƋƵĂůŝƚLJŵŝŐƌĂƚŝŽŶ͘ &ŝŶĂŶĐŝĂůŽŶǀĞƌƐŝŽŶ^ƵŵŵĂƌLJ dŚŝƐĚŽĐƵŵĞŶƚŝƐĂƐƵŵŵĂƌLJŽĨǁŚĂƚŝƐŝŶĐůƵĚĞĚŝŶƚŚĞƐƚĂŶĚĂƌĚĐŽŶǀĞƌƐŝŽŶĨŽƌdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ&ŝŶĂŶĐŝĂů ^ƵŝƚĞ͘dŚŝƐŝƐŶŽƚĂĐŽŵƉůĞƚĞĚĞƐĐƌŝƉƚŝŽŶ͖ĨŽƌĂĐŽŵƉůĞƚĞĚĞƐĐƌŝƉƚŝŽŶ͕ƉůĞĂƐĞƌĞĨĞƌƚŽƚŚĞdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ &ŝŶĂŶĐŝĂůĂƚĂŽŶǀĞƌƐŝŽŶ^ƉĞĐŝĨŝĐĂƚŝŽŶĚŽĐƵŵĞŶƚĂǀĂŝůĂďůĞƵƉŽŶƌĞƋƵĞƐƚ͘/ƚĞŵƐŶŽƚůŝƐƚĞĚďĞůŽǁĂƌĞ ŐĞŶĞƌĂůůLJĂƐƐƵŵĞĚƚŽŶŽƚďĞĞůŝŐŝďůĞĨŽƌĞůĞĐƚƌŽŶŝĐĚĂƚĂĐŽŶǀĞƌƐŝŽŶǁŝƚŚ/ŶĐŽĚĞϭϬ͘ ůŝĞŶƚZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ xĂƚĂŝŶdLJůĞƌ͛Ɛ^ƚĂŶĚĂƌĚĂƚĂ>ĂLJŽƵƚƐŽƌĂƉƉƌŽǀĞĚĨŽƌŵĂƚƐ xWƌŽǀŝĚĞĚĂƚĂĚĞĨŝŶŝƚŝŽŶƐ xWƌŽǀŝĚĞƐĐƌĞĞŶƐŚŽƚƐ xZĞǀŝĞǁĐŽŶǀĞƌƐŝŽŶĚƵƌŝŶŐƐĞƚƵƉĂŶĚŐŽͲůŝǀĞ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϭ ĂƚĂŽŶǀĞƌƐŝŽŶ &ƵůůĚĞƉĞŶĚĞŶĐŝĞƐĂƌĞĚĞƚĂŝůĞĚŝŶƉƉĞŶĚŝdž͘ 'ĞŶĞƌĂů>ĞĚŐĞƌ ^ƚĂŶĚĂƌĚŽŶǀĞƌƐŝŽŶ/ŶĐůƵĚĞƐ͗ x&ƵůůĐŚĂƌƚŽĨĂĐĐŽƵŶƚƐůŝƐƚŝŶŐ͕ĚĞƐĐƌŝƉƚŝŽŶƐ͕ĂŶĚĐŽƌƌĞƐƉŽŶĚŝŶŐĂĐĐŽƵŶƚƚLJƉĞƐ xůĞŵĞŶƚ;ƐĞŐŵĞŶƚͿǀĂůƵĞƐĂŶĚĚĞƐĐƌŝƉƚŝŽŶƐ ĚĚŝƚŝŽŶĂů^ĞůĞĐƚŝŽŶƐ͗ xhŶůŝŵŝƚĞĚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐƉƌŽǀŝĚĞĚďLJĐůŝĞŶƚĐĂŶďĞĐŽŶǀĞƌƚĞĚďLJdLJůĞƌŝŶƚŽŚŝƐƚŽƌŝĐĂůǀŝĞǁƐ EKd͗^ƵŵŵĂƌŝnjĞĚďƵĚŐĞƚĨŝŐƵƌĞƐĨŽƌĐƵƌƌĞŶƚĨŝƐĐĂůLJĞĂƌĂŶĚŚŝƐƚŽƌŝĐĂůLJĞĂƌƐĐĂŶďĞŝŵƉŽƌƚĞĚŝŶƚŽƚŚĞƐLJƐƚĞŵ ĨƌŽŵdžĐĞů͘dŚĞĐůŝĞŶƚŝƐƵůƚŝŵĂƚĞůLJƌĞƐƉŽŶƐŝďůĞĨŽƌƉƌŽĚƵĐŝŶŐƚŚĞďƵĚŐĞƚĨŝŐƵƌĞƐŝŶdžĐĞůĂŶĚǀĞƌŝĨLJŝŶŐƚŚĞ ƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐǁŝůůďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽŝŵƉŽƌƚďƵĚŐĞƚƐĨƌŽŵdžĐĞů͘ EKd͗^ƵŵŵĂƌŝnjĞĚďĞŐŝŶŶŝŶŐďĂůĂŶĐĞƐŚĞĞƚĞŶƚƌŝĞƐ͕ĂƐǁĞůůĂƐƐƵŵŵĂƌŝnjĞĚĨŝƐĐĂůLJĞĂƌĂĐƚŝǀŝƚLJĞŶƚƌŝĞƐ͕ĐĂŶďĞ ŝŵƉŽƌƚĞĚŝŶƚŽƚŚĞƐLJƐƚĞŵĨƌŽŵdžĐĞůĨŽƌƚŚĞĐƵƌƌĞŶƚLJĞĂƌ͘dŚĞĐůŝĞŶƚŝƐƵůƚŝŵĂƚĞůLJƌĞƐƉŽŶƐŝďůĞĨŽƌƉƌŽĚƵĐŝŶŐ ƚŚĞĞŶƚƌŝĞƐŝŶdžĐĞůĂŶĚǀĞƌŝĨLJŝŶŐƚŚĞƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐǁŝůůďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽŝŵƉŽƌƚ:͛ƐĨƌŽŵdžĐĞů͘ EKd͗hŶůŝŵŝƚĞĚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐĐĂŶďĞŝŵƉŽƌƚĞĚŝŶƚŽ>ĞŐĂĐLJsŝĞǁƐ;ƐĞĞƉƉĞŶĚŝdžͿƵƐŝŶŐĂƐƚĂŶĚĂƌĚ ŝŵƉŽƌƚĂǀĂŝůĂďůĞƚŽƚŚĞĐůŝĞŶƚĨƌŽŵdžĐĞů͘dŚĞĐůŝĞŶƚǁŝůůƵůƚŝŵĂƚĞůLJďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĐƌĞĂƚŝŶŐƚŚĞdžĐĞů ƐƉƌĞĂĚƐŚĞĞƚĂŶĚǀĞƌŝĨLJŝŶŐƚŚĞƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐǁŝůůďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽŝŵƉŽƌƚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐĨƌŽŵ džĐĞů͘ ĐĐŽƵŶƚƐWĂLJĂďůĞ ^ƚĂŶĚĂƌĚŽŶǀĞƌƐŝŽŶ/ŶĐůƵĚĞƐ͗ xsĞŶĚŽƌŵĂƐƚĞƌŝŶĨŽƌŵĂƚŝŽŶ͕ĂĚĚƌĞƐƐ͕ƉƌŝŵĂƌLJĐŽŶƚĂĐƚ͕ĂŶĚŶŽƚĞƐ ĚĚŝƚŝŽŶĂů^ĞůĞĐƚŝŽŶƐ͗ xhŶůŝŵŝƚĞĚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐƉƌŽǀŝĚĞĚďLJĐůŝĞŶƚĐĂŶďĞĐŽŶǀĞƌƚĞĚďLJdLJůĞƌŝŶƚŽ>ĞŐĂĐLJsŝĞǁƐ EKd͗ϭϬϵϵďĂůĂŶĐĞƐĂŶĚŶŽŶͲϭϬϵϵďĂůĂŶĐĞƐĐĂŶďĞŝŵƉŽƌƚĞĚŝŶƚŽƚŚĞƐLJƐƚĞŵƵƐŝŶŐĂƐƚĂŶĚĂƌĚŝŵƉŽƌƚ ĂǀĂŝůĂďůĞƚŽƚŚĞĐůŝĞŶƚĨƌŽŵdžĐĞů͘dŚĞĐůŝĞŶƚǁŝůůƵůƚŝŵĂƚĞůLJďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĐƌĞĂƚŝŶŐƚŚĞdžĐĞůƐƉƌĞĂĚƐŚĞĞƚ ĂŶĚǀĞƌŝĨLJŝŶŐƚŚĞƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐǁŝůůďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽŝŵƉŽƌƚďĂůĂŶĐĞƐĨƌŽŵdžĐĞů͘ EKd͗hŶůŝŵŝƚĞĚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐĐĂŶďĞŝŵƉŽƌƚĞĚŝŶƚŽ>ĞŐĂĐLJsŝĞǁƐƵƐŝŶŐĂƐƚĂŶĚĂƌĚŝŵƉŽƌƚĂǀĂŝůĂďůĞ ƚŽƚŚĞĐůŝĞŶƚĨƌŽŵdžĐĞů͘dŚĞĐůŝĞŶƚǁŝůůƵůƚŝŵĂƚĞůLJďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĐƌĞĂƚŝŶŐƚŚĞdžĐĞůƐƉƌĞĂĚƐŚĞĞƚĂŶĚ ǀĞƌŝĨLJŝŶŐƚŚĞƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐǁŝůůďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽŝŵƉŽƌƚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐĨƌŽŵdžĐĞů͘ WĞƌƐŽŶŶĞůDĂŶĂŐĞŵĞŶƚ ^ƚĂŶĚĂƌĚŽŶǀĞƌƐŝŽŶ/ŶĐůƵĚĞƐ͗ xĂƐŝĐĞŵƉůŽLJĞĞŝŶĨŽƌŵĂƚŝŽŶʹĞŵƉůŽLJĞĞŵĂƐƚĞƌ͕ĂĚĚƌĞƐƐ͕ƉƌŝŵĂƌLJĐŽŶƚĂĐƚ͕ĚĂƚĞƐ͕ƉŚŽŶĞŶƵŵďĞƌƐ͕ ĚĞƉĞŶĚĞŶƚƐ͕ŶŽƚĞƐ xƵƌƌĞŶƚĚŝƌĞĐƚĚĞƉŽƐŝƚďĂŶŬŝŶĨŽƌŵĂƚŝŽŶ x&ĞĚĞƌĂůĂŶĚƐƚĂƚĞƚĂdžǁŝƚŚŚŽůĚŝŶŐŝŶĨŽƌŵĂƚŝŽŶ ĚĚŝƚŝŽŶĂůKƉƚŝŽŶƐ͗ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϮ xhŶůŝŵŝƚĞĚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐƉƌŽǀŝĚĞĚďLJĐůŝĞŶƚĐĂŶďĞĐŽŶǀĞƌƚĞĚďLJdLJůĞƌŝŶƚŽŚŝƐƚŽƌŝĐĂůǀŝĞǁƐ EKd͗ŵƉůŽLJĞĞƉŽƐŝƚŝŽŶƐĂŶĚĚĞĚƵĐƚŝŽŶƐǁŝůůďĞĐƌĞĂƚĞĚĂĐĐŽƌĚŝŶŐƚŽƚŚĞƌĞĐŽŵŵĞŶĚĞĚďĞƐƚďƵƐŝŶĞƐƐ ƉƌĂĐƚŝĐĞƐ͘ EKd͗ůŝĞŶƚƐŐŽŝŶŐůŝǀĞŽŶƉĂLJƌŽůůŵŝĚͲĐĂůĞŶĚĂƌLJĞĂƌǁŝůůŚĂǀĞƚŚĞŽƉƚŝŽŶƚŽŝŵƉŽƌƚŽƌĞŶƚĞƌƋƵĂƌƚĞƌůLJ ĞŵƉůŽLJĞĞƉĂLJƌŽůůŚŝƐƚŽƌLJƚŽŵĞĞƚĨĞĚĞƌĂůĂŶĚƐƚĂƚĞƌĞƉŽƌƚŝŶŐƌĞƋƵŝƌĞŵĞŶƚƐŐŝǀŝŶŐƚŚĞĂďŝůŝƚLJƚŽĐƌĞĂƚĞĂƐŝŶŐůĞ ƐĞƚŽĨtͲϮ͛ƐĂƚĐĂůĞŶĚĂƌLJĞĂƌĞŶĚ͘dŚĞĐůŝĞŶƚǁŝůůƵůƚŝŵĂƚĞůLJďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĞŶƚĞƌŝŶŐŝŶƚŚĞƋƵĂƌƚĞƌůLJ ĞŵƉůŽLJĞĞƉĂLJƌŽůůŚŝƐƚŽƌLJĂŶĚǀĞƌŝĨLJŝŶŐƚŚĞƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐǁŝůůďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽĞŶƚĞƌŝŶƚŚŝƐ ŝŶĨŽƌŵĂƚŝŽŶ͘ EKd͗hŶůŝŵŝƚĞĚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐĐĂŶďĞŝŵƉŽƌƚĞĚŝŶƚŽ>ĞŐĂĐLJsŝĞǁƐƵƐŝŶŐĂƐƚĂŶĚĂƌĚŝŵƉŽƌƚĂǀĂŝůĂďůĞ ƚŽƚŚĞĐůŝĞŶƚĨƌŽŵdžĐĞů͘dŚĞĐůŝĞŶƚǁŝůůƵůƚŝŵĂƚĞůLJďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĐƌĞĂƚŝŶŐƚŚĞdžĐĞůƐƉƌĞĂĚƐŚĞĞƚĂŶĚ ǀĞƌŝĨLJŝŶŐƚŚĞƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐǁŝůůďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽŝŵƉŽƌƚŚŝƐƚŽƌŝĐĂůƚƌĂŶƐĂĐƚŝŽŶƐĨƌŽŵdžĐĞů͘ &ŝdžĞĚƐƐĞƚƐ EKd͗&ŝdžĞĚĂƐƐĞƚƐĐĂŶŝŵƉŽƌƚĞĚŝŶƚŽƚŚĞƐLJƐƚĞŵƵƐŝŶŐĂƐƚĂŶĚĂƌĚŝŵƉŽƌƚĂǀĂŝůĂďůĞƚŽƚŚĞĐůŝĞŶƚĨƌŽŵdžĐĞů͘ dŚĞĐůŝĞŶƚǁŝůůƵůƚŝŵĂƚĞůLJďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĐƌĞĂƚŝŶŐƚŚĞdžĐĞůƐƉƌĞĂĚƐŚĞĞƚĂŶĚǀĞƌŝĨLJŝŶŐƚŚĞƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐ ǁŝůůďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽŝŵƉŽƌƚĂƐƐĞƚƐĨƌŽŵdžĐĞů͘ /ŶǀĞŶƚŽƌLJ EKd͗/ŶǀĞŶƚŽƌLJĐĂŶŝŵƉŽƌƚĞĚŝŶƚŽƚŚĞƐLJƐƚĞŵƵƐŝŶŐĂƐƚĂŶĚĂƌĚŝŵƉŽƌƚĂǀĂŝůĂďůĞƚŽƚŚĞĐůŝĞŶƚĨƌŽŵdžĐĞů͘dŚĞ ĐůŝĞŶƚǁŝůůƵůƚŝŵĂƚĞůLJďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĐƌĞĂƚŝŶŐƚŚĞdžĐĞůƐƉƌĞĂĚƐŚĞĞƚĂŶĚǀĞƌŝĨLJŝŶŐƚŚĞƌĞƐƵůƚƐ͘dƌĂŝŶŝŶŐǁŝůů ďĞƉƌŽǀŝĚĞĚŽŶŚŽǁƚŽŝŵƉŽƌƚŝŶǀĞŶƚŽƌLJŝƚĞŵƐĨƌŽŵdžĐĞů͘ ƉƉůŝĐĂƚŝŽŶƐŶŽƚĐŽŶǀĞƌƚĞĚ xtŽƌŬKƌĚĞƌƐ xĂŶŬZĞĐŽŶĐŝůŝĂƚŝŽŶ xŵƉůŽLJĞĞ^ĞůĨ^ĞƌǀŝĐĞƐͬdŝŵĞΘƚƚĞŶĚĂŶĐĞ xWƌŽũĞĐƚĐĐŽƵŶƚŝŶŐ xWƵƌĐŚĂƐĞKƌĚĞƌƐ ƵƐƚŽŵŽŶǀĞƌƐŝŽŶ^ĞƌǀŝĐĞƐ dŚĞĨŽůůŽǁŝŶŐĂƌĞĂĨĞǁĞdžĂŵƉůĞƐŽĨŝƚĞŵƐƚŚĂƚĂƌĞŶŶŽƚŝŶĐůƵĚĞĚŝŶƚŚĞƐƚĂŶĚĂƌĚĐŽŶǀĞƌƐŝŽŶĂŶĚĐĂŶďĞ ĂĚĚƌĞƐƐĞĚƚŚƌŽƵŐŚĐƵƐƚŽŵĐŽŶǀĞƌƐŝŽŶƐĞƌǀŝĐĞƐ͗ xĂƚĂĐůĞĂŶŝŶŐ͖ŝŶĐůƵĚŝŶŐďƵƚŶŽƚůŝŵŝƚĞĚƚŽŶĂŵĞĐůĞĂŶͲƵƉĂŶĚĚĂƚĂĨŝdžĞƐ xŽŶǀĞƌƚŝŶŐĨƌŽŵŵƵůƚŝƉůĞƐŽƵƌĐĞƐŽĨĚĂƚĂ xdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĂƐƐŝƐƚŝŶŐŝŶĚĂƚĂĞdžƚƌĂĐƚŝŽŶĨƌŽŵLJŽƵƌĞdžŝƐƚŝŶŐƐLJƐƚĞŵ xdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĚĞĨŝŶŝŶŐĨŝůĞůĂLJŽƵƚƐŝĨŶŽƚƉƌŽǀŝĚĞĚ xŚĂŶŐŝŶŐĐŽŶĨŝŐƵƌĂƚŝŽŶĂĨƚĞƌƐŝŐŶͲŽĨĨ xŽŶǀĞƌƚŝŶŐƉĞƌƐŽŶŶĞů,ZŝŶĨŽƌŵĂƚŝŽŶ ĂƚĂdžƚƌĂĐƚ dŚĞƐƚĂŶĚĂƌĚĐŽŶǀĞƌƐŝŽŶŝŶĐůƵĚĞƐĐŽŶǀĞƌƚŝŶŐĨƌŽŵĂƐŝŶŐůĞƐŽƵƌĐĞŽĨĚĂƚĂ͘/ĨĚĂƚĂŝƐƐƚŽƌĞĚŝŶŵƵůƚŝƉůĞ ĚĂƚĂďĂƐĞƐŽƌĚĂƚĂŝƐƉƌŽǀŝĚĞĚŝŶŵƵůƚŝƉůĞĨŽƌŵĂƚƐĐƵƐƚŽŵĐŽŶǀĞƌƐŝŽŶƐĞƌǀŝĐĞƐŵĂLJďĞƌĞƋƵŝƌĞĚ͘/ĨƵŶĂďůĞƚŽ ƉƌŽǀŝĚĞƚŚĞĚĂƚĂŝŶdLJůĞƌ͛Ɛ^ƚĂŶĚĂƌĚĂƚĂ>ĂLJŽƵƚƐLJŽƵƌĚĂƚĂǁŝůůŶĞĞĚƚŽďĞƉƌŽǀŝĚĞĚŝŶŽŽŶĞŽĨƚŚĞĨŽůůŽǁŝŶŐ ĨŽƌŵĂƚƐ͗ xDŝĐƌŽƐŽĨƚ^Y>^ĞƌǀĞƌĚĂƚĂďĂƐĞ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϯ xDŝĐƌŽƐŽĨƚĐĐĞƐƐĚĂƚĂďĂƐĞ xĞůŝŵŝƚĞĚ^//ƚĞdžƚĨŝůĞƐǁŝƚŚŚĞĂĚĞƌƐ;ƉŝƉĞͮ͟͞ĚĞůŝŵŝƚĞĚŝƐƉƌĞĨĞƌƌĞĚͿ xdžĐĞůƐƉƌĞĂĚƐŚĞĞƚƐʹǁŝƚŚĨůĂƚĚĂƚĂĂŶĚŚĞĂĚĞƌƐ͕ŶŽƚŐƌŽƵƉĞĚůŝŬĞĂƌĞƉŽƌƚ dŽĞŶƐƵƌĞƚŚĂƚŶŽĚĂƚĂŝƐĐŽƌƌƵƉƚĞĚ͕ƐƚĂĨĨƐŚŽƵůĚĞdžŝƚƚŚĞƐŽĨƚǁĂƌĞƉƌŝŽƌƚŽƉƵůůŝŶŐƚŚĞĚĂƚĂĂŶĚƌĞƐƚƌŝĐƚ ƉƌŽĐĞƐƐŝŶŐŽĨĂŶLJƚƌĂŶƐĂĐƚŝŽŶƐĚƵƌŝŶŐƚŚŝƐƚŝŵĞ͘ /ƚŝƐŝŵƉŽƌƚĂŶƚƚŽƵŶĚĞƌƐƚĂŶĚƚŚĂƚƚŚĞĐŽŶǀĞƌƐŝŽŶǁŝůůŶŽƚ͞ƌĞŚĂďŝůŝƚĂƚĞ͟ŽůĚĚĂƚĂ͘dŚĞĐŽŶǀĞƌƐŝŽŶƉƌŽĐĞƐƐ ĚŽĞƐŶŽƚĐůĞĂŶƵƉŽƌĐŽƌƌĞĐƚƉƌŽďůĞŵƐŝŶŽůĚĚĂƚĂ͖ĚĂƚĂŝƐĐŽŶǀĞƌƚĞĚŽŶĞĨŽƌŽŶĞ͘&ŽƌĞdžĂŵƉůĞ͕ŝĨƚŚĞĐƵƌƌĞŶƚ ƐLJƐƚĞŵĂůůŽǁĞĚƉƵŶĐƚƵĂƚŝŽŶ͕ƚŚĞŶĞǁƐŽĨƚǁĂƌĞǁŝůůĂůƐŽĚŝƐƉůĂLJĚĂƚĂǁŝƚŚƚŚĞĞdžĂĐƚƐĂŵĞƉƵŶĐƚƵĂƚŝŽŶĂĨƚĞƌ ƚŚĞĐŽŶǀĞƌƐŝŽŶ͘/ĨĚĂƚĂŵĂŶŝƉƵůĂƚŝŽŶŝƐĚĞƐŝƌĞĚ͕ƉůĞĂƐĞĐŽŶƚĂĐƚLJŽƵƌWƌŽũĞĐƚDĂŶĂŐĞƌƚŽĂƐƐŝƐƚŝŶƉƌĞƉĂƌŝŶŐĂ ǁŽƌŬŽƌĚĞƌĨŽƌƚŚĞƐĞƐĞƌǀŝĐĞƐ͘ ƵƉůŝĐĂƚĞŶƚƌLJ hŶůĞƐƐŽƚŚĞƌǁŝƐĞŶŽƚĞĚ͕ŝƚŝƐĂƐƐƵŵĞĚĂůůĚĂƚĂĐŽŶǀĞƌƐŝŽŶĞůĞŵĞŶƚƐǁŝůůďĞĐŽŶǀĞƌƚĞĚŽŶĐĞ͘tŚŝůĞƚŚĞƚŝŵŝŶŐ ŽĨĞĂĐŚĚĂƚĂĐŽŶǀĞƌƐŝŽŶĞůĞŵĞŶƚǁŝůůďĞƐĐŚĞĚƵůĞĚŽƵƚďĞƚǁĞĞŶƚŚĞůŝĞŶƚĂŶĚdLJůĞƌ͛ƐWƌŽũĞĐƚDĂŶĂŐĞƌƐ͕ŽŶĐĞ ĂŶĞůĞŵĞŶƚŚĂƐďĞĞŶĐŽŶǀĞƌƚĞĚĂŶĚĚĞůŝǀĞƌĞĚ͕ŝƚǁŝůůŶŽƚďĞĐŽŶǀĞƌƚĞĚĂŐĂŝŶĂŶĚĚƵƉůŝĐĂƚĞĞŶƚƌLJďĞƚǁĞĞŶƚŚĞ ĐƵƌƌĞŶƚůĞŐĂĐLJƐLJƐƚĞŵĂŶĚ/ŶĐŽĚĞϭϬǁŝůůďĞƌĞƋƵŝƌĞĚĨŽƌĂƉĞƌŝŽĚŽĨƚŝŵĞƵŶƚŝů/ŶĐŽĚĞϭϬďĞĐŽŵĞƐƚŚĞůŝǀĞ ƐLJƐƚĞŵŽĨƌĞĐŽƌĚ͘ ^ĞĐƚŝŽŶϰ͘ϬͲ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϰ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϱ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ 7KHSURSRVDOVKRXOGVSHFLI\WKHQDWXUHRIDQ\SRVWLPSOHPHQWDWLRQDQGRQJRLQJ VXSSRUWLQFOXGLQJKRVWLQJ VHUYLFHVSURYLGHGE\WKHYHQGRULQFOXGLQJ ($WWDFKPHQW7HFKQLFDO6SHFLILFDWLRQV x7HFKQLFDO6SHFLILFDWLRQV x5HTXLUHG/LFHQVHV x'RHVWKH3URSRVHG6\VWHP5HTXLUH WKDWWKH*RYHUQPHQWLQVWDOOVRIWZDUH" x<HV1R x3URYLGHIXOOGRFXPHQWDWLRQRIWHFKQLFDO VSHFLILFDWLRQVDQGUHTXLUHPHQWVQHFHVVDU\WRKRVW WKHV\VWHP(vendors can submit documentation in alternate format and attach to this page.) WůĞĂƐĞƐĞĞdLJůĞƌ͛ƐƐƉĞĐŝĨŝĐĂƚŝŽŶĨŽƌ,ŽƐƚĞĚĂŶĚKŶ WƌĞŵŝƐĞƐŽůƵƚŝŽŶŚĂƌĚǁĂƌĞƌĞƋƵŝƌĞŵĞŶƚƐůŝƐƚĞĚ ďĞůŽǁŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚĞZ&WZĞƐƉŽŶƐĞ͘ x+DUGZDUH6HUYHU'DWDEDVH5HTXLUHPHQWVWůĞĂƐĞƐĞĞdLJůĞƌ͛ƐƐƉĞĐŝĨŝĐĂƚŝŽŶĨŽƌ,ŽƐƚĞĚĂŶĚKŶ WƌĞŵŝƐĞƐŽůƵƚŝŽŶŚĂƌĚǁĂƌĞƌĞƋƵŝƌĞŵĞŶƚƐůŝƐƚĞĚ ďĞůŽǁŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚĞZ&WZĞƐƉŽŶƐĞ͘ x'HVNWRS&OLHQW5HTXLUHPHQWVWůĞĂƐĞƐĞĞdLJůĞƌ͛ƐƐƉĞĐŝĨŝĐĂƚŝŽŶĨŽƌ,ŽƐƚĞĚĂŶĚKŶ WƌĞŵŝƐĞƐŽůƵƚŝŽŶŚĂƌĚǁĂƌĞƌĞƋƵŝƌĞŵĞŶƚƐůŝƐƚĞĚ ďĞůŽǁŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚĞZ&WZĞƐƉŽŶƐĞ͘ x0RELOH5HTXLUHPHQWVWůĞĂƐĞƐĞĞdLJůĞƌ͛ƐƐƉĞĐŝĨŝĐĂƚŝŽŶĨŽƌ,ŽƐƚĞĚĂŶĚKŶ WƌĞŵŝƐĞƐŽůƵƚŝŽŶŚĂƌĚǁĂƌĞƌĞƋƵŝƌĞŵĞŶƚƐůŝƐƚĞĚ ďĞůŽǁŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚĞZ&WZĞƐƉŽŶƐĞ͘ x%XVLQHVV,QWHOOLJHQFH x'HVFULEHKRZEXVLQHVVLQWHOOLJHQFHWRROV RSHUDWH DQGLIWKH*RYHUQPHQWZRXOGEHDEOHWR OHYHUDJHWRROVIRUQRQ(53GDWD dLJůĞƌƐŽůƵƚŝŽŶƐŚĂǀĞŶƵŵďĞƌŽĨďƵŝůƚŝŶƉƌŽŐƌĂŵƐ ĂŶĚƚŽŽůƐĨŽƌĂƉƉůŝĐĂƚŝŽŶďĂƐĞĚĂĚŵŝŶŝƐƚƌĂƚŝŽŶ͕ ĐŽŶĨŝŐƵƌĂƚŝŽŶ͕ŵŽŶŝƚŽƌŝŶŐ͕ĂŶĚĚĞďƵŐŐŝŶŐ͘^LJƐƚĞŵ ĚŵŝŶŝƐƚƌĂƚŽƌ͛ƐŵĞŶƵŽƉƚŝŽŶƐŝŶĐůƵĚĞƐĞƚƵƉ ƉƌŽŐƌĂŵƐ͕ƉĂƌĂŵĞƚĞƌĨŝůĞƐ͕ƉƌŽŐƌĂŵĂĐƚŝǀŝƚLJůŽŐƐ͕ ĂŶĚĚŝĂŐŶŽƐƚŝĐĂŶĚƌƵŶƚŝŵĞŝŶĨŽƌŵĂƚŝŽŶƵƚŝůŝƚŝĞƐ͘ x'RHVWKHUHSRUWZULWHUXWLOL]HDVHSDUDWH GDWDEDVH" EŽ x6HFXULW\ x'HVFULEHGDWDEDVHVHFXULW\ǀĞƌLJĐůŝĞŶƚŚĂƐŝƚƐŽǁŶƐĞƉĂƌĂƚĞĚĂƚĂďĂƐĞĨŽƌƚŚĞŝƌ ĚĂƚĂ͘KƵƌĂƚĂďĂƐĞƐĞƌǀĞƌƐĂƌĞůŽĐŬĞĚĚŽǁŶƐŽŽŶůLJ ŶĞĐĞƐƐĂƌLJƉĞŽƉůĞǁŝƚŚƉƌŽƉĞƌĂĐĐĞƐƐŚĂƐĂĐĐĞƐƐƚŽ ƚŚĞŵ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϲ x'HVFULEHDSSOLFDWLRQVHFXULW\dLJůĞƌ͛Ɛ/ŶĐŽĚĞƐŽůƵƚŝŽŶƵƐĞƐƚŚĞdƌƵƐƚĞĚ^ĞĐƵƌŝƚLJ DŽĚĞůďĂƐĞĚŽŶDŝĐƌŽƐŽĨƚtŝŶĚŽǁƐΠƉŚŝůŽƐŽƉŚLJ͘ dŚŝƐŵĞĂŶƐŽŶĐĞĂƵƐĞƌůŽŐƐŝŶƚŽŚŝƐͰŚĞƌŽƉĞƌĂƚŝŶŐ ƐLJƐƚĞŵ͕/ŶĐŽĚĞ͛ƐƐLJƐƚĞŵƐĞĐƵƌŝƚLJǁŝůůĂƵƚŽŵĂƚŝĐĂůůLJ ƌĞĐŽŐŶŝnjĞƚŚĞŝŶĚŝǀŝĚƵĂů͘ ^ĞĐƵƌŝƚLJǁŝƚŚŝŶƚŚĞƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚƐďŽƚŚ ŝŶĚŝǀŝĚƵĂůĂŶĚŐƌŽƵƉƉĞƌŵŝƐƐŝŽŶƐƐŝŵƵůƚĂŶĞŽƵƐůLJ͘ dŚĞƐĞƉĞƌŵŝƐƐŝŽŶƐĐĂŶďĞĂƐƐŝŐŶĞĚƚŽŝŶĚŝǀŝĚƵĂů ĂƉƉůŝĐĂƚŝŽŶƐĂŶĚƉƌŽŐƌĂŵƐǁŝƚŚŝŶĂƉƉůŝĐĂƚŝŽŶƐ͘dŚĞ ƐŽĨƚǁĂƌĞĂůƐŽƚƌĂĐŬƐǁŚŝĐŚƉƌŽŐƌĂŵƐĂƌĞĞdžĞĐƵƚĞĚ ĂŶĚďLJǁŚŽŵ͘dŚĞƐLJƐƚĞŵůŽŐƐŝŶĨŽƌŵĂƚŝŽŶƐƵĐŚĂƐ ĚĂƚĞ͕ƚŝŵĞ͕ƵƐĞƌ͕ƉƌŽŐƌĂŵŶĂŵĞ͕ĂŶĚƐLJƐƚĞŵ ŵĞƐƐĂŐĞĨŽƌĞĂĐŚĞŶƚƌLJ͘KƚŚĞƌƐĞĐƵƌŝƚLJŽƉƚŝŽŶƐ ĂǀĂŝůĂďůĞŝŶĂŶƵŵďĞƌŽĨ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐŝŶĐůƵĚĞ ĨƵŶĚ͕ĚĞƉĂƌƚŵĞŶƚ͕ƌĞĐŽƌĚ͕ƚĂď͕ĂŶĚĨŝĞůĚ͘ x,VV\VWHPFRPSDWLEOHZLWKVLQJOHVLJQRQ"zĞƐ ($WWDFKPHQW6RIWZDUHDVD6HUYLFHV+RVWLQJ $WWDFKDGGLWLRQDOSDJHVLIQHFHVVDU\ x$OWHUQDWLYH'HOLYHU\2SWLRQV x2SWLRQV x,VV\VWHPDYDLODEOHWKURXJKDKRVWHG PRGHO*RYHUQPHQWRZQVOLFHQVHDQG V\VWHPLPSOHPHQWHGRQGHGLFDWHGVLQJOH WHQDQWHQYLURQPHQW x<HV1R x,VWKHV\VWHPDYDLODEOHWKURXJK6DD6 PRGHO*RYHUQPHQWSD\VVXEVFULSWLRQIHHDQG V\VWHPLPSOHPHQWHGLQPXOWLWHQDQW x<HV1R x,VWKHV\VWHPDYDLODEOHWKURXJKD PDQDJHGVHUYLFHVPRGHO*RYHUQPHQWRZQV DQGKRVWVV\VWHPYHQGRUPDLQWDLQVV\VWHP x<HV1R x:KHUHLVWKHGDWDFHQWHUDQGGLVDVWHU UHFRYHU\GDWDFHQWHUORFDWHG" &ĂůŵŽƵƚŚ͕D͕ĂŶĚĂůůĂƐ͕dy x1HWZRUN%DQGZLGWK x,I$63RU6DD6ZKDWDUHWKHLQWHUQHW EDQGZLGWKUHTXLUHPHQWVIRURSWLPDO SHUIRUPDQFH" 'ŝŐĂďŝƚƚŚĞƌŶĞƚ x&RQWUDFW x'HVFULEHDQ\PLQLPXPFRQWUDFWSHULRGV H[DPSOH0LQLPXPRI\HDU ^ĂĂ^ĂŐƌĞĞŵĞŶƚŝƐďĂƐĞĚƵƉŽŶĂϱLJĞĂƌĂŐƌĞĞŵĞŶƚ͘ x'RHVYHQGRUFRQWUDFWSURYLGHIRUSULFH LQFUHDVHVDERYHSHU\HDUIRU\HDUV dŚĞƉƌŽƉŽƐĞĚĂŶŶƵĂů^ĂĂ^ĂŐƌĞĞŵĞŶƚŝƐďĂƐĞĚ ƵƉŽŶϱLJĞĂƌƐĂŶĚǁŝůůŶŽƚŝŶĐƌĞĂƐĞƵŶƚŝůƚŚĞƌĞĂĨƚĞƌ x$IWHU FRQWUDFW SHULRG LV LW SRVVLEOH WR WUDQVLWLRQWR VHOIKRVWHGPRGHO"'HVFULEHZKDWLV UHTXLUHGIRUWUDQVLWLRQDQGFRVW dŚĞŝƚLJĐĂŶĂůǁĂLJƐƚƌĂŶƐŝƚŝŽŶĨƌŽŵ^ĂĂ^ƚŽĂŶ KŶWƌĞŵŝƐĞ^ŽůƵƚŝŽŶ͘dŚĞŝƚLJǁŝůůŽǁŶƚŚĞůŝĐĞŶƐĞ ĨĞĞƐƐŽƚŚĞƌĞƐŚŽƵůĚŽŶůLJďĞƐĞƌǀŝĐĞĐŽƐƚƐ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϳ x'RHVYHQGRUFRQWUDFWFDSSULFHLQFUHDVH WROHVVWKDQIRU\HDUV dŚĞ^ĂĂ^ŶŶƵĂůĨĞĞŝŶƚŚĞƉƌŽƉŽƐĂůǁŝůůďĞůŽĐŬĞĚ ŝŶĨŽƌƚŚĞϱLJĞĂƌĂŐƌĞĞŵĞŶƚĂŶĚƚŚĞƌĞĂĨƚĞƌǁŝůůŐŽ ƚŽƚŚĞƚŚĞŶĐƵƌƌĞŶƚƌĂƚĞƐ͘ x3URSRVHG6HUYLFHV x1XPEHURIGDWDEDVHLQVWDQFHVSOHDVHOLVWϮ x'HVFULEHSURSRVHGGLVDVWHUUHFRYHU\VHUYLFHV dLJůĞƌďĂĐŬƐƵƉĂůůƐLJƐƚĞŵΘĚĂƚĂĨŝůĞƐĂŶĚƐƚŽƌĞƐ ƚŚĞŵŝŶĂƐĞĐƵƌĞŽĨĨͲƐŝƚĞůŽĐĂƚŝŽŶ͘tĞŚĂǀĞĨƵůůLJ ƌĞĚƵŶĚĂŶƚƚĞůĞĐŽŵŵƵŶŝĐĂƚŝŽŶƐĂĐĐĞƐƐ͕ĞůĞĐƚƌŝĐĂů ƉŽǁĞƌ͕ĂŶĚƌĞƋƵŝƌĞĚŚĂƌĚǁĂƌĞƚŽƉƌŽǀŝĚĞĂĐĐĞƐƐƚŽ ƚŚĞDƵŶŝƐĂƉƉůŝĐĂƚŝŽŶƐŝŶƚŚĞĞǀĞŶƚŽĨĂĚŝƐĂƐƚĞƌŽƌ ĐŽŵƉŽŶĞŶƚĨĂŝůƵƌĞ͘ x'HVFULEHSURSRVHGDSSOLFDWLRQDYDLODELOLW\ VHUYLFHOHYHO WůĞĂƐĞƐĞĞdLJůĞƌ͛Ɛ^>ƚŚĂƚŝƐŝŶĐůƵĚĞĚŝŶŽƵƌ ƐƚĂŶĚĂƌĚƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐůŽĐĂƚĞĚŝŶƚŚŝƐZ&W ZĞƐƉŽŶƐĞ͘ x6XSSRUW x'HVFULEHRSHUDWLRQVVXSSRUWWůĞĂƐĞƐĞĞdLJůĞƌ͛ƐƐƚĂŶĚĂƌĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐůŝƐƚĞĚ ďĞůŽǁŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚŝƐZ&WZĞƐƉŽŶƐĞ͘ x'HVFULEHEDFNXSSURFHGXUHVDQGWHVWLQJ RIEDFNXSVDQGRWKHUTXDOLW\DVVXUDQFHSURFHVVHV WRHQVXUHWKHEDFNXSLVZRUNLQJFRUUHFWO\ ,ŽƐƚŝŶŐKƉĞƌĂƚŝŽŶƐĨŽůůŽǁƐƐĞĐƵƌŝƚLJďĞƐƚƉƌĂĐƚŝĐĞƐ ĚŝĐƚĂƚĞĚĂŶĚĚĞĨŝŶĞĚďLJƚŚĞƚŚƌĞĞĂƐƐƵƌĂŶĐĞĂƵĚŝƚƐ ƚŚĂƚdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĂƌĞƐƵďũĞĐƚƚŽ͘^KyͲϰϬϰ &ŝŶĂŶĐŝĂůĂŶĚ/d'ĞŶĞƌĂůŽŶƚƌŽůƐ͕W/^ĞĐƵƌŝƚLJ ŽƵŶĐŝůWͲ^^ͬW/Ͳ^^͕ĂŶĚƚŚĞ/W^^Ͳϭϲ ^KϭdLJƉĞϮ͘ x'HVFULEHSURFHVVIRULQVWDOOLQJ SDWFKHVDQGXSGDWHV WĂƚĐŚĞƐĂƌĞƌĞůĞĂƐĞĚǁĞĞŬůLJĂƐŶĞĞĚĞĚƚŽĂĚĚƌĞƐƐ ŝƐƐƵĞƐƚŚĂƚĂƌŝƐĞďĞƚǁĞĞŶŵŽŶƚŚůLJƉĂƚĐŚĞƐ͘/ĨĂŶ ƵƌŐĞŶƚďƵŐĨŝdžŽƌƐĞĐƵƌŝƚLJĨŝdžŝƐŶĞĞĚĞĚ͕dLJůĞƌǁŝůů ĐŽŽƌĚŝŶĂƚĞƚŚĞƌĞůĞĂƐĞŽĨƚŚĂƚĨŝdžǁŝƚŚƚŚĞĐůŝĞŶƚ ďĂƐĞŽŶĂĐĂƐĞďLJĐĂƐĞďĂƐŝƐ͘ x'HVFULEHSURFHVVIRUUROOEDFNRISDWFKHV DQGXSGDWHVLIPDMRUIXQFWLRQDOLW\LVEURNHQDVD UHVXOWRIWKHSDWFKDQGRUXSGDWH /ĨĂƉĂƚĐŚŽƌƵƉĚĂƚĞŶĞĞĚƐƚŽďĞƌŽůůĞĚďĂĐŬ͕ƚŚĞ ƉƌĞǀŝŽƵƐůLJŝŶƐƚĂůůĞĚĐŽĚĞŝƐƌĞŝŶƐƚĂůůĞĚ͘ 'HVFULEHSURSRVHGVHUYLFHVIRUKRVWLQJLQFOXGLQJ x,QIRUPDWLRQRQWKHVSHFLILFKRVWLQJVHUYLFHVSURYLGHG x+HOSGHVNVXSSRUWVHUYLFHV x$SSOLFDWLRQVXSSRUW x2SHUDWLRQDOVXSSRUWVHUYLFHV x7HFKQRORJ\LQIUDVWUXFWXUHVHUYLFHV x'LVDVWHUUHFRYHU\ x:LOODOOSURGXFWVLQFOXGLQJWKLUGSDUW\SURGXFWVEHKRVWHGWKURXJKWKHVDPHSURYLGHU" x:LOOWKH*RYHUQPHQWQHHGWRKRVWDQ\WKLQJRQLWVVHUYHUV" dLJůĞƌ^ĂĂ^^ŽůƵƚŝŽŶ tŝƚŚŽƵƌdLJůĞƌͲŽǁŶĞĚĂŶĚŽƉĞƌĂƚĞĚƐLJƐƚĞŵ͕ǁĞǁŝůůŚŽƐƚĂŶĚŵĂŶĂŐĞLJŽƵƌdLJůĞƌƐŽĨƚǁĂƌĞĂƉƉůŝĐĂƚŝŽŶƐĨƌŽŵ ŽƵƌĨĂĐŝůŝƚŝĞƐ͘tĞǁŝůůƉƌŽǀŝĚĞƚŚĞŽŶŐŽŝŶŐƐƵƉƉŽƌƚ͕ŵĂŝŶƚĞŶĂŶĐĞ͕ĂŶĚƵƉŐƌĂĚĞƐŽĨƚŚĞĂƉƉůŝĐĂƚŝŽŶƐ͕ŚĂƌĚǁĂƌĞ͕ ĂŶĚŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵƐ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϴ tŝƚŚƚŚŝƐƐŽůƵƚŝŽŶLJŽƵƌĞĐĞŝǀĞĐůĞĂƌ͕ĐŽŶĐŝƐĞĚŽĐƵŵĞŶƚĂƚŝŽŶ͕ĚĞĨŝŶŝŶŐĂůůĂƐƉĞĐƚƐŽĨƚŚĞƌĞůĂƚŝŽŶƐŚŝƉ͘zŽƵǁŝůů ƌĞĐĞŝǀĞĂŽŶƚƌĂĐƚĂŶĚ^ĞƌǀŝĐĞ>ĞǀĞůŐƌĞĞŵĞŶƚƐƚĂƚŝŶŐŵĞĂƐƵƌĂďůĞĞdžƉĞĐƚĂƚŝŽŶƐŽĨƉĞƌĨŽƌŵĂŶĐĞ͘ ĞŶĞĨŝƚƐŽĨĂ,ŽƐƚĞĚ^ŽůƵƚŝŽŶ dŚĞŽǀĞƌͲƌŝĚŝŶŐďĞŶĞĨŝƚƚŽĐůŝĞŶƚƐŝƐƚŚĞĂďŝůŝƚLJƚŽŚĂǀĞŽƚŚĞƌƐŽƵƚƐŝĚĞƚŚĞŝƌŽƌŐĂŶŝnjĂƚŝŽŶŵĂŶĂŐĞĂŶĚ ĂĚŵŝŶŝƐƚĞƌƚŚĞĞdžƉĞŶƐŝǀĞĂŶĚĐŽŵƉůĞdžĐŽŵƉƵƚŝŶŐĞŶǀŝƌŽŶŵĞŶƚƐƵƐĞĚƚŽĚĂLJͶƐŽŵĞƚŚŝŶŐƚŚĂƚŝƐŝŶĐƌĞĂƐŝŶŐůLJ ŝŵƉŽƌƚĂŶƚƚŽŽƵƌĐůŝĞŶƚƐ͘ DŽƌĞĂŶĚŵŽƌĞŽƌŐĂŶŝnjĂƚŝŽŶƐůŝŬĞLJŽƵƌƐĂƌĞƚƵƌŶŝŶŐƚŽ^ĂĂ^ĂŶĚŽƚŚĞƌĐůŽƵĚĐŽŵƉƵƚŝŶŐƐĞƌǀŝĐĞƐďĞĐĂƵƐĞŽĨ ƚŚŝƐďĞŶĞĨŝƚͶƌĞĚƵĐŝŶŐůĂƌŐĞƵƉĨƌŽŶƚŚĂƌĚǁĂƌĞ͕ƐŽĨƚǁĂƌĞ͕ƐĞƌǀĞƌ͕ĂŶĚůŝĐĞŶƐŝŶŐĐŽƐƚƐĂŶĚĞůŝŵŝŶĂƚŝŶŐƚŚĞŝƌ ƌĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌŵĂŝŶƚĂŝŶŝŶŐĚĂƚĂďĂƐĞƐŽƌŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵƐ͘ĐĐŽƌĚŝŶŐƚŽĂƌƌĞůůtĞƐƚ͕ĚŝƌĞĐƚŽƌŽĨƚŚĞ ĞŶƚĞƌĨŽƌdĞĐŚŶŽůŽŐLJ/ŶŶŽǀĂƚŝŽŶĂƚƚŚĞƌŽŽŬŝŶŐƐ/ŶƐƚŝƚƵƚŝŽŶ͕ĂůĂƌŐĞƉĞƌĐĞŶƚĂŐĞŽĨƉƵďůŝĐƐĞĐƚŽƌ/dĐŽƐƚƐŐĞƚ ƐƵŶŬŝŶƚŽŚĂƌĚǁĂƌĞ͕ƐŽĨƚǁĂƌĞ͕ĂŶĚƐƚŽƌĂŐĞ͘ dLJůĞƌĂƚĂĞŶƚĞƌ dLJůĞƌŵĂŝŶƚĂŝŶƐƚǁŽ^ĂĂ^ĚĂƚĂĐĞŶƚĞƌƐŽƉĞƌĂƚŝŶŐƵŶĚĞƌĂĐŽŶƚŝŶƵŽƵƐŝŵƉƌŽǀĞŵĞŶƚŵŽĚĞůǁŚĞƌĞďLJƚŚĞ ŚĂƌĚǁĂƌĞ͕ƐŽĨƚǁĂƌĞĂŶĚƚĞĐŚŶŝĐĂůŝŶĨƌĂƐƚƌƵĐƚƵƌĞĂƌĞĐŽŶƐƚĂŶƚůLJďĞŝŶŐƌĞǀŝĞǁĞĚĂŶĚŽƉƚŝŵŝnjĞĚĨŽƌ ƉĞƌĨŽƌŵĂŶĐĞĂŶĚƐƚĂďŝůŝƚLJ͘EĞǁĐůŝĞŶƚĂĐƋƵŝƐŝƚŝŽŶ͕ƵƚŝůŝnjĂƚŝŽŶĂŶĚĂĚǀĂŶĐĞŵĞŶƚƐŝŶƚĞĐŚŶŽůŽŐLJĂůůŝŶĨůƵĞŶĐĞ ĐŚĂŶŐĞƐŝŶƚŚĞĚĂƚĂĐĞŶƚĞƌĐŽŶĨŝŐƵƌĂƚŝŽŶ͘ ^LJƐƚĞŵĂŶĚ^ĞĐƵƌŝƚLJĚŵŝŶŝƐƚƌĂƚŝŽŶ dLJůĞƌƉĞƌĨŽƌŵƐĚĂŝůLJĂĚŵŝŶŝƐƚƌĂƚŝǀĞƚĂƐŬƐ͘tĞĂĚĚƌĞƐƐƚŚĞŝŶƐƚĂůůĂƚŝŽŶ͕ƵƉŐƌĂĚĞ͕ƐƵƉƉŽƌƚ͕ĂŶĚĨŝůĞ ŵĂŝŶƚĞŶĂŶĐĞŽĨLJŽƵƌdLJůĞƌƐŽĨƚǁĂƌĞĂƉƉůŝĐĂƚŝŽŶƐ͕ĚĂƚĂďĂƐĞƐĞƌǀĞƌƐ͕ŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵƐ͕ĚĂƚĂďĂƐĞ͕ĂƉƉůŝĐĂƚŝŽŶ ĨŝůĞƐ͕ĂŶĚŝŵĂŐĞĨŝůĞƐ͘dLJůĞƌƉƌŽǀŝĚĞƐƐĞĐƵƌĞĚĂƚĂƚƌĂŶƐŵŝƐƐŝŽŶƉĂƚŚƐĨƌŽŵĞĂĐŚĐůŝĞŶƚǁŽƌŬƐƚĂƚŝŽŶƚŽdLJůĞƌ D,^ƐĞƌǀĞƌƐ͘hƐĞƌ/Ɛ͕ƉĂƐƐǁŽƌĚƐ͕ĂŶĚĂƉƉůŝĐĂƚŝŽŶĂĐĐĞƐƐƌŝŐŚƚƐĨŽƌƚŚĞsWEĂŶĚLJŽƵƌdLJůĞƌƐŽĨƚǁĂƌĞ ĂƉƉůŝĐĂƚŝŽŶƐĂƌĞĂĚŵŝŶŝƐƚĞƌĞĚďLJdLJůĞƌǁŝƚŚƚŚĞůŝĞŶƚ͛ƐĨŝŶĂůĂƉƉƌŽǀĂů͘ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŵĂŝŶƚĂŝŶƐĂďĂƐĞůŝŶĞ/d^ĞĐƵƌŝƚLJWŽůŝĐLJƚŚĂƚŝƐĐŽŵŵƵŶŝĐĂƚĞĚƚŽĂŶĚĂĐŬŶŽǁůĞĚŐĞĚďLJĂůů ĞŵƉůŽLJĞĞƐ͘dLJůĞƌŵĂLJŝŶĐůƵĚĞĚĞƚĂŝůĞĚŝŶĚƵƐƚƌLJďĞƐƚƉƌĂĐƚŝĐĞƐŝĨĚĞƐŝƌĞĚďLJƚŚĞůŝĞŶƚ͘/ŶĂĚĚŝƚŝŽŶ͕ǁĞĐŽŶĚƵĐƚ ĂŶĚĚŽĐƵŵĞŶƚ^/ZWƚĞƐƚƐŽŶƋƵĂƌƚĞƌůLJďĂƐŝƐďĂƐĞĚŽŶE/^dƐƚĂŶĚĂƌĚƐ͘ /d^ĞĐƵƌŝƚLJWŽůŝĐLJ ^ĞĐƵƌŝƚLJ/ŶĐŝĚĞŶƚZĞƐƉŽŶƐĞWƌŽĐĞĚƵƌĞƐ WƌŽĐĞĚƵƌĞ,ŝŐŚůŝŐŚƚƐ͗ ;ϭͿŝƐĐŽǀĞƌLJ ;ϮͿ/ŶǀĞƐƚŝŐĂƚŝŽŶ ;ϯͿEŽƚŝĨŝĐĂƚŝŽŶ ;ϰͿZĞƐƉŽŶƐĞ ;ϱͿZĞĐŽǀĞƌLJ ;ϲͿ&ŽůůŽǁͲƵƉ ,ŽƐƚŝŶŐKƉĞƌĂƚŝŽŶƐĨŽůůŽǁƐƐĞĐƵƌŝƚLJďĞƐƚƉƌĂĐƚŝĐĞƐĚŝĐƚĂƚĞĚĂŶĚĚĞĨŝŶĞĚďLJƚŚĞƚŚƌĞĞĂƐƐƵƌĂŶĐĞĂƵĚŝƚƐƚŚĂƚ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĂƌĞƐƵďũĞĐƚƚŽ͘^KyͲϰϬϰ&ŝŶĂŶĐŝĂůĂŶĚ/d'ĞŶĞƌĂůŽŶƚƌŽůƐ͕W/^ĞĐƵƌŝƚLJŽƵŶĐŝůWͲ^^ͬW/Ͳ ^^͕ĂŶĚƚŚĞ/W^^Ͳϭϲ^KϭdLJƉĞϮ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϭϵϵ dLJůĞƌ͛ƐZĞƐƉŽŶƐĞƐƚŽdLJƉŝĐĂů,ŽƐƚŝŶŐYƵĞƐƚŝŽŶƐ Y͘tŚĂƚŬŝŶĚŽĨĐŽŵƉƵƚĞƌĂŶĚ/ŶƚĞƌŶĞƚĐŽŶŶĞĐƚŝŽŶĚŽƵƐĞƌƐŶĞĞĚƚŽƵƐĞ^ĂĂ^͍ ͘^LJƐƚĞŵƌĞƋƵŝƌĞŵĞŶƚƐǀĂƌLJƐůŝŐŚƚůLJĨŽƌĞĂĐŚdLJůĞƌƉƌŽĚƵĐƚĂŶĚĐĂŶďĞĨŽƵŶĚŽŶŽƵƌǁĞďƐŝƚĞ͘/ŶŐĞŶĞƌĂů͕ŽƵƌ ƉƌŽĚƵĐƚƐĐĂŶďĞƐƵƉƉŽƌƚĞĚĂŶĚĐŽŶĨŝŐƵƌĞĚŽŶĐŽŵŵŽŶůLJƵƐĞĚŵĂĐŚŝŶĞƐ͘ ůƚŚŽƵŐŚďĂŶĚǁŝĚƚŚƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞůŽǁ͕ĂŚŝŐŚͲƐƉĞĞĚ/ŶƚĞƌŶĞƚĐŽŶŶĞĐƚŝŽŶŝƐƌĞƋƵŝƌĞĚ͘ŝĂůͲƵƉŵŽĚĞŵƐ ŵĂLJǁŽƌŬďƵƚǁŝůůŶŽƚƉƌŽǀŝĚĞŝĚĞĂůƉĞƌĨŽƌŵĂŶĐĞ͘ Y͘ŽƵƐĞƌƐŚĂǀĞƚŽŝŶƐƚĂůůĂŶLJƉƌŽŐƌĂŵƐŽŶƚŚĞŝƌĐŽŵƉƵƚĞƌƐƚŽĂĐĐĞƐƐƚŚĞŝƌ^ĂĂ^ͲŚŽƐƚĞĚĚĂƚĂďĂƐĞĂŶĚ ƐŽĨƚǁĂƌĞĂƉƉůŝĐĂƚŝŽŶƐ͍ ͘ĞƌƚĂŝŶĂƉƉůŝĐĂƚŝŽŶƐƌĞƋƵŝƌĞƐŽĨƚǁĂƌĞƚŽďĞůŽĂĚĞĚŽŶLJŽƵƌƵƐĞƌƐ͛ĐŽŵƉƵƚĞƌƐ͕ƐƵĐŚĂƐĂŶĐƚŝǀĞyΠĐŽŶƚƌŽů ǁŚŝĐŚŝƐĂƐŵĂůůĂĚĚͲŽŶƉƌŽŐƌĂŵƵƐĞĚŽŶƚŚĞ/ŶƚĞƌŶĞƚ͘/ĨƐŽĨƚǁĂƌĞŝƐƌĞƋƵŝƌĞĚ͕ŽƵƌdLJůĞƌ^ĂĂ^ƚĞĂŵĐĂŶŚĞůƉ ǁŝƚŚƚŚĞŝŶƐƚĂůůĂƚŝŽŶ͘ Y͘,ŽǁĚŽĞƐLJŽƵƌĚĂƚĂĐĞŶƚĞƌƵƚŝůŝnjĞŵƵůƚŝƉůĞ/^WƐƚŽƉƌĞǀĞŶƚƚĞůĞĐŽŵŵƵŶŝĐĂƚŝŽŶƐŽƵƚĂŐĞƐŝŶƚŚĞĞǀĞŶƚLJŽƵƌ ƉƌŝŵĂƌLJ/^WŐŽĞƐĚŽǁŶ͍ ͘dLJůĞƌ͛ƐĚĂƚĂĐĞŶƚĞƌƐŶŽƚŽŶůLJƵƚŝůŝnjĞŵƵůƚŝƉůĞ/^WƐďƵƚĂƌĞĂůƐŽĚĞƐŝŐŶĞĚƐŽƚŚĂƚďĂŶĚǁŝĚƚŚŝƐĚƌĂǁŶĨƌŽŵ ĚŝĨĨĞƌĞŶƚŚƵďůŽĐĂƚŝŽŶƐ͘DƵůƚŝƉůĞ/^WƐĂŶĚŵƵůƚŝƉůĞŚƵďƐŽƵƌĐĞƐŵŝƚŝŐĂƚĞƚŚĞƌŝƐŬŽĨĂĚĂƚĂĐĞŶƚĞƌ/ŶƚĞƌŶĞƚ ŽƵƚĂŐĞ͘ Y͘tŚĂƚŵĞĂƐƵƌĞƐĚŽLJŽƵŚĂǀĞŝŶƉůĂĐĞĨŽƌĂƉŽǁĞƌŽƵƚĂŐĞ͍ ͘dŚĞ^ĂĂ^ĚĂƚĂĐĞŶƚĞƌŝƐĞƋƵŝƉƉĞĚǁŝƚŚďĂƚƚĞƌLJďĂĐŬͲƵƉƐŝŶƚŚĞĞǀĞŶƚŽĨĂƉŽǁĞƌůŽƐƐ͘ƵƌŝŶŐĂƐƵƐƚĂŝŶĞĚ ŽƵƚĂŐĞĂĚŝĞƐĞůŐĞŶĞƌĂƚŽƌƐƵƉƉůŝĞƐƉŽǁĞƌ͘dŚĞĞƋƵŝƉŵĞŶƚŝƐƚĞƐƚĞĚǁĞĞŬůLJ͘ Y͘,ŽǁŽĨƚĞŶĚŽLJŽƵƉĞƌĨŽƌŵďĂĐŬƵƉƐ͍ ͘EŝŐŚƚůLJďĂĐŬƵƉƐĂƌĞƐƚŽƌĞĚŽĨĨƐŝƚĞ͘ Y͘tŚĂƚĂďŽƵƚƉŚLJƐŝĐĂůƐĞĐƵƌŝƚLJ͍ ͘dŚĞzĂƌŵŽƵƚŚ͕DĂŝŶĞ͕ĚĂƚĂĐĞŶƚĞƌŝƐĂůǁĂLJƐůŽĐŬĞĚ͕ƌĞƋƵŝƌŝŶŐŬĞLJĐĂƌĚĂĐĐĞƐƐŽŶůLJďLJĂƵƚŚŽƌŝnjĞĚƉĞƌƐŽŶŶĞů͘ KƵƌĂůůĂƐ͕dĞdžĂƐ͕ĚĂƚĂĐĞŶƚĞƌŝƐĐŽͲůŽĐĂƚĞĚĂƚĂƚĂĂŶŬ͘dŚŝƐĨĂĐŝůŝƚLJŝƐŵĂŶŶĞĚďLJĂŐƵĂƌĚϮϰdžϳĂŶĚŝŶĐůƵĚĞƐ ŬĞLJĐĂƌĚĂŶĚďŝŽŵĞƚƌŝĐƐĞĐƵƌŝƚLJƚŽŽůƐŝŶƉůĂĐĞ͘ Y͘ŽLJŽƵƌĞůLJŽŶĂŶLJƐƵďͲĐŽŶƚƌĂĐƚŽƌƐŽƌƚŚŝƌĚƉĂƌƚŝĞƐƚŽĂĚŵŝŶŝƐƚĞƌƚŚĞ^ĂĂ^ĂƉƉůŝĐĂƚŝŽŶĂŶĚĚĂƚĂďĂƐĞ ƐĞƌǀĞƌƐ͍ ͘EŽ͕dLJůĞƌƌĞĐŽŐŶŝnjĞƐƚŚĞŝŵƉŽƌƚĂŶĐĞĂŶĚǀĂůƵĞŽĨŚĂǀŝŶŐĞdžƉĞƌŝĞŶĐĞĚƐƚĂĨĨƐƵƉƉŽƌƚĂŶĚĂĚŵŝŶŝƐƚĞƌƚŚĞ^ĂĂ^ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ͘ Y͘ŽĞƐLJŽƵƌĐŽŵƉĂŶLJŽǁŶĂŶĚŚĂǀĞĐŽŵƉůĞƚĞĐŽŶƚƌŽůŽĨƚŚĞĚĂƚĂĐĞŶƚĞƌƚŚĂƚŚŽƐƚƐƚŚĞ^ĂĂ^ƐĞƌǀĞƌƐ͍ ͘dLJůĞƌŽǁŶƐƚŚĞďƵŝůĚŝŶŐǁŚĞƌĞƚŚĞzĂƌŵŽƵƚŚ͕DĂŝŶĞ͕ĚĂƚĂĐĞŶƚĞƌŝƐůŽĐĂƚĞĚ͘dLJůĞƌĚŽĞƐŶŽƚŽǁŶƚŚĞ ĂƚĂĂŶŬďƵŝůĚŝŶŐŝŶĂůůĂƐ͕dĞdžĂƐ͕ďƵƚǁĞŽǁŶĂůůŽĨƚŚĞĞƋƵŝƉŵĞŶƚůŽĐĂƚĞĚƚŚĞƌĞ͘ ĂƚĂĂŶŬƉƌŽǀŝĚĞƐĂůŽĐŬĞĚĐĂŐĞ͕ĂŝƌĐŽŽůŝŶŐ͕/ŶƚĞƌŶĞƚƐĞƌǀŝĐĞƐĂŶĚƉŽǁĞƌ͘dŚĞLJĚŽŶŽƚĂĚŵŝŶŝƐƚĞƌŽƌƉƌŽǀŝĚĞ ĂŶLJĞƋƵŝƉŵĞŶƚƚŚĂƚŝƐƵƐĞĚƚŽƌƵŶdLJůĞƌŚŽƐƚĞĚĂƉƉůŝĐĂƚŝŽŶƐ͘ dLJůĞƌ,ŽƐƚĞĚ^LJƐƚĞŵZĞƋƵŝƌĞŵĞŶƚƐ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐΖ,ŽƐƚĞĚ^ŽůƵƚŝŽŶŝƐĚĞƐŝŐŶĞĚƚŽŽƉĞƌĂƚĞŽŶŶĞƚǁŽƌŬƐĂŶĚŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵƐƚŚĂƚŵĞĞƚ ĐĞƌƚĂŝŶƌĞƋƵŝƌĞŵĞŶƚƐ͘^LJƐƚĞŵƐƚŚĂƚĚŽŶŽƚŵĞĞƚƚŚĞƌĞƋƵŝƌĞĚƐƉĞĐŝĨŝĐĂƚŝŽŶƐŵĂLJŶŽƚƉƌŽǀŝĚĞƌĞůŝĂďůĞŽƌ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϬ ĂĚĞƋƵĂƚĞƉĞƌĨŽƌŵĂŶĐĞ͕ĂŶĚdLJůĞƌĐĂŶŶŽƚŐƵĂƌĂŶƚĞĞĂĐĐĞƉƚĂďůĞƌĞƐƵůƚƐ͘dŚŝƐƐŚŽƵůĚŝŶĐůƵĚĞĂƌĞůŝĂďůĞ/ŶƚĞƌŶĞƚ ĐŽŶŶĞĐƚŝŽŶƉƌŽǀŝĚĞĚďLJLJŽƵƌ/^W͘ tŽƌŬƐƚĂƚŝŽŶZĞƋƵŝƌĞŵĞŶƚƐ ŽŵƉŽŶĞŶƚZĞƋƵŝƌĞŵĞŶƚ ,ĂƌĚǁĂƌĞ DŝĐƌŽƐŽĨƚtŝŶĚŽǁƐĞƌƚŝĨŝĞĚW WƌŽĐĞƐƐŽƌ WĞŶƚŝƵŵŽƌĞϮƵŽ DĞŵŽƌLJ Ϯ' ŝƐŬ^ƉĂĐĞ ϱ'ĂǀĂŝůĂďůĞĚŝƐŬƐƉĂĐĞ KƉĞƌĂƚŝŶŐ^LJƐƚĞŵ tŝŶĚŽǁƐϳWƌŽĨĞƐƐŝŽŶĂůŽƌtŝŶĚŽǁƐϴWƌŽĨĞƐƐŝŽŶĂů͕ϴ͘ϭϭ EĞƚǁŽƌŬ 'ŝŐĂďŝƚƚŚĞƌŶĞƚ EĞƚǁŽƌŬŶǀŝƌŽŶŵĞŶƚ >ĂƚĞƐƚtŝŶĚŽǁƐhƉĚĂƚĞƐ ϭtŝŶĚŽǁƐϵϱͬϵϴͬD͕yW,ŽŵĞ͕ĂŶĚsŝƐƚĂ,ŽŵĞĞĚŝƚŝŽŶƐĂŶĚǁŽƌŬŐƌŽƵƉŽƌƉĞĞƌͲƚŽͲƉĞĞƌŶĞƚǁŽƌŬƐĂƌĞŶŽƚƐƵƉƉŽƌƚĞĚ͘ &Ƶůů,ĂƌĚǁĂƌĞ^ƉĞĐŝĨŝĐĂƚŝŽŶƐ &ŽƌĐŽŵƉůĞƚĞĚĞƚĂŝůƐŽŶŚĂƌĚǁĂƌĞƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐƚŚĞŝƚLJĐĂŶǀŝƐŝƚƚŚĞ^ŝƚĞƐƐĞƐƐŵĞŶƚǁĞďƐŝƚĞ͘dŚĞƌĞLJŽƵ ĐĂŶƐĞůĞĐƚƐƉĞĐŝĨŝĐĚĞƚĂŝůƐƚŚĂƚǁŝůůĚĞƚĞƌŵŝŶĞǁŚĂƚŚĂƌĚǁĂƌĞĐŽŶĨŝŐƵƌĂƚŝŽŶǁŽƵůĚďĞƚŚĞďĞƐƚĨŝƚĨŽƌLJŽƵƌƐŝƚĞ͘ dŚĞŝƚLJǁŝůůĂůƐŽďĞĂďůĞƚŽĐŽŵƉĂƌĞƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐĨŽƌĂŶŽŶͲƉƌĞŵŝƐĞƐŽůƵƚŝŽŶǀĞƌƐĞƐĂdLJůĞƌͲŚŽƐƚĞĚ ƐŽůƵƚŝŽŶ͘ dŽĐŽŵƉůĞƚĞLJŽƵƌƐŝƚĞĂƐƐĞƐƐŵĞŶƚ͕ůŽŐŝŶƚŽŚƚƚƉ͗ͬͬĐŚĞĐŬ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵ ŶƚĞƌLJŽƵƌĞŵĂŝůĂĚĚƌĞƐƐĂŶĚƚŚĞƉĂƐƐǁŽƌĚ͞dLJůĞƌ͘͟ ^ĞůĞĐƚƚŚĞ/ŶĐŽĚĞƉƌŽĚƵĐƚƚŽďĞŐŝŶLJŽƵƌƐLJƐƚĞŵĂƐƐĞƐƐŵĞŶƚ͘zŽƵǁŝůůĂůƐŽďĞĂďůĞƚŽĚŽǁŶůŽĂĚW&ĐŽƉŝĞƐŽĨ ŚĂƌĚǁĂƌĞƌĞƋƵŝƌĞŵĞŶƚƐĨƌŽŵǁŝƚŚŝŶƚŚĞƉƌŽĐĞƐƐ͘tĞƐƚƌŽŶŐůLJƌĞĐŽŵŵĞŶĚƚŚĂƚLJŽƵĚŽǁŶůŽĂĚĂŶĚŬĞĞƉĂ ĐŽƉLJŽĨƚŚĞĨƵůůŚĂƌĚǁĂƌĞƌĞƋƵŝƌĞŵĞŶƚƐĂƐƚŚŝƐĚŽĐƵŵĞŶƚĂůƐŽĐŽǀĞƌƐƌĞĐŽŵŵĞŶĚĞĚĚĂƚĂďĂĐŬƵƉƉƌŽĐĞĚƵƌĞƐ͘ dLJůĞƌ͛Ɛ^ĞĐƵƌĞĂƚĂĂŶŬ tŝƚŚŵŽƌĞƚŚĂŶϯϬLJĞĂƌƐŽĨŝŶĚƵƐƚƌLJĞdžƉĞƌŝĞŶĐĞ͕dLJůĞƌƉƌŽǀŝĚĞƐĂƵŶŝƋƵĞĐŽŵďŝŶĂƚŝŽŶŽĨƐĞƌǀŝĐĞƐƚŽŵĞĞƚƚŚĞ ƐƉĞĐŝĨŝĐŶĞĞĚƐŽĨƐƚĂƚĞĂŶĚůŽĐĂůŐŽǀĞƌŶŵĞŶƚ͘KƵƌ^ĂĂ^ŽĨĨĞƌŝŶŐŝƐĂĨƵůůͲƐĞƌǀŝĐĞ^ĂĂ^͕ŵĞĂŶŝŶŐǁĞŽǁŶ͕ ĂĚŵŝŶŝƐƚĞƌ͕ĂŶĚƐƵƉƉŽƌƚĂůůŚĂƌĚǁĂƌĞĂŶĚĂƉƉůŝĐĂƚŝŽŶƐ͘KƵƌĐŽŵŵŝƚŵĞŶƚƚŽĨƵůůƐĞƌǀŝĐĞŵĞĂŶƐƚŚĂƚdLJůĞƌ ĚŽĞƐŶ͛ƚƌĞůLJŽŶƐƵďͲĐŽŶƚƌĂĐƚŽƌƐ͘tĞŚĂǀĞĂƚĞĂŵŽĨdLJůĞƌĞŵƉůŽLJĞĞƐǁŚŽĂƌĞĚĞĚŝĐĂƚĞĚƐŽůĞůLJƚŽ^ĂĂ^ ŽƉĞƌĂƚŝŽŶƐ͘ dLJůĞƌ ŵĂŝŶƚĂŝŶƐƚǁŽ^ĂĂ^ĚĂƚĂĐĞŶƚĞƌƐŽƉĞƌĂƚŝŶŐƵŶĚĞƌĂĐŽŶƚŝŶƵŽƵƐŝŵƉƌŽǀĞŵĞŶƚŵŽĚĞůǁŚĞƌĞďLJƚŚĞŚĂƌĚǁĂƌĞ͕ ƐŽĨƚǁĂƌĞĂŶĚƚĞĐŚŶŝĐĂůŝŶĨƌĂƐƚƌƵĐƚƵƌĞĂƌĞĐŽŶƐƚĂŶƚůLJďĞŝŶŐƌĞǀŝĞǁĞĚĂŶĚŽƉƚŝŵŝnjĞĚĨŽƌƉĞƌĨŽƌŵĂŶĐĞĂŶĚ ƐƚĂďŝůŝƚLJ͘EĞǁĐůŝĞŶƚĂĐƋƵŝƐŝƚŝŽŶ͕ƵƚŝůŝnjĂƚŝŽŶĂŶĚĂĚǀĂŶĐĞŵĞŶƚƐŝŶƚĞĐŚŶŽůŽŐLJĂůůŝŶĨůƵĞŶĐĞĐŚĂŶŐĞƐŝŶƚŚĞĚĂƚĂ ĐĞŶƚĞƌĐŽŶĨŝŐƵƌĂƚŝŽŶ͘KƵƌŝŶǀĞƐƚŵĞŶƚƐŝŶĐůƵĚĞŝŶĚƵƐƚƌLJͲůĞĂĚŝŶŐƐŽůƵƚŝŽŶƐĨƌŽŵ͗ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϭ xDŝĐƌŽƐŽĨƚΠ x/DΠ xŝƐĐŽΠ x>ŝĞďĞƌƚΠ xĂƚĞƌƉŝůůĂƌΠ ĂƚĂ^ĞĐƵƌŝƚLJ dLJůĞƌƚĂŬĞƐƐĞĐƵƌŝƚLJǀĞƌLJƐĞƌŝŽƵƐůLJ͘tĞƵƐĞĂŵƵůƚŝƚƵĚĞŽĨĚŝĨĨĞƌĞŶƚƐĞĐƵƌŝƚLJƐŽůƵƚŝŽŶƐƚŽĞŶƐƵƌĞƐĞĐƵƌĞ ĐŽŵŵƵŶŝĐĂƚŝŽŶƐŝŶĐůƵĚŝŶŐsŝƌƚƵĂůWƌŝǀĂƚĞEĞƚǁŽƌŬ;sWEͿĚĞǀŝĐĞƐ͕ƐŽĨƚǁĂƌĞsWEƐĂŶĚ,ddW^͘EĞƚǁŽƌŬ ĞŶŐŝŶĞĞƌƐǁŽƌŬĐůŽƐĞůLJǁŝƚŚĂƉƉůŝĐĂƚŝŽŶƚĞĂŵƐƚŽĞŶƐƵƌĞƐĞĐƵƌŝƚLJƉƌĂĐƚŝĐĞƐĂƌĞĞŵƉůŽLJĞĚƚŚƌŽƵŐŚŽƵƚƚŚĞĞŶƚŝƌĞ ƉƌŽĚƵĐƚůŝĨĞĐLJĐůĞ͘ ZĞĚƵŶĚĂŶĐLJ tŚĞŶǁĞďƵŝůƚŽƵƌ^ĂĂ^ŝŶĨƌĂƐƚƌƵĐƚƵƌĞƚŚĞŐŽĂůǁĂƐƐŝŵƉůĞ͗ŶŽƐŝŶŐůĞƉŽŝŶƚŽĨĨĂŝůƵƌĞ͘KƵƌŝŶǀĞƐƚŵĞŶƚƐŝŶĞǀĞƌLJ ĨĂĐĞƚŽĨƚŚĞƉƌŽũĞĐƚŝŶĐůƵĚĞŵƵůƚŝƉůĞĚĞǀŝĐĞƐƐĞƚƵƉĨŽƌŚŝŐŚĂǀĂŝůĂďŝůŝƚLJĂŶĚĨĂŝůŽǀĞƌ͘dŚĞĚŝƐŬƐƵďͲƐLJƐƚĞŵƵƐĞƐ ĨƵůůLJƌĞĚƵŶĚĂŶƚĚƌŝǀĞĂƌƌĂLJƐƚŚĂƚƉƌĞǀĞŶƚĚŽǁŶƚŝŵĞĚƵĞƚŽĂĨĂŝůĞĚĚŝƐŬĚƌŝǀĞ͘tĞŚĂǀĞŵƵůƚŝƉůĞ/ŶƚĞƌŶĞƚ ƉƌŽǀŝĚĞƌƐĂƚďŽƚŚŽĨŽƵƌĚĂƚĂĐĞŶƚĞƌƐŝŶzĂƌŵŽƵƚŚ͕DĂŝŶĞ͕ĂŶĚĂůůĂƐ͕dĞdžĂƐ͕ůĞĂǀŝŶŐƚŚĞŝƌƌĞƐƉĞĐƚŝǀĞƐƚĂƚĞƐ ƚŚƌŽƵŐŚĚŝĨĨĞƌĞŶƚƌŽƵƚĞƐ͘ŶhŶŝŶƚĞƌƌƵƉƚŝďůĞWŽǁĞƌ^ƵƉƉůLJ;hW^ͿƉƌŽǀŝĚĞƐƐĞĂŵůĞƐƐĨĂŝůŽǀĞƌƚŽĂĚŝĞƐĞů ŐĞŶĞƌĂƚŽƌŝŶƚŚĞĞǀĞŶƚŽĨĂƉŽǁĞƌŽƵƚĂŐĞ͘/ŶƚŚĞĞǀĞŶƚŽĨĂĐĂƚĂƐƚƌŽƉŚŝĐĨĂŝůƵƌĞĂƚŽŶĞĨĂĐŝůŝƚLJ͕ŽƵƌĚŝƐĂƐƚĞƌ ƌĞĐŽǀĞƌLJƉůĂŶĂƐƐƵƌĞƐƚŚĂƚĂůůĐƌŝƚŝĐĂůƉƌŽĐĞƐƐĞƐĐŽŶƚŝŶƵĞƵŶŝŶƚĞƌƌƵƉƚĞĚĂƚƚŚĞƐĞĐŽŶĚĚĂƚĂĐĞŶƚĞƌ͘ ŶĂƵĚŝƚŽĨdLJůĞƌ͛Ɛ^ĂĂ^ĚĂƚĂĐĞŶƚĞƌ͕ƐƉŽŶƐŽƌĞĚďLJŽŶĞŽĨdLJůĞƌ͛Ɛ^ĂĂ^ĐůŝĞŶƚƐ͕ǁĂƐƉĞƌĨŽƌŵĞĚďLJ/D'ůŽďĂů ^ĞƌǀŝĐĞƐ͘dŚĞĂƵĚŝƚǁĂƐĐŽŶĚƵĐƚĞĚƚŽĨŽƌŵĂůůLJĚŽĐƵŵĞŶƚƚŚĞƌĞĚƵŶĚĂŶĐLJĂŶĚĨĂƵůƚƚŽůĞƌĂŶĐĞĐĂƉĂďŝůŝƚŝĞƐŽĨƚŚĞ ĚĂƚĂĐĞŶƚĞƌĂŶĚŝƚƐŽƉĞƌĂƚŝŽŶĂůƉƌŽĐĞĚƵƌĞƐ͘/ƚ͛ƐĐůĞĂƌͶdLJůĞƌƚĂŬĞƐŝƚƐ^ĂĂ^ƐĞƌǀŝĐĞƐǀĞƌLJƐĞƌŝŽƵƐůLJ͘KƵƌ ƉƌŽĨĞƐƐŝŽŶĂůƐƚĂĨĨŝƐƚƌĂŝŶĞĚĂŶĚŬŶŽǁůĞĚŐĞĂďůĞŝŶĂůůĂƐƉĞĐƚƐŽĨ^ĂĂ^ĂĚŵŝŶŝƐƚƌĂƚŝŽŶ͕ŽƵƌĨĂĐŝůŝƚLJŝƐƐƚĂƚĞͲŽĨͲƚŚĞͲ ĂƌƚĂŶĚŽƵƌĂƚƚĞŶƚŝŽŶƚŽŽƵƌĐůŝĞŶƚƐŝƐƵŶƌŝǀĂůůĞĚ͘ dŚĞĂƚĂĂŶŬƐ xdŝĞƌ///WůƵƐĚĂƚĂĐĞŶƚĞƌ xĂƌƌŝĞƌEĞƵƚƌĂůʹŽǀĞƌϮϬ/^WƐ xKǁŶĞĚĂŶĚŽƉĞƌĂƚĞĚďLJĂƚĂĂŶŬ xEƵĐůĞĂƌ&ĂůůŽƵƚͬdŽƌŶĂĚŽ^ŚĞůƚĞƌ WŚLJƐŝĐĂůĐĐĞƐƐ xϳdžϮϰŽŶͲƐŝƚĞƐĞĐƵƌŝƚLJƐƚĂĨĨ x'ĂƚĞĚƉƌŝǀĂƚĞƉĂƌŬŝŶŐůŽƚ x^ĞƉĂƌĂƚĞǀŝƐŝƚŽƌƉĂƌŬŝŶŐ xĂƌĚĂŶĚďŝŽͲŵĞƚƌŝĐĂĐĐĞƐƐ ŽŵƉůŝĂŶĐĞ xh^ĂĨĞ,ĂƌďŽƌ x^^ϳϬdLJƉĞ//ͬ^^ϭϲ ^ĞƌǀŝĐĞǀĂŝůĂďŝůŝƚLJ xsDtĂƌĞ, xϮdžůŝĞŶƚďLJWĂƌĂůůĞůƐ x/ŶĨƌĂƐƚƌƵĐƚƵƌĞ, ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϮ ĂƚĂĐĞŶƚĞƌǀĂŝůĂďŝůŝƚLJ xĐƚŝǀĞͬĐƚŝǀĞĂƚĂĐĞŶƚĞƌƐ x^EůĞǀĞůĚĂƚĂƌĞƉůŝĐĂƚŝŽŶŽǀĞƌDW>^Ύ x'ĞŽŐƌĂƉŚŝĐĂůůLJĚŝƐƉĞƌƐĞĚĐůŝĞŶƚĞůĞΎ ^ƵƉƉŽƌƚĞĚůŝĞŶƚƐ xtŝŶĚŽǁƐyWͬsŝƐƚĂĂŶĚtŝŶĚŽǁƐϳ xDĂĐK^y xŝWĂĚ͕ŝWŚŽŶĞ͕ŶĚƌŽŝĚĞǀŝĐĞƐΎ ^ƵƉƉŽƌƚĞĚĞǀŝĐĞƐ xLJŶĂŵŝĐƉƌŝŶƚĞƌƐƵƉƉŽƌƚΎ x>ŽĐĂůĚŝƐŬĂĐĐĞƐƐ xdǁĂŝŶĐŽŵƉůŝĂŶƚĚĞǀŝĐĞƐΎ xtŝŶĚŽǁƐ/ŵĂŐĞĐƋƵŝƐŝƚŝŽŶΎ WƌŽƚĞĐƚŝŶŐzŽƵƌĂƚĂ x^EůĞǀĞůƐŶĂƉƐŚŽƚƐ xŝƐŬƚŽŝƐŬĂĐŬƵƉƐ x^EůĞǀĞůƌĞƉůŝĐĂƚŝŽŶΎ /d^ĞĐƵƌŝƚLJWŽůŝĐLJ sĞƌƐŝŽŶ,ŝƐƚŽƌLJ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐdLJůĞƌ/dWŽůŝĐLJ WĂŐĞη͗ϮϬϮ KƌŝŐŝŶĂů/ƐƐƵĞ ĂƚĞ͗ ϬϴͬϬϴͬϮϬϬϴ ZĞǀŝƐŝŽŶ ĂƚĞ͗ ϬϭͬϭϬͬϮϬϭϰ ZĞǀη͗ϭ͘ϭ ^ƵďũĞĐƚ͗ /d^ĞĐƵƌŝƚLJWŽůŝĐLJ ĞǀĞůŽƉĞĚLJ͗ ZŝĐŬ,ŽĨĨ ĂƚĞ͗ ϬϴͬϬϴͬϮϬϬϴ /ƐƐƵŝŶŐĞƉĂƌƚŵĞŶƚ͗ /E&KZDd/KEd,EK>K'z ƉƉƌŽǀĞĚLJ͗ WĞƚĞƌd͘,ŝŐŐŝŶƐ ĂƚĞ͗ ϬϭͬϭϬͬϮϬϭϰ yK͗ ĂƚĞ͗ sĞƌηĂƚĞƵƚŚŽƌĞƐĐƌŝƉƚŝŽŶ Ϭ ϬϴͬϬϴͬϬϴZŝĐŬ,ŽĨĨdŚŝƐŶĞǁƉŽůŝĐLJĐŽŵďŝŶĞƐƚŚĞĨŽůůŽǁŝŶŐƉƌĞǀŝŽƵƐ ƉŽůŝĐŝĞƐ͗;ϭͿ/ŶĨŽƌŵĂƚŝŽŶ^ĞĐƵƌŝƚLJWŽůŝĐLJ͕;ϮͿĐĐĞƐƐ ĂŶĚWĂƐƐǁŽƌĚWŽůŝĐLJ͕;ϯͿŶƚŝͲsŝƌƵƐWŽůŝĐLJ͕;ϰͿ^ĞĐƵƌŝƚLJ /ŶĐŝĚĞŶƚZĞƐƉŽŶƐĞWƌŽĐĞĚƵƌĞƐ͕;ϱͿhƐĞƌĐĐĞƐƐ ĚŵŝŶŝƐƚƌĂƚŝŽŶWŽůŝĐLJ ϭ ϴͬϮϲͬϭϭEĞĂů,ƵĨĨŵĂŶĚĚĞĚƐĞĐƚŝŽŶϲƚŽƐƵƉƉŽƌƚĂŶŶƵĂůƌĞǀŝĞǁŽĨdLJůĞƌ/d ^ĞĐƵƌŝƚLJWŽůŝĐLJĂŶĚWƌŽĐĞƐƐĞƐ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϯ ϭ͘ϭϬϭͬϭϬͬϭϰWĞƚĞƌd͘,ŝŐŐŝŶƐŶŶƵĂůWŽůŝĐLJZĞǀŝĞǁ hƉĚĂƚĞĚW/ͬWͲ^^ƌĞĨĞƌĞŶĐĞƐ hƐĞƌĐĐĞƐƐĚŵŝŶŝƐƚƌĂƚŝŽŶ WŽůŝĐLJ ĨŽƌŵĂůƵƐĞƌĂĚŵŝŶŝƐƚƌĂƚŝŽŶƉŽůŝĐLJŝƐƵƐĞĚĂĐƌŽƐƐĂůůdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƐŝƚĞƐ͘dŚŝƐƉƌŽĐĞƐƐĞŶƐƵƌĞƐƚŚĂƚŽŶůLJ ĂƵƚŚŽƌŝnjĞĚƵƐĞƌƐĂƌĞĂďůĞƚŽĂĐĐĞƐƐƚŚĞdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͛ŶĞƚǁŽƌŬĂŶĚŶƚĞƌƉƌŝƐĞƐLJƐƚĞŵƐ͘&ƵƌƚŚĞƌŵŽƌĞ͕ ƚŚŝƐƉŽůŝĐLJĞdžƚĞŶĚƐƚŽĞŵƉůŽLJĞĞƐǁŚŽŚĂǀĞůĞĨƚƚŚĞĐŽŵƉĂŶLJƚŽĞŶƐƵƌĞƚŚĂƚƚŚĞŝƌĂĐĐĞƐƐƚŽĂůůƐLJƐƚĞŵƐŝƐ ƚĞƌŵŝŶĂƚĞĚŝŶĂƚŝŵĞůLJŵĂŶŶĞƌ͘ ^ĐŽƉĞ dŚĞƐĞƉƌŽĐĞĚƵƌĞƐĂƉƉůLJƚŽĂůůdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƐŝƚĞƐĂŶĚƚŽĂůůdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͛ĞŵƉůŽLJĞĞƐ͕ĐŽŶƚƌĂĐƚŽƌƐ͕ ĂŶĚƚŚŝƌĚͲƉĂƌƚLJƉƌŽǀŝĚĞƌƐ͘ŵƉůŽLJĞĞƌĞƋƵĞƐƚƐŝŶĐůƵĚĞďƵƚĂƌĞŶŽƚůŝŵŝƚĞĚƚŽ͗;ϭͿŶĞǁƵƐĞƌĂĐĐŽƵŶƚƐ͕;ϮͿ ĐŚĂŶŐĞƐƚŽĞdžŝƐƚŝŶŐĂĐĐŽƵŶƚƐĂŶĚ;ϯͿƚĞƌŵŝŶĂƚŝŽŶŽĨĂĐĐŽƵŶƚƐ͘dŚĞ/dŽƌŐĂŶŝnjĂƚŝŽŶĂƚĞĂĐŚdLJůĞƌƐŝƚĞŝƐ ƌĞƐƉŽŶƐŝďůĞĨŽƌĞŶĨŽƌĐŝŶŐƚŚŝƐƉŽůŝĐLJǁŝƚŚŝŶƚŚĞĚĞƐŝŐŶĂƚĞĚŐƵŝĚĞůŝŶĞƐĂŶĚŝŶĐŽŽƉĞƌĂƚŝŽŶǁŝƚŚƚŚĞŝƌƌĞƐƉĞĐƚŝǀĞ ,ZĚĞƉĂƌƚŵĞŶƚ͘ EĞƚǁŽƌŬhƐĞƌĚŵŝŶŝƐƚƌĂƚŝŽŶWƌŽĐĞĚƵƌĞƐ EĞǁƵƐĞƌĂĐĐĞƐƐŵƵƐƚďĞĨŽƌŵĂůůLJƐƵďŵŝƚƚĞĚǀŝĂƚŚĞdƌĂĐŬ/d,ĞůƉĞƐŬ^LJƐƚĞŵŽƌĂĐŽŵƉĂƌĂďůĞ/d^ĞƌǀŝĐĞ ZĞƋƵĞƐƚ^LJƐƚĞŵ͕ƚŽƚŚĞůŽĐĂůEĞƚǁŽƌŬ^LJƐƚĞŵĚŵŝŶŝƐƚƌĂƚŽƌďLJƚŚĞĂƉƉƌŽƉƌŝĂƚĞĚĞƉĂƌƚŵĞŶƚŵĂŶĂŐĞƌ͘dŚĞ ĚĞƉĂƌƚŵĞŶƚŵĂŶĂŐĞƌŵƵƐƚƐƚĂƚĞ͗ xŵƉůŽLJĞĞ͛Ɛ&ŝƌƐƚĂŶĚ>ĂƐƚEĂŵĞ xWŽƐŝƚŝŽŶdŝƚůĞ x^ƚĂƌƚĂƚĞ xKǀĞƌĂůů^LJƐƚĞŵĐĐĞƐƐ͕Ğ͘Ő͘ĞŵĂŝů͕ĐŽŵƉĂŶLJŝŶƚƌĂŶĞƚ͕ĞƚĐ͘ xĐĐĞƐƐƚŽƐƉĞĐŝĨŝĐ&ŝŶĂŶĐŝĂů͕&ŝŶĂŶĐŝĂůʹ&ĞĞĚĞƌƐLJƐƚĞŵƐĂŶĚ&ŝŶĂŶĐŝĂů^ƉƌĞĂĚƐŚĞĞƚƐ xEĞƚǁŽƌŬ^ŚĂƌĞĚ&ŽůĚĞƌĐĐĞƐƐ ZĞƋƵĞƐƚĨŽƌŵƐĂƌĞƌĞƚĂŝŶĞĚƉĞƌŵĂŶĞŶƚůLJĞŝƚŚĞƌŚĂƌĚĐŽƉLJŽƌĞůĞĐƚƌŽŶŝĐĂůůLJƚŽƉƌŽǀŝĚĞĂĚĞƋƵĂƚĞĂƵĚŝƚƚƌĂŝůƐŽĨ ŵĂŶĂŐĞŵĞŶƚĂƉƉƌŽǀĂů͘ tŚĞŶƚŚĞũŽďĚƵƚŝĞƐŽĨĂŶĞŵƉůŽLJĞĞĐŚĂŶŐĞ͕ƚŚĞĂƉƉƌŽƉƌŝĂƚĞĚĞƉĂƌƚŵĞŶƚŵĂŶĂŐĞƌŶŽƚŝĨŝĞƐƚŚĞůŽĐĂůEĞƚǁŽƌŬ ^LJƐƚĞŵĚŵŝŶŝƐƚƌĂƚŽƌŝŶĨŽƌŵŝŶŐŚŝŵŽĨƚŚĞĐŚĂŶŐĞ͘dŚŝƐƌĞƋƵĞƐƚŵƵƐƚŽĐĐƵƌƵƐŝŶŐdƌĂĐŬ/d,ĞůƉĞƐŬ^LJƐƚĞŵ ŽƌĂĐŽŵƉĂƌĂďůĞ/d^ĞƌǀŝĐĞZĞƋƵĞƐƚ^LJƐƚĞŵ͘dŚĞƌĞƋƵĞƐƚŵƵƐƚƐƚĂƚĞƚŚĞŝŶĨŽƌŵĂƚŝŽŶĂďŽǀĞŶŽƚŝŶŐĂŶLJ ĂĚĚŝƚŝŽŶƐŽƌĚĞůĞƚŝŽŶƐƚŽƚŚĞƵƐĞƌĂĐĐŽƵŶƚ͘ dĞƌŵŝŶĂƚŝŽŶƐ hƉŽŶŶŽƚŝĨŝĐĂƚŝŽŶŽĨĂŶĞŵƉůŽLJĞĞ͛ƐƚĞƌŵŝŶĂƚŝŽŶ͕ŝƚŝƐƚŚĞƌĞƐƉŽŶƐŝďŝůŝƚLJŽĨƚŚĞĞŵƉůŽLJĞĞ͛ƐĚĞƉĂƌƚŵĞŶƚ ŵĂŶĂŐĞƌƚŽŶŽƚŝĨLJƚŚĞůŽĐĂů,ƵŵĂŶZĞƐŽƵƌĐĞƐ;,ZͿĚĞƉĂƌƚŵĞŶƚŽĨƚŚĞƚĞƌŵŝŶĂƚŝŽŶƐƚĂƚƵƐĂŶĚƚŚĞůĂƐƚǁŽƌŬŝŶŐ ĚĂƚĞ͘,ZƚŚĞŶŶŽƚŝĨŝĞƐƚŚĞůŽĐĂůEĞƚǁŽƌŬ^LJƐƚĞŵĚŵŝŶŝƐƚƌĂƚŽƌĂŶĚŝƌĞĐƚŽƌŽĨĐĐŽƵŶƚŝŶŐ^LJƐƚĞŵƐďLJŵĂŝů ŽĨƚŚĞĞŵƉůŽLJĞĞ͛ƐƚĞƌŵŝŶĂƚŝŽŶƐƚĂƚƵƐĂŶĚƚŚĞŝƌĞĨĨĞĐƚŝǀĞĚĂƚĞŽĨƚĞƌŵŝŶĂƚŝŽŶ͘hƉŽŶŶŽƚŝĨŝĐĂƚŝŽŶ͕ƚŚĞƵƐĞƌ͛Ɛ ŶĞƚǁŽƌŬĂŶĚŶƚĞƌƉƌŝƐĞ&ŝŶĂŶĐŝĂů^LJƐƚĞŵƐĂĐĐŽƵŶƚƐĂƌĞŝŶĂĐƚŝǀĂƚĞĚͬĚĞůĞƚĞĚǁŝƚŚŝŶϭďƵƐŝŶĞƐƐĚĂLJ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϰ ĐĐĞƐƐĂŶĚWĂƐƐǁŽƌĚWŽůŝĐLJ ĂĐŚƵƐĞƌŝƐƌĞƋƵŝƌĞĚƚŽŚĂǀĞĂƵŶŝƋƵĞ/ĂŶĚƉĂƐƐǁŽƌĚ͘dŚĞĐƌĞĂƚŝŽŶŽĨŐĞŶĞƌŝĐĂŶĚͬŽƌƐŚĂƌĞĚhƐĞƌ/͛ƐŝƐ ƐƉĞĐŝĨŝĐĂůůLJƉƌŽŚŝďŝƚĞĚ͘ĂĐŚƵƐĞƌŚĂƐĞdžĂĐƚůLJŽŶĞhƐĞƌ/ĂŶĚƉĂƐƐǁŽƌĚ͕ĞdžĐĞƉƚǁŚĞƌĞũŽďƌĞƋƵŝƌĞŵĞŶƚƐ ŶĞĐĞƐƐŝƚĂƚĞƚŚĞĐƌĞĂƚŝŽŶŽĨŵƵůƚŝƉůĞ/͛ƐƚŽĂĐĐĞƐƐĚŝĨĨĞƌĞŶƚďƵƐŝŶĞƐƐĨƵŶĐƚŝŽŶƐ͘ ƵƚŚŽƌŝƚLJ ĂĐŚƵƐĞƌŝƐŐƌĂŶƚĞĚŽŶůLJƚŚĞůĞǀĞůŽĨĂĐĐĞƐƐƐƉĞĐŝĨŝĐĂůůLJƌĞƋƵŝƌĞĚďLJƚŚĞŝƌũŽď͘hƐĞŽĨ͞ĚŵŝŶŝƐƚƌĂƚŽƌ͕͟͞^ƵƉĞƌ hƐĞƌ͕͟͞^ĞĐƵƌŝƚLJĚŵŝŶŝƐƚƌĂƚŽƌ͕͟ĂŶĚͬŽƌ͞^͟ůĞǀĞůƐŽĨĂƵƚŚŽƌŝƚLJŝƐƐĞǀĞƌĞůLJƌĞƐƚƌŝĐƚĞĚ͘ 'ĞŶĞƌŝĐhƐĞƌ/Ɛ 'ĞŶĞƌŝĐhƐĞƌ/ƐĂƌĞŶŽƚĂůůŽǁĞĚƚŽƐŝŐŶŽŶƚŽƐLJƐƚĞŵƐ͘ WĂƐƐǁŽƌĚ^ƚĂŶĚĂƌĚƐ ĐĐŽƵŶƚWŽůŝĐLJZĞĐŽŵŵĞŶĚĞĚ^ĞƚƚŝŶŐ DĂdžŝŵƵŵWĂƐƐǁŽƌĚŐĞ ϵϬĚĂLJƐ DŝŶŝŵƵŵWĂƐƐǁŽƌĚŐĞ ϮĚĂLJƐ DŝŶŝŵƵŵWĂƐƐǁŽƌĚ>ĞŶŐƚŚ ϴĐŚĂƌĂĐƚĞƌƐ ŶĨŽƌĐĞWĂƐƐǁŽƌĚ,ŝƐƚŽƌLJ ϲƉĂƐƐǁŽƌĚƐ;ůĂƐƚϲĐĂŶŶŽƚďĞƵƐĞĚͿ ĐĐŽƵŶƚ>ŽĐŬŽƵƚ;ηŽĨƵŶƐƵĐĐĞƐƐĨƵůůŽŐŽŶ ĂƚƚĞŵƉƚƐͿ ϱďĂĚĂƚƚĞŵƉƚƐ ĐĐŽƵŶƚ>ŽĐŬŽƵƚƵƌĂƚŝŽŶ ϲŚŽƵƌƐ ZĞƐĞƚĐĐŽƵŶƚ>ŽĐŬŽƵƚŽƵŶƚĞƌĨƚĞƌ ϲŚŽƵƌƐ ĚŵŝŶŽƌ^ƵƉĞƌͲhƐĞƌWĂƐƐǁŽƌĚƐ ůůĚŵŝŶŝƐƚƌĂƚŝǀĞŽƌ^ƵƉĞƌͲhƐĞƌƉĂƐƐǁŽƌĚƐ͕ŝ͘Ğ͘EĞƚǁŽƌŬŽŵĂŝŶ͕^Y>^ĞƌǀĞƌ͕ƉŝĐŽƌĂƌĞĐŽŵƉůĞdžƉĂƐƐǁŽƌĚƐ͕ ŝ͘Ğ͘ƚŚĞLJĐŽŶƚĂŝŶĂƚůĞĂƐƚƚǁŽŶŽŶͲĂůƉŚĂŶƵŵĞƌŝĐĐŚĂƌĂĐƚĞƌƐ͕Ğ͘Ő͘Λ͕η͕Ψ͕ĞƚĐ͘ ZĞǀŝĞǁ >ŽĐĂůĂŶĚdLJůĞƌŽƌƉŽƌĂƚĞ^LJƐƚĞŵĚŵŝŶŝƐƚƌĂƚŽƌƐŝŵƉůĞŵĞŶƚƉŽůŝĐŝĞƐĂŶĚƉƌŽĐĞĚƵƌĞƐƚŽǀĂůŝĚĂƚĞƚŚĞŽŶͲŐŽŝŶŐ ŝŵƉůĞŵĞŶƚĂƚŝŽŶĂŶĚĂĚŚĞƌĞŶĐĞƚŽƚŚŝƐƉŽůŝĐLJ͘hƐĞƌ/͛ƐĂŶĚƉĂƐƐǁŽƌĚƐĂƌĞĂƵĚŝƚĞĚĂŶŶƵĂůůLJ͘dŚĞƐĞĂƵĚŝƚƐ ĂƌĞŵĂŝŶƚĂŝŶĞĚĨŽƌĂƉĞƌŝŽĚŽĨĂƚůĞĂƐƚϭLJĞĂƌ͘ ŶƚŝͲsŝƌƵƐWŽůŝĐLJ WƵƌƉŽƐĞ dŚĞƉƵƌƉŽƐĞŽĨƚŚŝƐƐĞĐƚŝŽŶŝƐƚŽĚĞƐĐƌŝďĞƚŚĞ/dKƉĞƌĂƚŝŽŶƐƉƌŽĐĞƐƐĞƐƚŽƉƌĞǀĞŶƚĂŶĚƌĞƐƉŽŶĚƚŽǀŝƌƵƐĂƚƚĂĐŬƐ͘ dŚŝƐƉƌĞǀĞŶƚŝŽŶĂŶĚƌĞƐƉŽŶƐĞƉƌŽĐĞƐƐĂƉƉůŝĞƐƚŽĂůůŝŶƚĞƌŶĂůĐŽŵƉƵƚĞƌƐLJƐƚĞŵƐĂŶĚĂůůŝŶƐƚĂŶĐĞƐĨŽƌǀŝƌƵƐ ƚŚƌĞĂƚĂŶĚĂƚƚĂĐŬƚŽƚŚĞƐĞƐLJƐƚĞŵƐ͘/ƚŝƐƚŚĞƌĞƐƉŽŶƐŝďŝůŝƚLJŽĨĞĂĐŚ>ŽĐĂů/dDĂŶĂŐĞƌƚŽƉŽƉƵůĂƚĞĂŶĚŵĂŝŶƚĂŝŶ ĂůůŽŵƉĂŶLJĚĞƐŬƚŽƉƐ͕ŶŽƚĞŬƐ͕tŝŶĚŽǁƐƐĞƌǀĞƌƐ͕ĂŶĚĂƉƉůŝĂŶĐĞƐĞƌǀĞƌƐLJƐƚĞŵƐǁŝƚŚŶƚŝͲsŝƌƵƐƐŽĨƚǁĂƌĞ ĨŽƌǀŝƌƵƐƉƌŽƚĞĐƚŝŽŶĂŶĚĚĞƚĞĐƚŝŽŶ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϱ WƌŽĐĞĚƵƌĞƐ /ŶďŽƵŶĚͲDĂŝůWƌŽƚĞĐƚŝŽŶ xhƉĚĂƚĞĚǀŝƌƵƐĚĞĨŝŶŝƚŝŽŶƐƐŚŽƵůĚďĞĚŽǁŶůŽĂĚĞĚĞǀĞƌLJĚĂLJ͘ xůůŝŶďŽƵŶĚĞͲŵĂŝůŵĞƐƐĂŐĞƐƐŚŽƵůĚďĞƐĐĂŶŶĞĚ͘ dŚĞĨŝůĞĂƚƚĂĐŚŵĞŶƚƐŚŽƵůĚďĞĚĞůĞƚĞĚŝĨƚŚĞĞdžƚĞŶƐŝŽŶŝƐĐŽŶƚĂŝŶĞĚŝŶƚŚĞĨŽůůŽǁŝŶŐƚĂďůĞ͗ ͘ďĂƚ ͘ĐƉů ͘ĞdžĞ ͘ƐĐƌ ͘ĐĂď ͘Ěďdž ͘ŚůƉ ͘ƐŚƐ ͘ĐŵĚ͘ ͘Ěůů ͘ŵŚƚ ͘ǀďƐ ͘ĐŽŵ ͘Ğŵů ͘ƉŝĨ ͘ǁĂď dŚĞĞͲŵĂŝůƌĞĐŝƉŝĞŶƚƐŚŽƵůĚďĞŶŽƚŝĨŝĞĚŽĨƚŚĞĂƚƚĂĐŚŵĞŶƚĚĞůĞƚŝŽŶ͘ tŚĞŶĂǀŝƌƵƐŝƐĚĞƚĞĐƚĞĚ͕ƚŚĞƐLJƐƚĞŵƐŚŽƵůĚƚƌLJƚŽƌĞƉĂŝƌŝƚ͘/ĨƚŚĞƌĞƉĂŝƌŝƐŶŽƚƐƵĐĐĞƐƐĨƵů͕ƚŚĞĞŵĂŝů ƐŚŽƵůĚďĞĚĞůĞƚĞĚ͘ x/ĨƚŚĞƐLJƐƚĞŵĚĞƚĞĐƚƐĨŝǀĞǀŝƌƵƐŝŶĨĞĐƚŝŽŶƐŝŶŽŶĞͲŵŝŶƵƚĞƚŝŵĞƐƉĂŶ͕ŝƚƐŚŽƵůĚƐĞŶĚŶŽƚŝĨŝĐĂƚŝŽŶƚŽƚŚĞ /dƐLJƐƚĞŵĂĚŵŝŶŝƐƚƌĂƚŽƌďLJĞŵĂŝů͘ ^ĞƌǀĞƌƐ͕ĞƐŬƚŽƉƐ͕EŽƚĞŬƐWƌŽƚĞĐƚŝŽŶ >ŽĐĂů/dƉĞƌƐŽŶŶĞůƐŚŽƵůĚŝŶƐƚĂůůĂŶĚĐŽŶĨŝŐƵƌĞŶƚŝǀŝƌƵƐĨŽƌtŝŶĚŽǁƐĚĞƐŬƚŽƉƐ͕ŶŽƚĞŬƐ͕ĂŶĚƐĞƌǀĞƌƐ ĞdžƉĞĐƚĞĚƚŽũŽŝŶŽŵƉĂŶLJ͛ƐĐŽƌƉŽƌĂƚĞŶĞƚǁŽƌŬĚŽŵĂŝŶ;ǀŝĂĐƚŝǀĞŝƌĞĐƚŽƌLJͿ͘ xůůĚĞƐŬƚŽƉƐĂŶĚŶŽƚĞŬƐƐŚŽƵůĚďĞƐĐŚĞĚƵůĞĚƚŽƉĞƌĨŽƌŵĐŽŵƉůĞƚĞǀŝƌƵƐƐĐĂŶŶŝŶŐŽĨůŽĐĂůŚĂƌĚ ĚƌŝǀĞƐĂƚůĞĂƐƚŽŶĐĞĂŵŽŶƚŚ͘ xtŚĞŶĂǀŝƌƵƐŝƐĚĞƚĞĐƚĞĚ͕ƚŚĞƐLJƐƚĞŵƐŚŽƵůĚƚƌLJƚŽĐůĞĂŶƚŚĞĨŝůĞ͘/ĨƚŚĞĐůĞĂŶŝŶŐŝƐŶŽƚƐƵĐĐĞƐƐĨƵů͕ƚŚĞ ĨŝůĞƐŚŽƵůĚďĞĚĞůĞƚĞĚ͘͘ xhƉĚĂƚĞĚǀŝƌƵƐĚĞĨŝŶŝƚŝŽŶƐƐŚŽƵůĚďĞĚŽǁŶůŽĂĚĞĚĞǀĞƌLJĚĂLJ͘ xůůĚŽŵĂŝŶĐŽŵƉƵƚĞƌƐ;ƐĞƌǀĞƌƐ͕ĚĞƐŬƚŽƉƐ͕ĂŶĚŶŽƚĞŬƐͿƐŚŽƵůĚďĞƐĐŚĞĚƵůĞĚƚŽƵƉĚĂƚĞƚŚĞůŽĐĂů ǀŝƌƵƐĚĞĨŝŶŝƚŝŽŶĨŝůĞǁŚĞŶƚŚĞƐLJƐƚĞŵŝƐƌĞͲƚĞĚ x/dƐLJƐƚĞŵĂĚŵŝŶŝƐƚƌĂƚŽƌƐĐĂŶƉƵƐŚƵƉĚĂƚĞĚǀŝƌƵƐĚĞĨŝŶŝƚŝŽŶĂŶĚƉĞƌĨŽƌŵƌĞŵŽƚĞƐĐĂŶŶŝŶŐŽŶƐĞůĞĐƚĞĚ ĚŽŵĂŝŶĐŽŵƉƵƚĞƌƐŝĨƚŚĞLJĂƌĞƐƵƐƉĞĐƚĞĚŽĨďĞŝŶŐǀŝƌƵƐŝŶĨĞĐƚĞĚ͘ x/dƐLJƐƚĞŵĂĚŵŝŶŝƐƚƌĂƚŽƌĐĂŶƉƵƐŚŶĞǁǀĞƌƐŝŽŶŽĨĂŶƚŝǀŝƌƵƐĐůŝĞŶƚŽƌĞŶŐŝŶĞƐŽĨƚǁĂƌĞƚŽĂŶLJͬĂůůĚŽŵĂŝŶ ĐŽŵƉƵƚĞƌƐĂƐƌĞƋƵŝƌĞĚ͘ hƌŐĞŶƚͬ,ŝŐŚsŝƐŝďŝůŝƚLJsŝƌƵƐƚƚĂĐŬƐ EŽƚŝĨŝĐĂƚŝŽŶŽĨƵƐĞƌƐĂƐĂƌĞƐƵůƚŽĨǁŝĚĞƐƉƌĞĂĚǀŝƌƵƐĂƚƚĂĐŬƐǁŝůůďĞĞǀĂůƵĂƚĞĚŽŶĂĐĂƐĞͲďLJͲĐĂƐĞďĂƐŝƐ͘dŚĞ/d KƉĞƌĂƚŝŽŶƐDĂŶĂŐĞƌĂŶĚ,ĞůƉĞƐŬǁŝůůĂƐƐĞƐƐŶĞĞĚĞĚĂĐƚŝŽŶƐ͕ŝŶĐůƵĚŝŶŐ͗ x>ŽŐŝĐĂůŽƌƉŚLJƐŝĐĂůŶĞƚǁŽƌŬĚŝƐĐŽŶŶĞĐƚŽĨŝŶĨĞĐƚĞĚĐŽŵƉƵƚĞƌƐ͖ xWƌŽĂĐƚŝǀĞĚŝƐƚƌŝďƵƚŝŽŶŽĨƵƉĚĂƚĞĚǀŝƌƵƐĚĞĨŝŶŝƚŝŽŶĨŝůĞƐƚŽƐĞůĞĐƚĞĚŶĞƚǁŽƌŬĐŽŵƉƵƚĞƌƐ͖ xWƌŽĂĐƚŝǀĞƌĞŵŽƚĞƐĐĂŶŶŝŶŐŽĨƐĞůĞĐƚĞĚŶĞƚǁŽƌŬĐŽŵƉƵƚĞƌƐ͖ xͲŵĂŝůŶŽƚŝĨŝĐĂƚŝŽŶŽĨŽŵƉĂŶLJƵƐĞƌƐ͕ϭͿĚƵƌŝŶŐǀŝƌƵƐĂƚƚĂĐŬƐŝƚƵĂƚŝŽŶ͕ĂŶĚϮͿ͚ƉŽƐƚͲĂƚƚĂĐŬ͛ƐƵŵŵĂƌŝĞƐ ŽĨĞĨĨŽƌƚƐƚĂŬĞŶ͖ĂŶĚ xEŽƚŝĨŝĐĂƚŝŽŶƚŽƐĞŶŝŽƌŵĂŶĂŐĞŵĞŶƚŽĨƐĞůĞĐƚĞĚǀŝƌƵƐĂƚƚĂĐŬƐƚŚĂƚŵĂLJŚĂǀĞĂĨĨĞĐƚĞĚŐĞŶĞƌĂůĞŵƉůŽLJĞĞ ƉƌŽĚƵĐƚŝǀŝƚLJŽƌŝŵƉĂĐƚĞĚƉƌŽũĞĐƚͬďƵƐŝŶĞƐƐƚŝŵĞĨƌĂŵĞƐ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϲ ^ĞĐƵƌŝƚLJ/ŶĐŝĚĞŶƚZĞƐƉŽŶƐĞWƌŽĐĞĚƵƌĞƐ WƵƌƉŽƐĞ dŚŝƐƐĞĐƚŝŽŶǁŝůůƐƵƉƉůLJŐƵŝĚĂŶĐĞƚŽďĞƵƐĞĚďĞĨŽƌĞ͕ĚƵƌŝŶŐ͕ĂŶĚĂĨƚĞƌĂĐŽŵƉƵƚĞƌƐĞĐƵƌŝƚLJŝŶĐŝĚĞŶƚŽĐĐƵƌƐŽŶĂ ƐĞƌǀĞƌ͕ŶĞƚǁŽƌŬ͕ƐŝƚĞ͕ŽƌĞŶƚĞƌƉƌŝƐĞ͘dŚĞƉŚŝůŽƐŽƉŚLJŝŶƚŚĞĞǀĞŶƚŽĨĂďƌĞĂĐŚŽĨĐŽŵƉƵƚĞƌƐĞĐƵƌŝƚLJŝƐƚŽƌĞĂĐƚ ĂĐĐŽƌĚŝŶŐƚŽĂƉůĂŶ͘dŚŝƐŝƐƚƌƵĞǁŚĞƚŚĞƌƚŚĞďƌĞĂĐŚŝƐƚŚĞƌĞƐƵůƚŽĨĂŶĞdžƚĞƌŶĂůŝŶƚƌƵĚĞƌĂƚƚĂĐŬ͕ƵŶŝŶƚĞŶƚŝŽŶĂů ĚĂŵĂŐĞ͕ŽƌĂĚŝƐŐƌƵŶƚůĞĚĞŵƉůŽLJĞĞ͘ĂĐŚŽĨƚŚĞƉŽƐƐŝďůĞƚLJƉĞƐŽĨĞǀĞŶƚƐ͕ƐƵĐŚĂƐƚŚŽƐĞũƵƐƚůŝƐƚĞĚ͕ƐŚŽƵůĚďĞ ĂĚĚƌĞƐƐĞĚŝŶĂĚǀĂŶĐĞďLJĂĚĞƋƵĂƚĞĐŽŶƚŝŶŐĞŶĐLJƉůĂŶƐ͘ WƌŽĐĞĚƵƌĞKǀĞƌǀŝĞǁ ϭ͘ŝƐĐŽǀĞƌLJ Ϯ͘/ŶǀĞƐƚŝŐĂƚŝŽŶ ϯ͘EŽƚŝĨŝĐĂƚŝŽŶ ϰ͘ZĞƐƉŽŶƐĞ ϱ͘ZĞĐŽǀĞƌLJ ϲ͘&ŽůůŽǁͲƵƉ ŝƐĐŽǀĞƌLJ DŽŶŝƚŽƌsƵůŶĞƌĂďŝůŝƚLJĚǀŝƐŽƌŝĞƐĂŝůLJ ŶŝŶƚĞŐƌĂůƉĂƌƚŽĨƚŚĞ^ĞĐƵƌŝƚLJ/ŶĐŝĚĞŶƚZĞƐƉŽŶƐĞWƌŽĐĞĚƵƌĞƐ;^/ZWͿŝƐƚŚĞĂďŝůŝƚLJŽĨƚŚĞ/dĚĞƉĂƌƚŵĞŶƚƚŽ ĞŶƐƵƌĞŝƚƐŝŶĨŽƌŵĂƚŝŽŶƐLJƐƚĞŵƐĂƌĞĂƉƉƌŽƉƌŝĂƚĞůLJƉĂƚĐŚĞĚĂŶĚƵƉĚĂƚĞĚ͘dŚĞ/ŶƚĞƌŶĞƚƉƌŽǀŝĚĞƐĂǀĂůƵĂďůĞ ƌĞƐŽƵƌĐĞƚŚĂƚĂůůŽǁƐŽƌŐĂŶŝnjĂƚŝŽŶƐƚŽŵŽŶŝƚŽƌƚŚĞƌĞůĞĂƐĞŽĨƉĂƚĐŚĞƐĂŶĚƵƉŐƌĂĚĞƐĨƌŽŵǀĞŶĚŽƌƐ͘dŚĞ ĨŽůůŽǁŝŶŐƚĂďůĞŝĚĞŶƚŝĨŝĞƐƐƵĐŚƌĞƐŽƵƌĐĞƐ͗ DŽŶŝƚŽƌŝŶŐ>ŽŐƐ >ŽŐƐƐŚŽƵůĚďĞŵŽŶŝƚŽƌĞĚŝŶŽƌĚĞƌĨŽƌŝŶĐŝĚĞŶƚƐƚŽďĞŝĚĞŶƚŝĨŝĞĚ͘DŽŶŝƚŽƌŝŶŐĐŽƵůĚďĞďLJĂĐĐŽŵƉůŝƐŚĞĚ ƚŚƌŽƵŐŚŵĂŶƵĂůŵĞĂŶƐĂŶĚͬŽƌĂŶ/ŶƚƌƵƐŝŽŶĞƚĞĐƚŝŽŶ^LJƐƚĞŵ͕Ğ͘Ő͘'&/͛Ɛ^ĞĐƵƌŝƚLJDŽŶŝƚŽƌ͘ /ŶĐŝĚĞŶƚZĞƐƉŽŶƐĞdƌĂĐŬŝŶŐĂƚĂďĂƐĞ KƌŐĂŶŝnjĂƚŝŽŶtĞďƐŝƚĞ ZdĚǀŝƐŽƌŝĞƐŚƚƚƉ͗ͬͬǁǁǁ͘ĐĞƌƚ͘ŽƌŐͬĂĚǀŝƐŽƌŝĞƐͬ ^ĞĐƵƌŝƚLJ&ŽĐƵƐŚƚƚƉ͗ͬͬǁǁǁ͘ƐĞĐƵƌŝƚLJĨŽĐƵƐ͘ĐŽŵͬ ^ƵŶ^ŽůĂƌŝƐŚƚƚƉ͗ͬͬƐƵŶƐŽůǀĞ͘ƐƵŶ͘ĐŽŵͬƐĞĐƵƌŝƚLJ DŝĐƌŽƐŽĨƚŚƚƚƉ͗ͬͬǁǁǁ͘ŵŝĐƌŽƐŽĨƚ͘ĐŽŵͬƚĞĐŚŶĞƚͬƐĞĐƵƌŝƚLJͬĐƵƌƌĞŶƚ͘ĂƐƉ ŝƐĐŽŚƚƚƉ͗ͬͬǁǁǁ͘ĐŝƐĐŽ͘ĐŽŵͬǁĂƌƉͬƉƵďůŝĐͬϳϳϬͬ EĞƚƐĐĂƉĞŚƚƚƉ͗ͬͬŚŽŵĞ͘ŶĞƚƐĐĂƉĞ͘ĐŽŵͬƐĞĐƵƌŝƚLJͬŶŽƚĞƐͬŝŶĚĞdž͘Śƚŵů ŚĞĐŬƉŽŝŶƚŚƚƚƉ͗ͬͬƉŚŽŶĞďŽLJ͘ĐŽŵͬĨǁϭͬ ĚĂƚĂďĂƐĞƐŚŽƵůĚďĞŵĂŝŶƚĂŝŶĞĚƚŽƚƌĂĐŬĂůůƌĞƉŽƌƚĞĚƐĞĐƵƌŝƚLJŝŶĐŝĚĞŶƚƐ͘dŚŝƐŵĂLJĨĂĐŝůŝƚĂƚĞƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶ ŝŶǁĂƌĚŝŶŐŽĨĨĨƵƚƵƌĞŝŶĐŝĚĞŶƚƐ͘ ůĂƐƐŝĨŝĐĂƚŝŽŶĂŶĚ/ĚĞŶƚŝĨŝĐĂƚŝŽŶŽĨĂŶ/ŶĐŝĚĞŶƚ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϳ ůůƌĞƉŽƌƚĞĚŝŶĐŝĚĞŶƚƐƐŚŽƵůĚďĞĐůĂƐƐŝĨŝĞĚĂƐĂŚŝŐŚͬŵĞĚŝƵŵͬůŽǁƌŝƐŬƚŽĨĂĐŝůŝƚĂƚĞƚŚĞĂƉƉƌŽƉƌŝĂƚĞĂĐƚŝŽŶƐƚŽ ƚĂŬĞ͘dŚĞĨŽůůŽǁŝŶŐƚĂďůĞƉƌŽǀŝĚĞƐĂŶŝŶĐŝĚĞŶƚĐůĂƐƐŝĨŝĐĂƚŝŽŶƐƐĐŚĞŵĞ͗ ƌŝƚŝĐĂůŝƚLJĞĨŝŶŝƚŝŽŶdžĂŵƉůĞƐ ,ŝŐŚ /ŶĐŝĚĞŶƚƐƚŚĂƚŚĂǀĞĂŵŽŶƵŵĞŶƚĂů ŝŵƉĂĐƚŽŶƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶ͛ƐďƵƐŝŶĞƐƐŽƌ ƐĞƌǀŝĐĞĐƵƐƚŽŵĞƌƐ͘ xDĂůŝĐŝŽƵƐĐŽĚĞĂƚƚĂĐŬƐ͕ ŝŶĐůƵĚŝŶŐdƌŽũĂŶŚŽƌƐĞ ƉƌŽŐƌĂŵƐĂŶĚǀŝƌƵƐ ŝŶĨĞĐƚŝŽŶƐ xhŶĂƵƚŚŽƌŝnjĞĚƐLJƐƚĞŵĂĐĐĞƐƐ DĞĚŝƵŵ /ŶĐŝĚĞŶƚƐƚŚĂƚŚĂƐĂƐŝŐŶŝĨŝĐĂŶƚŽƌŚĂƐƚŚĞ ƉŽƚĞŶƚŝĂůƚŽŚĂǀĞĂŵŽŶƵŵĞŶƚĂůŝŵƉĂĐƚ ŽŶƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶ͛ƐďƵƐŝŶĞƐƐŽƌƐĞƌǀŝĐĞ ĐƵƐƚŽŵĞƌƐ͘ xWĂƐƐǁŽƌĚĐƌĂĐŬŝŶŐĂƚƚĞŵƉƚƐ xWĂƐƐǁŽƌĚĚŽĞƐŶŽƚĂůůŽǁ ĂĐĐĞƐƐƚŽƐLJƐƚĞŵ͕ĂƉƉĂƌĞŶƚ ĐŚĂŶŐĞŽĨƉĂƐƐǁŽƌĚǁŝƚŚŽƵƚ ƵƐĞƌŬŶŽǁůĞĚŐĞŚĂƐ ŽĐĐƵƌƌĞĚ >Žǁ /ŶĐŝĚĞŶƚƐƚŚĂƚŚĂƐƚŚĞƉŽƚĞŶƚŝĂůƚŽŚĂǀĞĂ ƐŝŐŶŝĨŝĐĂŶƚŽƌŵŽŶƵŵĞŶƚĂůŝŵƉĂĐƚŽŶƚŚĞ ŽƌŐĂŶŝnjĂƚŝŽŶ͛ƐďƵƐŝŶĞƐƐŽƌƐĞƌǀŝĐĞ ĐƵƐƚŽŵĞƌƐ͘ xWƌŽďĞƐĂŶĚŶĞƚǁŽƌŬ ŵĂƉƉŝŶŐ xĞŶŝĂůŽĨĂĐĐĞƐƐƚŽƚŚĞ ƐLJƐƚĞŵĚƵĞƚŽƵŶĞdžƉĞĐƚĞĚ ůŽĐŬŽƵƚ /Es^d/'d/KE hƐŝŶŐLJŽƵƌĞdžƉĞƌŝĞŶĐĞĂŶĚŬŶŽǁůĞĚŐĞĂŶĚĂŶLJĂǀĂŝůĂďůĞƚŽŽůƐLJŽƵŵƵƐƚŐĂƚŚĞƌĞǀŝĚĞŶĐĞƚŚĂƚĂĐƌŝŵĞŝƐŽƌŚĂƐ ďĞĞŶĐŽŵŵŝƚƚĞĚ͘dŽƉƌŽƚĞĐƚĞǀŝĚĞŶĐĞĂŶĚŚĞůƉĨĞĚĞƌĂů͕ƐƚĂƚĞ͕ŽƌůŽĐĂůůĂǁĞŶĨŽƌĐĞŵĞŶƚĂŐĞŶĐŝĞƐŝŶǀĞƐƚŝŐĂƚĞ ƚŚĞŝŶĐŝĚĞŶƚ͕ƚĂŬĞƚŚĞĨŽůůŽǁŝŶŐĂĐƚŝŽŶƐ͗ xŵĂŬĞďĂĐŬƵƉĐŽƉŝĞƐŽĨĚĂŵĂŐĞĚŽƌĂůƚĞƌĞĚĨŝůĞƐ͕ĂŶĚŬĞĞƉƚŚĞƐĞďĂĐŬƵƉƐŝŶĂƐĞĐƵƌĞůŽĐĂƚŝŽŶ͖ xĂĐƚŝǀĂƚĞĂůůĂƵĚŝƚŝŶŐƐŽĨƚǁĂƌĞ͖ xĐŽŶƐŝĚĞƌŝŵƉůĞŵĞŶƚŝŶŐĂŬĞLJƐƚƌŽŬĞŵŽŶŝƚŽƌŝŶŐƉƌŽŐƌĂŵ͕ƉƌŽǀŝĚĞĚĂŶĂĚĞƋƵĂƚĞǁĂƌŶŝŶŐďĂŶŶĞƌŝƐ ĚŝƐƉůĂLJĞĚŽŶLJŽƵƌƐLJƐƚĞŵ͖ĂŶĚ xKEKdĐŽŶƚĂĐƚƚŚĞƐƵƐƉĞĐƚĞĚƉĞƌƉĞƚƌĂƚŽƌ͘ /ĨƚŚĞƌĞŝƐƐŝŐŶŝĨŝĐĂŶƚĚĂŵĂŐĞďĞŝŶŐĚŽŶĞŽƌƐĞŶƐŝƚŝǀĞŵĂƚĞƌŝĂůŝƐďĞŝŶŐĐŽŵƉƌŽŵŝƐĞĚ͕ƐŚƵƚĚŽǁŶĂŶĚƐƚŽƉƚŚĞ ŝŶƚƌƵƐŝŽŶ͘/ĨŶĞĐĞƐƐĂƌLJ͕ĚŝƐĐŽŶŶĞĐƚƚŚĞĂĨĨĞĐƚĞĚĚĞǀŝĐĞĨƌŽŵƚŚĞŶĞƚǁŽƌŬ͘^ŽŵĞƚŝŵĞƐƚŚĞƌŝƐŬŽĨĐŽŵƉƌŽŵŝƐŝŶŐ ƐĞŶƐŝƚŝǀĞŵĂƚĞƌŝĂůŝƐŶŽƚǁŽƌƚŚƚŚĞƌŝƐŬŽĨƚƌLJŝŶŐƚŽĐĂƚĐŚƚŚĞƉĞƌƉĞƚƌĂƚŽƌ͘ dŚĞĨŽůůŽǁŝŶŐĐŚĞĐŬůŝƐƚŝĚĞŶƚŝĨŝĞƐƐƚĞƉƐƚŚĂƚĐĂŶďĞƵƐĞĚƚŽĨĂĐŝůŝƚĂƚĞŝŶĐůĂƐƐŝĨLJŝŶŐƚŚĞŝŶĐŝĚĞŶƚ͕ŝĨŽŶĞŝŶĨĂĐƚ ŚĂƐŽĐĐƵƌƌĞĚ͗ x>ŽŐĨŝůĞƐ xWƌŝǀŝůĞŐĞĚƉƌŽŐƌĂŵƐ x^LJƐƚĞŵĨŝůĞƚĂŵƉĞƌŝŶŐ x^ŶŝĨĨĞƌWƌŽŐƌĂŵƐ xhŶĂƵƚŚŽƌŝnjĞĚƐĞƌǀŝĐĞƐ xWĂƐƐǁŽƌĚĨŝůĞĐŚĂŶŐĞƐ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϴ xŚĞĐŬƐLJƐƚĞŵĂŶĚŶĞƚǁŽƌŬĐŽŶĨŝŐƵƌĂƚŝŽŶƐ x>ŽŽŬĨŽƌƵŶƵƐƵĂůĨŝůĞƐ xdžĂŵŝŶĞŽƚŚĞƌŚŽƐƚƐ͘ dŚĞŵĂŝŶŐŽĂůŽĨƚŚŝƐŝŶŝƚŝĂůƐƚĞƉŝƐƚŽŐĂƚŚĞƌĂƐŵƵĐŚĚĞƚĂŝůĂďŽƵƚƚŚĞŝŶƚƌƵƐŝŽŶĂƐƉŽƐƐŝďůĞ͘dŚŝƐŵĞĂŶƐĨŝŶĚŝŶŐ ĂŶƐǁĞƌƐƚŽƚŚĞĨŽůůŽǁŝŶŐƋƵĞƐƚŝŽŶƐ͘ŶƐƵƌĞƚŚĂƚLJŽƵĨƵůůLJĚŽĐƵŵĞŶƚĞǀĞƌLJĚĞƚĂŝůŽĨƚŚĞŝŶĐŝĚĞŶƚ͘ x,ŽǁǁĂƐƚŚĞĂƚƚĂĐŬŝŶŝƚŝĂƚĞĚ͍ xtŚĞŶĚŝĚƚŚĞĂƚƚĂĐŬŽĐĐƵƌ͍;ĂƚĞĂŶĚƚŝŵĞͿ xtŚĞƌĞĚŝĚƚŚĞĂƚƚĂĐŬŽĐĐƵƌ͍ xtŚĂƚƚŽŽůƐĚŝĚƚŚĞŝŶƚƌƵĚĞƌƵƐĞ͍ xtŚĂƚǁĂƐĐŽŵƉƌŽŵŝƐĞĚ͍ EŽƚŝĨŝĐĂƚŝŽŶ /ĨƚŚĞŝŶĐŝĚĞŶƚŝƐŽĨ͚DĞĚŝƵŵ͛Žƌ͚,ŝŐŚ͛ĐƌŝƚŝĐĂůŝƚLJ;ƐĞĞƚĂďůĞĂďŽǀĞͿƚŚĞĨŝƌƐƚƉĞƌƐŽŶŶŽƚŝĨŝĞĚǁŚĞŶLJŽƵĚŝƐĐŽǀĞƌ ƚŚĂƚĂŶĂƚƚĂĐŬŚĂƐŽĐĐƵƌƌĞĚƐŚŽƵůĚďĞƚŚĞŽƌƉŽƌĂƚĞdLJůĞƌ/dDĂŶĂŐĞƌ͘,ĞŽƌ^ŚĞǁŝůůĂƐƐŝƐƚLJŽƵŝŶƚŚĞ ŶŽƚŝĨŝĐĂƚŝŽŶƉƌŽĐĞƐƐ͘/ĨƚŚĞŝŶĐŝĚĞŶƚŝƐŽĨ͚,ŝŐŚĐƌŝƚŝĐĂůŝƚLJ;ƐĞĞƚĂďůĞĂďŽǀĞͿƚŚĞ/KŽƌdKƐŚŽƵůĚďĞŶŽƚŝĨŝĞĚ ŝŵŵĞĚŝĂƚĞůLJĂŶĚƉƌĞƐĞŶƚĞĚǁŝƚŚĂƐŵĂŶLJĨĂĐƚƐĂŶĚƌĞƉŽƌƚƐŽĨƚŚĞŝŶĐŝĚĞŶƚĂƐĂƌĞĂǀĂŝůĂďůĞ͘dŚĞďŽƚƚŽŵůŝŶĞŝƐ ƚŚĂƚŵĂŶĂŐĞŵĞŶƚƐŚŽƵůĚŬŶŽǁĂďŽƵƚƚŚŝƐ^^KKE^WK^^/>͘ /ĨƚŚĞŝŶĐŝĚĞŶƚŝƐŽĨ͚,ŝŐŚ͛ĐƌŝƚŝĐĂůŝƚLJƚŚĞŶĞdžƚůĞǀĞůŽĨŝŶĐŝĚĞŶƚŶŽƚŝĨŝĐĂƚŝŽŶƐŚŽƵůĚďĞƚŽLJŽƵƌůŽĐĂů&ĞĚĞƌĂů ƵƌĞĂƵŽĨ/ŶǀĞƐƚŝŐĂƚŝŽŶ;&/ͿŽĨĨŝĐĞŽƌƚŚĞEĂƚŝŽŶĂů/ŶĨƌĂƐƚƌƵĐƚƵƌĞWƌŽƚĞĐƚŝŽŶĞŶƚĞƌ;E/WͿ͘dŚĞEĂƚŝŽŶĂů /ŶĨƌĂƐƚƌƵĐƚƵƌĞWƌŽƚĞĐƚŝŽŶĞŶƚĞƌ;E/WͿŝƐĂŐŽǀĞƌŶŵĞŶƚĂŐĞŶĐLJǁŚŽƐĞŵŝƐƐŝŽŶŝƐƚŽƐĞƌǀĞĂƐƚŚĞh͘^͘ ŐŽǀĞƌŶŵĞŶƚΖƐĨŽĐĂůƉŽŝŶƚĨŽƌƚŚƌĞĂƚĂƐƐĞƐƐŵĞŶƚ͕ǁĂƌŶŝŶŐ͕ŝŶǀĞƐƚŝŐĂƚŝŽŶ͕ĂŶĚƌĞƐƉŽŶƐĞĨŽƌƚŚƌĞĂƚƐŽƌĂƚƚĂĐŬƐ ĂŐĂŝŶƐƚŽƵƌĐƌŝƚŝĐĂůŝŶĨƌĂƐƚƌƵĐƚƵƌĞƐ͘ ZĞƐƉŽŶƐĞ ĨƚĞƌƐƵĨĨŝĐŝĞŶƚĞǀŝĚĞŶĐĞŚĂƐďĞĞŶŐĂƚŚĞƌĞĚŽƌĂŶŽƚŚĞƌĂŐĞŶĐLJ;&/ŽƌE/WͿŚĂƐĐŽŵƉůĞƚĞĚƚŚĞŝƌ ŝŶǀĞƐƚŝŐĂƚŝŽŶ͕LJŽƵŵƵƐƚƌĞƚƵƌŶƚŽƚŚĞƚĂƐŬŽĨŝŶĨŽƌŵĂƚŝŽŶƐĞĐƵƌŝƚLJ͘ ŶƐƵƌĞƚŚĂƚĂŶŽƚŚĞƌƉĂƌƚLJĐŽƵůĚŶŽƚƵƐĞƚŚĞŵĞĂŶƐďLJǁŚŝĐŚƚŚĞŽƌŝŐŝŶĂůŝŶƚƌƵĚĞƌŚĂƐŐĂŝŶĞĚĂĐĐĞƐƐĂŐĂŝŶ͘ ƐƐĞŶƚŝĂůůLJ͙ƉůƵŐƚŚĞŚŽůĞ͘dŚŝƐǁŝůůƉƌĞǀĞŶƚĨƵƌƚŚĞƌĚĂŵĂŐĞŽƌĐŽŵƉƌŽŵŝƐĞƚŽLJŽƵƌŶĞƚǁŽƌŬ͘dŚĞƌĞĂƌĞƐĞǀĞƌĂů ͞ƋƵŝĐŬƐŽůƵƚŝŽŶƐ͟ƚŚĂƚĐĂŶĨĂĐŝůŝƚĂƚĞƐƚŽƉƉŝŶŐĂŶŝŶƚƌƵƐŝŽŶĨƌŽŵƉƌŽƉĂŐĂƚŝŶŐĨƵƌƚŚĞƌ͘dŚĞƐĞƐŽůƵƚŝŽŶƐŝŶĐůƵĚĞ ďůŽĐŬŝŶŐƚŚĞ/WĨƌŽŵǁŚŝĐŚƚŚĞĂƚƚĂĐŬŝƐďĞŝŶŐŐĞŶĞƌĂƚĞĚ͕ĚŝƐĂďůŝŶŐƚŚĞĂĨĨĞĐƚĞĚƵƐĞƌŝĚ͖ƌĞŵŽǀĞͬďůŽĐŬƚŚĞƐLJƐƚĞŵ ĨƌŽŵƚŚĞŶĞƚǁŽƌŬĂŶĚƐŚƵƚƚŝŶŐƚŚĞƐLJƐƚĞŵĚŽǁŶ͘ ŽĐƵŵĞŶƚƚŚĞƉƌŽĐĞĚƵƌĞƐƚĂŬĞŶĂŶĚƉƵďůŝƐŚƚŚĞŵĨŽƌƵƐĞďLJŽƚŚĞƌƐ͘ŶƐƵƌĞƚŚĂƚĂůůLJŽƵƌĚŽĐƵŵĞŶƚĞĚ ŝŶĨŽƌŵĂƚŝŽŶŝƐĂǀĂŝůĂďůĞƚŽƚŚŽƐĞŝŶĚŝǀŝĚƵĂůƐǁŝƚŚŝŶLJŽƵƌŽƌŐĂŶŝnjĂƚŝŽŶǁŚŽŵĂLJĂůƐŽďĞǀƵůŶĞƌĂďůĞƚŽƚŚĞƐĂŵĞ ŽƌƐŝŵŝůĂƌĂƚƚĂĐŬƐ͘ ZĞĐŽǀĞƌLJ ŵĂŝŶƉƵƌƉŽƐĞŽĨƚŚĞ^ĞĐƵƌŝƚLJ/ŶĐŝĚĞŶƚZĞƐƉŽŶƐĞWƌŽŐƌĂŵŝƐƚŽĞŶƐƵƌĞĂŶĞĨĨŝĐŝĞŶƚƌĞĐŽǀĞƌLJƚŚƌŽƵŐŚƚŚĞ ƌĞŵŽǀĂůŽĨƐĞĐƵƌŝƚLJǀƵůŶĞƌĂďŝůŝƚŝĞƐĂŶĚƚŚĞƌĞŝŶƐƚĂƚĞŵĞŶƚŽĨƌĞƉĂŝƌĞĚƐLJƐƚĞŵƐ͘ZĞĐŽǀĞƌLJŝŶĐůƵĚĞƐĞŶƐƵƌŝŶŐƚŚĞ ĂƚƚĂĐŬĞƌ͛ƐƉŽŝŶƚƐŽĨƉĞŶĞƚƌĂƚŝŽŶĂŶĚĂŶLJĂƐƐŽĐŝĂƚĞĚǀƵůŶĞƌĂďŝůŝƚŝĞƐŚĂǀĞďĞĞŶĞůŝŵŝŶĂƚĞĚĂŶĚĂůůƐLJƐƚĞŵƐŚĂǀĞ ďĞĞŶƌĞƐƚŽƌĞĚ͘dŚĞ/dĞƉĂƌƚŵĞŶƚƐŚŽƵůĚǁŽƌŬŝŶĐŽŶũƵŶĐƚŝŽŶǁŝƚŚƚŚĞŝƐĂƐƚĞƌZĞĐŽǀĞƌLJƚĞĂŵƚŽĞŶƐƵƌĞ ĞĨĨŽƌƚƐŵĂĚĞďLJĞĂĐŚƚĞĂŵĐĂŶďĞůĞǀĞƌĂŐĞĚ͕ŝ͘Ğ͘ƚŚĞďĞƐƚĐŽƵƌƐĞŽĨĂĐƚŝŽŶŵĂLJďĞƚŽĨĂŝůŽǀĞƌƚŚĞĞĨĨĞĐƚĞĚ ƐƵďͲƐLJƐƚĞŵƐƚŽƚŚĞŝƐĂƐƚĞƌZĞĐŽǀĞƌLJƐŝƚĞƵŶƚŝůƚŚŽƐĞƐƵďͲƐLJƐƚĞŵƐŚĂǀĞďĞĞŶĨƵůůLJƌĞƐƚŽƌĞĚŝŶƚŚĞƉƌŽĚƵĐƚŝŽŶ ĞŶǀŝƌŽŶŵĞŶƚ͘dŚŝƐĚĞĐŝƐŝŽŶƐŚŽƵůĚďĞŵĂĚĞũŽŝŶƚůLJďLJƚŚĞ/KŽƌdKĂŶĚdLJůĞƌ͛ƐŽƌƉŽƌĂƚĞ/dDĂŶĂŐĞƌ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϬϵ &ŽůůŽǁͲƵƉ /ƚŝƐŝŵƉĞƌĂƚŝǀĞƚŚĂƚǁĞůĞĂƌŶĨƌŽŵŝŶĐŝĚĞŶƚƐƚŚĂƚŽĐĐƵƌ͘dŚŝƐǁŝůůƌĞĚƵĐĞƚŚĞůŝŬĞůŝŚŽŽĚŽĨĂŶŝŶĐŝĚĞŶƚĨƌŽŵ ƌĞŽĐĐƵƌƌŝŶŐ͘/ŶĐŝĚĞŶƚƐƐŚŽƵůĚďĞƚƌĂĐŬĞĚĂŶĚƌĞƉŽƌƚĞĚĂƉƉƌŽƉƌŝĂƚĞůLJ͘/ŶĂĚĚŝƚŝŽŶ͕ĂŶĂǁĂƌĞŶĞƐƐĂŶĚƚƌĂŝŶŝŶŐ ƉƌŽŐƌĂŵƐŚŽƵůĚďĞĚĞǀĞůŽƉĞĚƚŽĞŶƐƵƌĞĂůůŵĞŵďĞƌƐŽĨƚŚĞŽƌŐĂŶŝnjĂƚŝŽŶĂƌĞĂǁĂƌĞŽĨǁŚĂƚĐŽŶƐƚŝƚƵƚĞƐĂ ƐĞĐƵƌŝƚLJŝŶĐŝĚĞŶƚĂŶĚǁŚŽƚŚĞĂƉƉƌŽƉƌŝĂƚĞƉĞƌƐŽŶŶĞůĂƌĞƚŽŚĂŶĚůĞƚŚĞƐŝƚƵĂƚŝŽŶ͘ĞƉĞŶĚŝŶŐƵƉŽŶƚŚĞŶĂƚƵƌĞ ŽĨƚŚĞŝŶĐŝĚĞŶƚ͕ŝƚŵĂLJďĞŶĞĐĞƐƐĂƌLJƚŽŚĂǀĞŵĞĞƚŝŶŐƐŝŶǀŽůǀŝŶŐƚŚĞ/dĚĞƉĂƌƚŵĞŶƚĂŶĚĞdžĞĐƵƚŝǀĞŵĂŶĂŐĞŵĞŶƚ ƚŽďƌŝŶŐĞǀĞƌLJŽŶĞƵƉƚŽĚĂƚĞŽŶƚŚĞůĂƚĞƐƚƌŝƐŬĂŶĚƚŽĞŶƐƵƌĞĨƵůůƐƵƉƉŽƌƚĨƌŽŵĞdžĞĐƵƚŝǀĞŵĂŶĂŐĞŵĞŶƚ͘/Ŷ ĂĚĚŝƚŝŽŶ͕ƚŚĞƌĞƐƵůƚƐĨƌŽŵƐƵĐŚĂŵĞĞƚŝŶŐĂƐǁĞůůĂƐƚŚĞŝŶĨŽƌŵĂƚŝŽŶƐƵƌƌŽƵŶĚŝŶŐƚŚĞŝŶĐŝĚĞŶƚƐŚŽƵůĚďĞ ŽƌŐĂŶŝnjĞĚŝŶƚŚĞ/ŶĐŝĚĞŶƚZĞƐƉŽŶƐĞĂƚĂďĂƐĞĨŽƌĨƵƚƵƌĞƌĞĨĞƌĞŶĐĞ͘ WŚLJƐŝĐĂů^ĞĐƵƌŝƚLJŽĨŽŵƉƵƚĞƌƋƵŝƉŵĞŶƚ dŚĞƐĞƌǀĞƌƌŽŽŵŵƵƐƚĐŽŶƚĂŝŶĂŶĂĚĞƋƵĂƚĞĂŝƌĐŽŶĚŝƚŝŽŶŝŶŐƐLJƐƚĞŵƚŽƉƌŽǀŝĚĞĂƐƚĂďůĞŽƉĞƌĂƚŝŶŐĞŶǀŝƌŽŶŵĞŶƚ ƚŽƌĞĚƵĐĞƚŚĞƌŝƐŬŽĨƐLJƐƚĞŵĐƌĂƐŚĞƐĚƵĞƚŽŚĞĂƚƌĞůĂƚĞĚĐŽŵƉŽŶĞŶƚĨĂŝůƵƌĞ͘ &ŝƌĞƐƵƉƉƌĞƐƐŝŽŶƐLJƐƚĞŵƐĂŶĚͬŽƌĨŝƌĞĞdžƚŝŶŐƵŝƐŚĞƌƐŵƵƐƚďĞĂǀĂŝůĂďůĞƚŽĚĞĂůǁŝƚŚƚŚĞƚŚƌĞĂƚŽĨĨŝƌĞ͘ tŚĞŶĞǀĞƌƉŽƐƐŝďůĞhW^ƉŽǁĞƌŝƐƉƌŽǀŝĚĞĚƚŽƚŚĞƐĞƌǀĞƌƌŽŽŵƚŽŚĞůƉƉƌŽƚĞĐƚƚŚĞĐŽŵƉƵƚĞƌƐLJƐƚĞŵƐĂŶĚ ƉƌŽǀŝĚĞƚĞŵƉŽƌĂƌLJƉŽǁĞƌŝŶƚŚĞĐĂƐĞŽĨĂŵĂŝŶƉŽǁĞƌĨĂŝůƵƌĞ͘ dŚĞƐĞƌǀĞƌƌŽŽŵŝƐƉŚLJƐŝĐĂůůLJƐĞĐƵƌĞĚƉƌĞĨĞƌĂďůLJǁŝƚŚĂ͚ďĂĚŐĞƌĞĂĚĞƌ͛ǁŚŝĐŚĂůƐŽŚĂƐƚŚĞĐĂƉĂďŝůŝƚLJŽĨ ƉƌŝŶƚŝŶŐĂŶĂĐĐĞƐƐůŽŐ͘,ŽǁĞǀĞƌ͕ĂƚĂŵŝŶŝŵƵŵ͕ƚŚĞƐĞƌǀĞƌƌŽŽŵŚĂƐĂƉŚLJƐŝĐĂůůŽĐŬ͘ ĐĐĞƐƐƚŽƚŚĞƐĞƌǀĞƌƌŽŽŵŝƐƌĞƐƚƌŝĐƚĞĚƚŽĂůůŽǁŽŶůLJƐƚĂĨĨƚŚĂƚƌĞƋƵŝƌĞƐĂĐĐĞƐƐƚŽƉĞƌĨŽƌŵƚŚĞŝƌũŽďĨƵŶĐƚŝŽŶƐ͘ ŽŶƚƌĂĐƚŽƌƐƌĞƋƵŝƌŝŶŐĂĐĐĞƐƐƚŽƐĞƌǀĞƌƌŽŽŵƐŶŽƚŝĨLJ/d^ĞƌǀŝĐĞƐƐƚĂĨĨŝŶĂĚǀĂŶĐĞƐŽƚŚĂƚƚŚĞŶĞĐĞƐƐĂƌLJĂĐĐĞƐƐ ĐĂŶďĞĂƌƌĂŶŐĞĚ͕ĂŶĚƚŚĞLJŵƵƐƚƐŝŐŶĂ͞sŝƐŝƚŽƌ>ŽŐ͟ŝŶĐůƵĚŝŶŐŶĂŵĞ͕ĐŽŵƉĂŶLJ͕ĚĂƚĞΘƚŝŵĞŽĨĞŶƚƌLJ͕ĚĂƚĞΘ ƚŝŵĞŽĨĞdžŝƚĂŶĚƉƵƌƉŽƐĞŽĨǀŝƐŝƚ͘ WŚLJƐŝĐĂů>E^ĞĐƵƌŝƚLJ ůůĐŽŵŵƵŶŝĐĂƚŝŽŶƐƐŚŽƵůĚƉĂƐƐƚŚƌŽƵŐŚƚŚĞŽŵƉĂŶLJ͛ƐƌŽƵƚĞƌĂŶĚĨŝƌĞǁĂůů͘ŝĂůͲŝŶŵŽĚĞŵƐĂƌĞŶŽƚƵƐĞĚŝĨ ĂƚĂůůƉŽƐƐŝďůĞ >EĞƋƵŝƉŵĞŶƚ͕ƌŽƵƚĞƌƐ͕ŚƵďƐ͕ďƌŝĚŐĞƐ͕ƐǁŝƚĐŚĞƐĂŶĚsWEƐŵƵƐƚďĞŬĞƉƚŝŶƐĞĐƵƌĞƌŽŽŵƐŽƌĐůŽƐĞƚƐ͘ 'ĞŶĞƌĂůůLJ͕ǁŝƌĞůĞƐƐ>EĞƋƵŝƉŵĞŶƚƐŚŽƵůĚŶŽƚďĞƵƐĞĚĂƐŝƚŝŶƚƌŽĚƵĐĞƐƐĞĐƵƌŝƚLJƌŝƐŬƐ͘/ĨĂǁŝƌĞůĞƐƐ>EŝƐ ĚĞƉůŽLJĞĚƚŽĨĂĐŝůŝƚĂƚĞŐƵĞƐƚĂĐĐĞƐƐƚŽƚŚĞŝŶƚĞƌŶĞƚ͕ƚŚĞŶĂƌĞƐƚƌŝĐƚĞĚĚŽŵĂŝŶŝƐĞŵƉůŽLJĞĚƚŽƉƌĞǀĞŶƚĂĐĐĞƐƐƚŽ ƚŚĞƉƌŝŵĂƌLJ>E͘ ŶŶƵĂůZĞǀŝĞǁWƌŽĐĞƐƐ KŶĂŶĂŶŶƵĂůďĂƐŝƐ͕ĂYƵĂůŝĨŝĞĚ^ĞĐƵƌŝƚLJƵĚŝƚŽƌ;Y^ͿǁŝůůĐŽŶĚƵĐƚĂĨŽƌŵĂůĂƵĚŝƚŽĨƚŚĞ,ŽƐƚĞĚͬ^ĂĂ^ŶĞƚǁŽƌŬ ƐƵƉƉŽƌƚŝŶŐƚŚĞŝŶƚĞŐƌĂƚĞĚĐƌĞĚŝƚĐĂƌĚƉƌŽĐĞƐƐŝŶŐƐŽĨƚǁĂƌĞ͘dŚĞƌĞǀŝĞǁǁŝůůĐŽǀĞƌƚŚĞĞŶǀŝƌŽŶŵĞŶƚƌĞŐĂƌĚŝŶŐ W/ͬWͲ^^ĐŽŵƉůŝĂŶĐĞďĂƐĞĚŽŶƚŚĞĐƵƌƌĞŶƚW/^ĞĐƵƌŝƚLJŽƵŶĐŝůƐƚĂŶĚĂƌĚƐ͘dŚŝƐƌĞǀŝĞǁǁŝůůďĞĐŚĂŝƌĞĚďLJ ƚŚĞ/d^ĞĐƵƌŝƚLJKĨĨŝĐĞƌdLJůĞƌ^ĞĐƵƌŝƚLJKĨĨŝĐĞƌ͘ dŚĞĨŝŶĂůĂƵĚŝƚĂƌƚŝĨĂĐƚƐǁŝůůĐŽǀĞƌƚŚĞĨŽůůŽǁŝŶŐ͗ ϭ͘/ĚĞŶƚŝĨLJƉŽƚĞŶƚŝĂůƚŚƌĞĂƚƐĞŝƚŚĞƌĨƌŽŵŝŶƚĞƌŶĂůƌĞƐŽƵƌĐĞƐŽƌĞdžƚĞƌŶĂůϯƌĚƉĂƌƚŝĞƐ Ϯ͘/ĚĞŶƚŝĨLJǀƵůŶĞƌĂďŝůŝƚŝĞƐƚŽƚŚĞĞdžŝƐƚŝŶŐŶĞƚǁŽƌŬĂŶĚĞŶƐƵƌĞƚŚĂƚĂŶLJƉůĂŶŶĞĚŵŽĚŝĨŝĐĂƚŝŽŶƐƚŽƚŚĞ ĞŶǀŝƌŽŶŵĞŶƚĚŽŶŽƚĐƌĞĂƚĞƉĞŶĞƚƌĂƚŝŽŶƌŝƐŬƐŽƌW/ͬWͲ^^ƌŝƐŬƐ ZĞǀŝĞǁdĞĂŵ͗ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϬ dŚĞƌĞǀŝĞǁƚĞĂŵǁŝůůĐŽŶƐŝƐƚŽĨĞĂĐŚƌĞƉƌĞƐĞŶƚĂƚŝǀĞŐƌŽƵƉǁŝƚŚŝŶƚŚĞ/dKƌŐĂŶŝnjĂƚŝŽŶ͘ƵƌƌĞŶƚůLJƚŚĞĨŽůůŽǁŝŶŐ ŐƌŽƵƉƐĞdžŝƐƚƚŽƐƵƉƉŽƌƚdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͛/dŝŶŝƚŝĂƚŝǀĞƐ͗ ϭ͘ƉƉůŝĐĂƚŝŽŶƐ Ϯ͘/ŶĨƌĂƐƚƌƵĐƚƵƌĞ ϯ͘ŶĚhƐĞƌ^ƵƉƉŽƌƚ ϰ͘,ŽƐƚŝŶŐ ϱ͘'ŽǀĞƌŶĂŶĐĞ ZĞƐƵůƚƐŽĨƚŚĞĂŶŶƵĂůĂƵĚŝƚǁŝůůďĞƐƚŽƌĞŝŶƚŚĞ^ŚĂƌĞWŽŝŶƚ/d^ĞĐƵƌŝƚLJKĨĨŝĐĞƌƐŝƚĞƵŶĚĞƌ ŚƚƚƉ͗ͬͬƚLJůƐŚĂƌĞͬĚĞƉƚƐͬŝƚͬ/d^ĞĐƵƌŝƚLJͬW/tŽƌŬƐƉĂĐĞͬ&ŽƌŵƐͬůů/ƚĞŵƐ͘ĂƐƉdž )RUHDFKRIWKHVHUYLFHVSURSRVHGH[SODLQVHUYLFHOHYHOVWKDWDUHXVHGWRJXDUDQWHHSHUIRUPDQFH IRU WKH*RYHUQPHQWWKURXJKWKHSURSRVHGKRVWLQJDJUHHPHQW&RPSOHWH$WWDFKPHQW3URSRVHG 6HUYLFH/HYHO $JUHHPHQW E.6 ƚƚĂĐŚŵĞŶƚϵ;WƌŽƉŽƐĞĚ^ĞƌǀŝĐĞ>ĞǀĞůŐƌĞĞŵĞŶƚͿ ,IKRVWLQJVHUYLFHVDUHSURSRVHGSOHDVHFRPSOHWHWKHIROORZLQJWDEOHLGHQWLI\LQJSURSRVHGVHUYLFHOHYHO JXDUDQWHHV )RUHDFKVHUYLFHSOHDVHLQGLFDWHWKHPHWULFXVHGWRPHDVXUHWKHVHUYLFHTXDOLW\WKHSURSRVHG UHTXLUHPHQWWDUJHWIRUVHUYLFHDQGWKHSURSRVHGUHPHG\SHQDOW\LIJXDUDQWHHLVQRWPHW 3URSRVHG6HUYLFH/HYHO*XDUDQWHHV 6HUYLFH0HWULF5HTXLUHPHQW *XDUDQWHH 5HPHG\LI1RW0HW 6\VWHP$YDLODELOLW\ 8QVFKHGXOHG'RZQWLPH ϵϵ͘ϵ 6\VWHP5HVSRQVH 3HUIRUPDQFH Eͬ ,VVXH5HVSRQVH7LPHΎ ,VVXH5HVROXWLRQ7LPHΎ 6\VWHP'DWD5HVWRUHϮϰ,ŽƵƌƐ ,PSOHPHQWDWLRQRI6\VWHP 3DWFKHV Ϯϰ,ŽƵƌƐ 1RWLILFDWLRQRI6HFXULW\ %UHDFK ϭƵƐŝŶĞƐƐĂLJ 3OHDVHOLVWRWKHUSURSRVHG VHUYLFHOHYHOV ΎWůĞĂƐĞƐĞĞdLJůĞƌ͛ƐƐƵƉƉŽƌƚŝŶĨŽƌŵĂƚŝŽŶůŝƐƚĞĚďĞůŽǁŝŶƚŚŝƐ^ĞĐƚŝŽŶŽĨƚŚĞZ&WZĞƐƉŽŶƐĞ͘WůĞĂƐĞƐĞĞ dLJůĞƌ͛ƐƚĞƌŵƐĂŶĚŽŶĚŝƚŝŽŶƐĂůƐŽŝŶĐůƵĚĞĚŝŶƚŚŝƐƌĞƐƉŽŶƐĞĨŽƌĂůůƐĞƌǀŝĐĞůĞǀĞƌĂŐƌĞĞŵĞŶƚ͘ 3URSRVHG6HUYLFH/HYHO*XDUDQWHHV +RZLVSHUIRUPDQFHDJDLQVWVHUYLFHOHYHOV UHSRUWHGWRWKH*RYHUQPHQW ŝƚLJǁŝůůŶĞĞĚƚŽŶŽƚŝĨLJdLJůĞƌŽĨƉĞƌĨŽƌŵĂŶĐĞ ƉƌŽďůĞŵƐ͘ 'HVFULEHSURFHVVIRU*RYHUQPHQWUHSRUWLQJLVVXH WRWKHYHQGRU sŝůůĂŐĞǁŝůůƐƵďŵŝƚĂƐƵƉƉŽƌƚƚŝĐŬĞƚ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϭ ^ƵƉƉŽƌƚĂŶĚDĂŝŶƚĞŶĂŶĐĞ ($WWDFKPHQW0DLQWHQDQFHDQG6XSSRUW x3URSRVHG0DLQWHQDQFHDQG6XSSRUW x3RVWLPSOHPHQWDWLRQ6XSSRUW x'D\VRIRQVLWHVXSSRUWDIWHUJROLYHΎΎZĞŵŽƚĞΎΎĚƵĞƚŽĐŽǀŝĚƌĞƐƚƌŝĐƚŝŽŶƐ͘ x:KDWLVSXUSRVHRIRQVLWHVXSSRUW"ΎΎZĞŵŽƚĞΎΎĚƵĞƚŽĐŽǀŝĚƌĞƐƚƌŝĐƚŝŽŶƐ͘ x2WKHURQVLWHVXSSRUWDIWHUJROLYH PRQWKHQGTXDUWHUHQG\HDUHQGRSHQ HQUROOPHQWHWF ΎΎZĞŵŽƚĞΎΎĚƵĞƚŽĐŽǀŝĚƌĞƐƚƌŝĐƚŝŽŶƐ͘ x7HOHSKRQH6XSSRUW x+RXUVDYDLODEOHDQGWLPH]RQHϴĂŵƚŽϱƉŵ;DŽŶĚĂLJͲ&ƌŝĚĂLJͿĂĐƌŽƐƐĨŽƵƌh^ƚŝŵĞ njŽŶĞƐ;WĂĐŝĨŝĐ͕DŽƵŶƚĂŝŶ͕ĞŶƚƌĂů͕ĂŶĚ ĂƐƚĞƌŶͿ x3UREOHPUHSRUWLQJDQGUHVROXWLRQSURFHGXUHV zŽƵŵĂLJĐŽŶƚĂĐƚƚŚĞĂƉƉƌŽƉƌŝĂƚĞ^ŽĨƚǁĂƌĞ^ƵƉƉŽƌƚ DĂŶĂŐĞƌƚŽĞŶƐƵƌĞLJŽƵĂƌĞƌĞĐĞŝǀŝŶŐ ƚŚĞƐĞƌǀŝĐĞŶĞĞĚĞĚŝĨĂŶŝƐƐƵĞĂƌŝƐĞƐ͘ĨƚĞƌƌĞĐĞŝǀŝŶŐ ƚŚĞŝŶĐŝĚĞŶƚƚƌĂĐŬŝŶŐŶƵŵďĞƌ͕ƚŚĞ ŵĂŶĂŐĞƌǁŝůůĨŽůůŽǁƵƉŽŶƚŚĞŽƉĞŶŝƐƐƵĞĂŶĚ ĚĞƚĞƌŵŝŶĞƚŚĞŶĞĐĞƐƐĂƌLJĂĐƚŝŽŶƚŽŵĞĞƚLJŽƵƌ ŶĞĞĚƐ͘KŶŽĐĐĂƐŝŽŶ͕ƚŚĞƉƌŝŽƌŝƚLJŽƌŝŵŵĞĚŝĂĐLJŽĨĂ ƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŵĂLJĐŚĂŶŐĞĂĨƚĞƌ ŝŶŝƚŝĂƚŝŽŶ͘dLJůĞƌĞŶĐŽƵƌĂŐĞƐĐůŝĞŶƚƐƚŽĐŽŵŵƵŶŝĐĂƚĞ ƚŚĞůĞǀĞůŽĨƵƌŐĞŶĐLJŽƌƉƌŝŽƌŝƚLJŽĨ ƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝƐƐƵĞƐƐŽƚŚĂƚǁĞĐĂŶƌĞƐƉŽŶĚ ĂƉƉƌŽƉƌŝĂƚĞůLJ͘ƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚĐĂŶ ďĞĞƐĐĂůĂƚĞĚďLJĂŶLJŽĨƚŚĞĨŽůůŽǁŝŶŐŵĞƚŚŽĚƐ͗ dĞůĞƉŚŽŶĞʹĨŽƌŝŵŵĞĚŝĂƚĞƌĞƐƉŽŶƐĞ͕ĐĂůůƚŽůůĨƌĞĞƚŽ ĞŝƚŚĞƌĞƐĐĂůĂƚĞĂŶŝŶĐŝĚĞŶƚ͛ƐƉƌŝŽƌŝƚLJŽƌ ƚŽĞƐĐĂůĂƚĞĂŶŝƐƐƵĞƚŚƌŽƵŐŚŵĂŶĂŐĞŵĞŶƚĐŚĂŶŶĞůƐ ĂƐĚĞƐĐƌŝďĞĚĂďŽǀĞ͘ ŵĂŝůʹĐůŝĞŶƚƐĐĂŶƐĞŶĚĂŶĞŵĂŝůƚŽƐŽĨƚǁĂƌĞ ƐƵƉƉŽƌƚŝŶŽƌĚĞƌƚŽĞƐĐĂůĂƚĞƚŚĞƉƌŝŽƌŝƚLJŽĨĂŶ ŝƐƐƵĞ KŶͲůŝŶĞ^ƵƉƉŽƌƚ/ŶĐŝĚĞŶƚWŽƌƚĂůʹĐůŝĞŶƚƐĐĂŶĂůƐŽ ĞƐĐĂůĂƚĞƚŚĞƉƌŝŽƌŝƚLJŽĨĂŶŝƐƐƵĞďLJůŽŐŐŝŶŐ ŝŶƚŽƚŚĞĐůŝĞŶƚŝŶĐŝĚĞŶƚƉŽƌƚĂůĂŶĚƌĞĨĞƌĞŶĐŝŶŐƚŚĞ ĂƉƉƌŽƉƌŝĂƚĞŝŶĐŝĚĞŶƚƚƌĂĐŬŝŶŐŶƵŵďĞƌ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϮ x5HVSRQVHWLPHIRUYDULRXVOHYHOVRIVHYHULW\dLJůĞƌ͛ƐƐƵƉƉŽƌƚŐŽĂůƐĂƌĞĂƐĨŽůůŽǁƐ ϭƌŝƚŝĐĂůʹǁŝƚŚŝŶϭŚŽƵƌ Ϯ,ŝŐŚʹǁŝƚŚŝŶϰŚŽƵƌƐ ϯDĞĚŝƵŵʹǁŝƚŚŝŶϭďƵƐŝŶĞƐƐĚĂLJ ϰEŽŶͲƌŝƚŝĐĂůʹǁŝƚŚŝŶϮďƵƐŝŶĞƐƐĚĂLJƐ x7KLUG3DUWLHV x6XSSRUWSURYLGHGIRUWKLUGSDUW\SURGXFWV"Eͬ x8SJUDGHV3DWFKHV x8SJUDGH)UHTXHQF\PDMRUDQGPLQRU UHOHDVHV hƉŐƌĂĚĞƐŽĐĐƵƌĂƐĚĞƚĞƌŵŝŶĞĚďLJƚŚĞĐůŝĞŶƚĂŶĚ ŝŶĐŽŶũƵŶĐƚŝŽŶǁŝƚŚdLJůĞƌ͘ x+RZDUHXSJUDGHVGHOLYHUHG"ŶŚĂŶĐĞŵĞŶƚƌĞůĞĂƐĞƐƚĂŬĞƉůĂĐĞĞǀĞƌLJLJĞĂƌĂŶĚĂƌĞ ƐĐŚĞĚƵůĞĚǁŝƚŚƚŚĞĐůŝĞŶƚƚŽƉƌŽǀŝĚĞƚŚĞďĞƐƚ ƉŽƐƐŝďůĞƚŝŵĞĨƌĂŵĞĨŽƌďŽƚŚƚŚĞĐůŝĞŶƚĂŶĚdLJůĞƌ͘ hƉŐƌĂĚĞƐ͕ŚŽǁĞǀĞƌ͕ŽĐĐƵƌƉĞƌŝŽĚŝĐĂůůLJĂŶĚĂƌĞ ŝŶŝƚŝĂƚĞĚďLJƚŚĞĐůŝĞŶƚĂƚĂŶLJƚŝŵĞǀŝĂƚŚĞ/ŶƚĞƌŶĞƚ ƚŚƌŽƵŐŚĂƉƌŽĐĞƐƐĐĂůůĞĚ>ŝǀĞhƉĚĂƚĞ͕ŵĂŬŝŶŐƚŚĞ ƉƌŽĐĞƐƐĂƐĐŽŶǀĞŶŝĞŶƚĂƐƉŽƐƐŝďůĞĨŽƌŽƵƌĐůŝĞŶƚƐ͘ WĂƚĐŚĞƐĂŶĚĨŝdžĞƐĂƌĞƉƌŽǀŝĚĞĚƚŽƚŚĞĐůŝĞŶƚƚŚƌŽƵŐŚ >ŝǀĞhƉĚĂƚĞĂƐǁĞůů͘ x$UHXSJUDGHVUHTXLUHG"dLJůĞƌƌĞĐŽŵŵĞŶĚƐĐůŝĞŶƚƐƐƚĂLJƵƉƚŽĚĂƚĞ͕ďƵƚŝƚŝƐ ƵƉƚŽƚŚĞĐůŝĞŶƚŝĨƚŚĞLJǁŝƐŚƚŽƚĂŬĞĂŶƵƉŐƌĂĚĞ͘ x+RZPDQ\YHUVLRQVDUHFXUUHQWO\VXSSRUWHG"dLJůĞƌƐƵƉƉŽƌƚƐƵƉƚŽƚŚƌĞĞŵĂũŽƌǀĞƌƐŝŽŶƐŽĨƚŚĞ ƐŽĨƚǁĂƌĞĨŽƌĂƐůŽŶŐĂƐĐůŝĞŶƚƐĂƌĞƵƐŝŶŐƚŚĞŵ͘EĞǁ ǀĞƌƐŝŽŶƐĂƌĞƚLJƉŝĐĂůůLJŽĨĨĞƌĞĚĂŶŶƵĂůůLJ͕ ŚŽǁĞǀĞƌĂŶĞǁǀĞƌƐŝŽŶŵĂLJŶŽƚďĞƌĞůĞĂƐĞĚǁŝƚŚŝŶĂ ϭϮŵŽŶƚŚƉĞƌŝŽĚ x7KLUG3DUW\6XSSRUW x8SJUDGH)UHTXHQF\PDMRUDQGPLQRU UHOHDVHV Eͬ x+RZDUHXSJUDGHVGHOLYHUHG"Eͬ x$UHXSJUDGHVUHTXLUHG"Eͬ x+RZPDQ\YHUVLRQVDUHFXUUHQWO\VXSSRUWHG"Eͬ ĚĚŝƚŝŽŶĂů^ƵƉƉŽƌƚĂŶĚDĂŝŶƚĞŶĂŶĐĞ/ŶĨŽƌŵĂƚŝŽŶ KƵƌŵŝƐƐŝŽŶŝƐƚŽĚĞůŝǀĞƌƐƵƉĞƌŝŽƌƐĞƌǀŝĐĞďLJƉƌŽǀŝĚŝŶŐĂƚŝŵĞůLJƌĞƐƉŽŶƐĞ͕ŝƐƐƵĞƌĞƐŽůƵƚŝŽŶĂŶĚŽƉĞƌĂƚŝŽŶĂů ƐƵƉƉŽƌƚ͕ƌĞƐƵůƚŝŶŐŝŶĂŚŝŐŚͲůĞǀĞůŽĨĐůŝĞŶƚƐĂƚŝƐĨĂĐƚŝŽŶ͘hŶůŝŬĞƐŽŵĞĐŽŵƉĂŶŝĞƐǁŚŽŽƵƚƐŽƵƌĐĞƚŚĞŝƌ ĂƉƉůŝĐĂƚŝŽŶƐƵƉƉŽƌƚƚŽĂƚŚŝƌĚƉĂƌƚLJ͕dLJůĞƌŽĨĨĞƌƐĂĐŽŵƉůĞƚĞƐŽůƵƚŝŽŶŽĨĐƵƐƚŽŵĞƌƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐƉƌŽǀŝĚĞĚďLJ ŽƵƌŝŶͲŚŽƵƐĞĞdžƉĞƌƚƐ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϯ dƌĂŶƐƉĂƌĞŶĐLJŝƐŝŵƉŽƌƚĂŶƚ͕ƚŚĂƚ͛ƐǁŚLJĞǀĞƌLJƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŝƐůŽŐŐĞĚŝŶƚŽdLJůĞƌ͛ƐƵƐƚŽŵĞƌZĞůĂƚŝŽŶƐŚŝƉ DĂŶĂŐĞŵĞŶƚ^LJƐƚĞŵĂŶĚŐŝǀĞŶĂƵŶŝƋƵĞŝŶĐŝĚĞŶƚŶƵŵďĞƌ͘dŚŝƐƐLJƐƚĞŵƚƌĂĐŬƐƚŚĞŚŝƐƚŽƌLJŽĨĞĂĐŚŝŶĐŝĚĞŶƚĂŶĚ ĞĂĐŚŝŶĐŝĚĞŶƚŝƐĂƐƐŝŐŶĞĚĂƉƌŝŽƌŝƚLJŶƵŵďĞƌ͕ǁŚŝĐŚĐŽƌƌĞƐƉŽŶĚƐƚŽLJŽƵƌŶĞĞĚƐĂŶĚĚĞĂĚůŝŶĞƐ͘ůŝĞŶƚƐĐĂŶƚƌĂĐŬ ƚŚĞƉƌŽŐƌĞƐƐŽĨƚŚĞƐĞŝŶĐŝĚĞŶƚƐŽŶůŝŶĞƵƐŝŶŐdLJůĞƌ͛ƐƐƵƉƉŽƌƚƉŽƌƚĂů͘ dLJůĞƌƉƌŽǀŝĚĞƐŽŶůŝŶĞĂŶĚĐŽŶƚŝŶƵŝŶŐĞĚƵĐĂƚŝŽŶƌĞƐŽƵƌĐĞƐĨŽƌŽƵƌĐůŝĞŶƚƐ͕ŝŶĐůƵĚŝŶŐďƵƚŶŽƚůŝŵŝƚĞĚƚŽƚŚĞ ĨŽůůŽǁŝŶŐƌĞƐŽƵƌĐĞƐ͘ ^ƵƉƉŽƌƚŚĂŶŶĞůƐ dLJůĞƌŽĨĨĞƌƐ>>ŝǀĞƚĞůĞƉŚŽŶĞƐƵƉƉŽƌƚŽŶŽƵƌƚŽůůͲĨƌĞĞƐƵƉƉŽƌƚŚŽƚůŝŶĞ;ϴĂŵʹϱƉŵĂĐƌŽƐƐĨŽƵƌh^ƚŝŵĞnjŽŶĞƐͿ͘ &ŽƌƵƌŐĞŶƚŽƌĐŽŵƉůĞdžƋƵĞƐƚŝŽŶƐ͕ƵƐĞƌƐƌĞĐĞŝǀĞ͕ƵŶůŝŵŝƚĞĚƚĞůĞƉŚŽŶĞƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚ͘ KŶͲůŝŶĞƐƵďŵŝƐƐŝŽŶ;ƉŽƌƚĂůͿĨŽƌůĞƐƐƵƌŐĞŶƚĂŶĚĨƵŶĐƚŝŽŶĂůŝƚLJͲďĂƐĞĚƋƵĞƐƚŝŽŶƐ͕ƵƐĞƌƐŵĂLJĐƌĞĂƚĞƵŶůŝŵŝƚĞĚ ƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐƚŚƌŽƵŐŚƚŚĞĐƵƐƚŽŵĞƌƌĞůĂƚŝŽŶƐŚŝƉŵĂŶĂŐĞŵĞŶƚƉŽƌƚĂůĂǀĂŝůĂďůĞĂƚƚŚĞdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ ǁĞďƐŝƚĞ͘ KƵƌͲŵĂŝůƐƵƉƉŽƌƚĂůůŽǁƐŽƵƌĐůŝĞŶƚƐƚŽĂƐŬƵŶůŝŵŝƚĞĚĚĞƚĂŝůĞĚƋƵĞƐƚŝŽŶƐ͕ĂƚƚĂĐŚĚŽĐƵŵĞŶƚƐĂŶĚƐĐƌĞĞŶƐŚŽƚƐ͕ ĂŶĚĞdžƉůĂŝŶƚŚĞŝƐƐƵĞƐƐŽƚŚĂƚŽƵƌƐƚĂĨĨĐĂŶĐƌĞĂƚĞĂƌĞƐŽůƵƚŝŽŶĞĨĨŝĐŝĞŶƚůLJ͘ dLJůĞƌŽŵŵƵŶŝƚLJʹLJŽƵƌĚŝƌĞĐƚůŝŶŬƚŽƚŚŽƵƐĂŶĚƐŽĨdLJůĞƌƐŽĨƚǁĂƌĞƵƐĞƌƐĂĐƌŽƐƐƚŚĞĐŽƵŶƚƌLJ͕ĂƐǁĞůůĂƐdLJůĞƌ ƉĞƌƐŽŶŶĞůŝŶƐƵƉƉŽƌƚ͕ŝŵƉůĞŵĞŶƚĂƚŝŽŶ͕ƐĂůĞƐ͕ĞƚĐ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϰ ^ƵƉƉŽƌƚZĞƐŽƵƌĐĞƐ xdLJůĞƌ^ĞĂƌĐŚʹĂŶŽŶůŝŶĞƋƵĞƌLJƚŽŽůƚŚĂƚƉƌŽǀŝĚĞƐĂŶƐǁĞƌƐĨŽƌLJŽƵƌƋƵĞƐƚŝŽŶƐďLJĐƵůůŝŶŐƚŚƌŽƵŐŚĂůů dLJůĞƌ͛ƐŽŶůŝŶĞƌĞƐŽƵƌĐĞƐƵƐŝŶŐ<ŶŽǁůĞĚŐĞĞŶƚĞƌĞĚ^ĞƌǀŝĐĞ xdLJůĞƌ<ŶŽǁůĞĚŐĞďĂƐĞʹĂĚŽĐƵŵĞŶƚĂƚŝŽŶůŝďƌĂƌLJŝŶĂƐŝŶŐůĞ͕ĞĂƐŝůLJĂĐĐĞƐƐŝďůĞůŽĐĂƚŝŽŶ xdLJůĞƌŽŵŵƵŶŝƚLJʹdLJůĞƌ͛ƐŽŶůŝŶĞĨŽƌƵŵĂǀĂŝůĂďůĞϮϰͬϳ xdLJůĞƌhŶŝǀĞƌƐŝƚLJʹdLJůĞƌ͛ƐĞͲůĞĂƌŶŝŶŐƐŽůƵƚŝŽŶƚŽĞŶŚĂŶĐĞƐƵƉƉŽƌƚĂŶĚƚƌĂŝŶŝŶŐŽĨLJŽƵƌĞŵƉůŽLJĞĞƐƵƐŝŶŐ LJŽƵƌĚĂƚĂ xdLJůĞƌZĞůĞĂƐĞDĂŶĂŐĞŵĞŶƚŽŶƐŽůĞΎʹ^ŚŽǁƐĂůůƌĞůĞĂƐĞǀĞƌƐŝŽŶŝŶĨŽƌŵĂƚŝŽŶ͕ǁŝƚŚĂƐƵŵŵĂƌLJŽĨĞĂĐŚ ƌĞůĞĂƐĞĂŶĚĂƐƐŽĐŝĂƚĞĚĞŶŚĂŶĐĞŵĞŶƚƐ͕ŽƉĞŶ͕ĐůŽƐĞĚĂŶĚŶŽŶͲĐƌŝƚŝĐĂůŝƐƐƵĞƐ xKŶůŝŶĞ,ĞůƉʹĐŽŶƚĞdžƚƐĞŶƐŝƚŝǀĞĨŝĞůĚŚĞůƉĂŶĚƉƌŽĐĞĚƵƌĂůŝŶĨŽƌŵĂƚŝŽŶƚŽĂƐƐŝƐƚLJŽƵƌƚĞĂŵŝŶ ĐŽŵƉůĞƚŝŶŐƉƌŽŐƌĂŵƚĂƐŬƐ xŶƐǁĞƌWĂŶĞůʹƐLJŽƵďĞŐŝŶĞŶƚĞƌŝŶŐLJŽƵƌĐĂƐĞĚĞƚĂŝůƐ͕dLJůĞƌ^ĞĂƌĐŚƉƌĞƐĞŶƚƐƌĞƐƵůƚƐŝŶƚŚĞƉĂŶĞůƚŚĂƚ ŵĂƚĐŚĞƐLJŽƵƌƋƵĞƐƚŝŽŶ͘ŶƐǁĞƌƐƉƌŽǀŝĚĞĚĂƌĞƚŚĞŵŽƐƚƌĞůĞǀĂŶƚƚŽLJŽƵƌƋƵĞƐƚŝŽŶ͕ƌĞŐĂƌĚůĞƐƐŽĨƚŚĞ ƐŽƵƌĐĞŽĨƚŚĞŝŶĨŽƌŵĂƚŝŽŶ͘ xDLJsŝĞǁΎʹDLJsŝĞǁŝƐĂƐĐƌĞĞŶĐĂƉƚƵƌĞƚŽŽůƚŽŐŝǀĞ^ƵƉƉŽƌƚŵŽƌĞŝŶĨŽƌŵĂƚŝŽŶƚŽĂƐƐŝƐƚĐůŝĞŶƚƐǁŝƚŚĂ ĐĂƐĞ͘dŚĞƌĞĐŽƌĚŝŶŐŝƐůŝŶŬĞĚƚŽƚŚĞĐĂƐĞĂŶĚǀŝƐŝďůĞŝŶƚŚĞKŶůŝŶĞ^ƵƉƉŽƌƚ/ŶĐŝĚĞŶƚƐƉŽƌƚĂů͘ xKŶůŝŶĞ^ƵƉƉŽƌƚWŽƌƚĂůʹůŽŐŽƌŵĂŶĂŐĞŝŶĐŝĚĞŶƚƐĂŶĚĂƚƚĂĐŚĚŽĐƵŵĞŶƚĂƚŝŽŶĂŶĚƐĐƌĞĞŶƐŚŽƚƐ x'ŽdŽƐƐŝƐƚΘŽŵŐĂƌΎʹƌĞŵŽƚĞĂƐƐŝƐƚĂŶĐĞĨƌŽŵ^ƵƉƉŽƌƚƵƐĞĚƚŽĐŽŶŶĞĐƚƚŽLJŽƵƌĚĞƐŬƚŽƉ xWŚŽŶĞʹdLJůĞƌƉƌŽǀŝĚĞƐĂĚĞĚŝĐĂƚĞĚϴϬϬŶƵŵďĞƌƚŚĂƚƉůĂĐĞƐŶŽůŝŵŝƚƐŽŶǁŚŽĨƌŽŵLJŽƵƌƚĞĂŵŵĂLJ ĐŽŶƚĂĐƚ^ƵƉƉŽƌƚ͕ŽƌƚŚĞŶƵŵďĞƌŽĨĐĂůůƐƉůĂĐĞĚ xŚĂƚΎʹĂĐĐĞƐƐŝďůĞǁŝƚŚŝŶƚŚĞƐŽĨƚǁĂƌĞ͕LJŽƵĐĂŶƐƉĞĂŬǁŝƚŚĂdLJůĞƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞƚŽƋƵŝĐŬůLJĂŶƐǁĞƌ ƋƵĞƐƚŝŽŶƐ x^ƚĂƚĞhƐĞƌ'ƌŽƵƉƐʹĨŽƌƵŵƐŽƌŐĂŶŝnjĞĚďLJdLJůĞƌƐƚĂĨĨĂŶĚĂƚƚĞŶĚĞĚďLJĞdžŝƐƚŝŶŐĐůŝĞŶƚƐƚŽŐĞƚƚŚĞůĂƚĞƐƚ ŝŶĨŽƌŵĂƚŝŽŶŽŶdLJůĞƌƉƌŽĚƵĐƚƐ xŶŶƵĂůŽŶĨĞƌĞŶĐĞʹdLJůĞƌŽŶŶĞĐƚĨĞĂƚƵƌĞƐŽŶůŝŶĞĐŽƵƌƐĞƐƚĂƵŐŚƚďLJdLJůĞƌƐƵďũĞĐƚŵĂƚƚĞƌĞdžƉĞƌƚƐ ŚŽƐƚĞĚŝŶĂĚŝĨĨĞƌĞŶƚĐŝƚLJĞĂĐŚLJĞĂƌ Ύ^ŽŵĞŽƉƚŝŽŶƐŵĂLJŶŽƚďĞŝŶĐůƵĚĞĚ͕ƉůĞĂƐĞƌĞǀŝĞǁǁŝƚŚĐĐŽƵŶƚdžĞĐƵƚŝǀĞĨŽƌĐŽŵƉůĞƚĞĚĞƚĂŝůƐ͘ ^ƵƉƉŽƌƚǀĂŝůĂďŝůŝƚLJ ZĞŐĂƌĚůĞƐƐŽĨŚŽǁLJŽƵƌƚĞĂŵĐŽŶƚĂĐƚƵƐ͕ǁĞĂƌĞŚĞƌĞƚŽŚĞůƉ͘dLJůĞƌdĞĐŚŶŝĐĂů^ƵƉƉŽƌƚŝƐĚŝǀŝĚĞĚŝŶƚŽ ĂƉƉůŝĐĂƚŝŽŶƐƉĞĐŝĨŝĐƚĞĂŵƐƚŽĞŶĂďůĞƉƌŽĚƵĐƚƐƉĞĐŝĂůŝnjĂƚŝŽŶĂŶĚƉƌŽǀŝĚĞƚŝŵĞůLJƌĞƐŽůƵƚŝŽŶŽĨƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐ͘ dŚŝƐĂƉƉůŝĐĂƚŝŽŶƐƉĞĐŝĨŝĐĂƉƉƌŽĂĐŚĂůůŽǁƐŽƵƌdĞĐŚŶŝĐĂů^ƵƉƉŽƌƚZĞƉƌĞƐĞŶƚĂƚŝǀĞƐƚŽĨŽĐƵƐŽŶĂƐŵĂůůŐƌŽƵƉŽĨ ĂƉƉůŝĐĂƚŝŽŶƐŽĨĨĞƌŝŶŐĂŚŝŐŚůĞǀĞůŽĨƉƌŽĚƵĐƚĞdžƉĞƌƚŝƐĞƚŽŽƵƌĐůŝĞŶƚƐ͘ƵƐƚŽŵĞƌƐƵƉƉŽƌƚ͛ƐŐŽĂůŝƐƚŽƌĞƚƵƌŶĂůů ƌĞƋƵĞƐƚƐĨŽƌ^ƵƉƉŽƌƚǁŝƚŚŝŶŽŶĞďƵƐŝŶĞƐƐŚŽƵƌ͘ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƐƵƉƉŽƌƚŝƐĂǀĂŝůĂďůĞĚƵƌŝŶŐƚŚĞůŽĐĂůďƵƐŝŶĞƐƐŚŽƵƌƐŽĨϴDƚŽϱWD;DŽŶĚĂLJʹ&ƌŝĚĂLJͿ ĂĐƌŽƐƐĨŽƵƌh^ƚŝŵĞnjŽŶĞƐ;WĂĐŝĨŝĐ͕DŽƵŶƚĂŝŶ͕ĞŶƚƌĂůĂŶĚĂƐƚĞƌŶͿ͘ůŝĞŶƚƐŵĂLJƌĞĐĞŝǀĞĐŽǀĞƌĂŐĞĂĐƌŽƐƐƚŚĞƐĞ ƚŝŵĞnjŽŶĞƐ͘dLJůĞƌ͛ƐŚŽůŝĚĂLJƐĐŚĞĚƵůĞŝƐŽƵƚůŝŶĞĚďĞůŽǁ͘dŚĞƌĞǁŝůůďĞŶŽƐƵƉƉŽƌƚĐŽǀĞƌĂŐĞŽŶƚŚĞƐĞĚĂLJƐ͘ xEĞǁzĞĂƌ͛ƐĂLJ xDĞŵŽƌŝĂůĂLJ x/ŶĚĞƉĞŶĚĞŶĐĞĂLJ x>ĂďŽƌĂLJ xdŚĂŶŬƐŐŝǀŝŶŐĂLJ xĂLJĂĨƚĞƌdŚĂŶŬƐŐŝǀŝŶŐ xŚƌŝƐƚŵĂƐĂLJ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϱ /ƐƐƵĞ,ĂŶĚůŝŶŐ dLJůĞƌƌĞĐŽƌĚƐĂůůLJŽƵƌĐŽŶƚĂĐƚƐĂŶĚŝŶĐŝĚĞŶƚƐŝŶĂĐƵƐƚŽŵĞƌƌĞůĂƚŝŽŶƐŚŝƉŵĂŶĂŐĞŵĞŶƚƐLJƐƚĞŵ͘dŚŝƐƐLJƐƚĞŵ ƚƌĂĐŬƐƚŚĞŚŝƐƚŽƌLJŽĨĞĂĐŚŝŶĐŝĚĞŶƚ͕ŝŶĐůƵĚŝŶŐƚŚĞĐŽŶƚĂĐƚ͕ƚŝŵĞ͕ƉƌŝŽƌŝƚLJůĞǀĞů͕ĐĂƐĞĚĞƐĐƌŝƉƚŝŽŶ͕ ĐŽƌƌĞƐƉŽŶĚĞŶĐĞ͕ĂƚƚĂĐŚĞĚĨŝůĞƐ͕ƐƵƉƉŽƌƚƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐ͕LJŽƵƌĨĞĞĚďĂĐŬ͕ĂŶĚƚŚĞƌĞƐŽůƵƚŝŽŶ͘dŚĞƉƌŝŽƌŝƚLJŝƐ ĂƐƐŝŐŶĞĚƚŽĞĂĐŚĐĂƐĞĂƐŝƚŝƐůŽŐŐĞĚďĂƐĞĚƵƉŽŶƚŚĞŝŶŝƚŝĂůŝŶĨŽƌŵĂƚŝŽŶƉƌŽǀŝĚĞĚĂŶĚĐĂŶďĞŵŽĚŝĨŝĞĚ͘ WƌŽďůĞŵƐĐĂůĂƚŝŽŶ dŚĞŐŽĂůŽĨƚŚĞdLJůĞƌ^ƵƉƉŽƌƚĚĞƉĂƌƚŵĞŶƚŝƐƚŽƉƌŽǀŝĚĞƚĞĐŚŶŝĐĂůĂƐƐŝƐƚĂŶĐĞƚŽdLJůĞƌWƌŽĚƵĐƚƵƐĞƌƐŝŶ ŽǀĞƌĐŽŵŝŶŐŝƐƐƵĞƐ͕ƵŶĚĞƌƐƚĂŶĚŝŶŐĐĞƌƚĂŝŶĨƵŶĐƚŝŽŶĂůŝƚLJ͕ĂŶĚƌĞĐŽŵŵĞŶĚŝŶŐĂƉƉƌŽĂĐŚĞƐƚŽǀĂƌŝŽƵƐƐŝƚƵĂƚŝŽŶƐ͘ ŶŝŶĐŝĚĞŶƚŝƐŽƌŝŐŝŶĂƚĞĚǁŚĞŶĂĐƵƐƚŽŵĞƌĐŽŶƚĂĐƚƐdLJůĞƌ͛ƐƐƵƉƉŽƌƚƐƚĂĨĨ͘^ƵƉƉŽƌƚĐĂŶďĞĐŽŶƚĂĐƚĞĚǀŝĂƚŚĞ ƚŽůůͲĨƌĞĞƐƵƉƉŽƌƚůŝŶĞ͕ĞͲŵĂŝů͕ŽƌƚŚĞƐƵƉƉŽƌƚǁĞďƐŝƚĞ͘dŚĞŝŶĐŝĚĞŶƚĐĂŶďĞƌĞĐĞŝǀĞĚŝŶƐĞǀĞƌĂůĚŝĨĨĞƌĞŶƚǁĂLJƐ ǀŝĂŽƵƌĨůĞdžŝďůĞƐƵƉƉŽƌƚƐLJƐƚĞŵƐ͘ /ĨƚŚĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŝƐƌĞĐĞŝǀĞĚǀŝĂƚŚĞƚŽůůͲĨƌĞĞƐƵƉƉŽƌƚůŝŶĞ͕ĂƐƵƉƉŽƌƚƌĞƉƌĞƐĞŶƚĂƚŝǀĞǁŝůůĐƌĞĂƚĞĂŶĚůŽŐ ƚŚĞƐƵƉƉŽƌƚŝƐƐƵĞŝŶƚŽŽƵƌŚĞůƉĚĞƐŬƐLJƐƚĞŵ͘dŚĞƐƵƉƉŽƌƚƌĞƉƌĞƐĞŶƚĂƚŝǀĞǁŝůůƚĂŬĞŽǁŶĞƌƐŚŝƉŽĨƚŚĞŝŶĐŝĚĞŶƚ ĂŶĚƐĞĞŝƚƚŽƌĞƐŽůƵƚŝŽŶ͘dŚĞƐƵƉƉŽƌƚƌĞƉƌĞƐĞŶƚĂƚŝǀĞǁŝůůƵƐĞŵĂŶLJĚŝĨĨĞƌĞŶƚƌĞƐŽƵƌĐĞƐƚŽƌĞƐŽůǀĞƚŚĞŝƐƐƵĞ ŝŶĐůƵĚŝŶŐŽŶͲůŝŶĞŚĞůƉ͕<ŶŽǁůĞĚŐĞĂƐĞ͕ĂĚǀŝƐŽƌƐ͕ƚĞĂŵůĞĂĚĞƌƐ͕ŵĂŶĂŐĞƌƐ͕ĂŶĚƐŽĨƚǁĂƌĞĚĞǀĞůŽƉĞƌƐ͘ /ĨƚŚĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŝƐƌĞĐĞŝǀĞĚǀŝĂĞͲŵĂŝůŽƌŽŶůŝŶĞƐƵƉƉŽƌƚƉŽƌƚĂů͕ĂŶŝŶĐŝĚĞŶƚŝƐĐƌĞĂƚĞĚ͕ĂŶĚĂƐƵƉƉŽƌƚ ƌĞƉƌĞƐĞŶƚĂƚŝǀĞǁŝůůĐŽŶƚĂĐƚƚŚĞĐƵƐƚŽŵĞƌďĂƐĞĚŽŶĂĐŽŵďŝŶĂƚŝŽŶŽĨƚŚĞƉƌŝŽƌŝƚLJŽĨƚŚĞŝƐƐƵĞĂŶĚƚŚĞŽƌĚĞƌ ƚŚĂƚƚŚĞŝƐƐƵĞǁĂƐƌĞĐĞŝǀĞĚ͘dŚĞƐƵƉƉŽƌƚƌĞƉƌĞƐĞŶƚĂƚŝǀĞǁŝůůƚĂŬĞŽǁŶĞƌƐŚŝƉŽĨƚŚĞŝŶĐŝĚĞŶƚĂŶĚƐĞĞŝƚƚŽ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϲ ƌĞƐŽůƵƚŝŽŶ͘dŚĞƐƵƉƉŽƌƚƌĞƉƌĞƐĞŶƚĂƚŝǀĞǁŝůůƵƐĞŵĂŶLJĚŝĨĨĞƌĞŶƚƌĞƐŽƵƌĐĞƐƚŽƌĞƐŽůǀĞƚŚĞŝƐƐƵĞŝŶĐůƵĚŝŶŐŽŶͲůŝŶĞ ŚĞůƉ͕<ŶŽǁůĞĚŐĞĂƐĞ͕ĂĚǀŝƐŽƌƐ͕ƚĞĂŵůĞĂĚĞƌƐ͕ŵĂŶĂŐĞƌƐ͕ĂŶĚƐŽĨƚǁĂƌĞĚĞǀĞůŽƉĞƌƐ͘ dŚĞdĞĂŵ>ĞĂĚĞƌƐĂŶĚDĂŶĂŐĞƌŽĨ^ƵƉƉŽƌƚ^ĞƌǀŝĐĞƐŵŽŶŝƚŽƌƚŚĞƐƚĂƚƵƐŽĨĂůůƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐƌĞĐĞŝǀĞĚ ĚƵƌŝŶŐƚŚĞĚĂLJ͘/ŶƐŝƚƵĂƚŝŽŶƐǁŚĞƌĞƚŚĞdĞĂŵ>ĞĂĚĞƌƐŽƌDĂŶĂŐĞƌŝĚĞŶƚŝĨLJĂŶŝŶĐŝĚĞŶƚƚŚĂƚŶĞĞĚƐĞƐĐĂůĂƚŝŽŶ͕ ƚŚĞdĞĂŵ>ĞĂĚĞƌŽƌDĂŶĂŐĞƌŵĂLJŵĂŶƵĂůůLJĞƐĐĂůĂƚĞƚŚĞŝŶĐŝĚĞŶƚŽƌĂƐƐŝŐŶŝƚƚŽĂƐƉĞĐŝĨŝĐƐƵƉƉŽƌƚ ƌĞƉƌĞƐĞŶƚĂƚŝǀĞ͘/ĨƚŚĞƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚƌĞƉƌĞƐĞŶƚĂƚŝǀĞĐĂŶŶŽƚƌĞƐŽůǀĞƚŚĞŝŶĐŝĚĞŶƚ͕ƚŚĞLJŚĂǀĞƐĞǀĞƌĂů ĚŝĨĨĞƌĞŶƚůĞǀĞůƐŽĨŚĞůƉŝŶŽƌĚĞƌƚŽƌĞƐŽůǀĞƚŚĞŝŶĐŝĚĞŶƚŝŶĂƚŝŵĞůLJŵĂŶŶĞƌ͘dŚĞůĞǀĞůƐĂƌĞĂƐĨŽůůŽǁƐ͗^ƵƉƉŽƌƚ ^ƉĞĐŝĂůŝƐƚхĚǀŝƐŽƌхdĞĂŵ>ĞĂĚĞƌхDĂŶĂŐĞƌŽĨ^ƵƉƉŽƌƚ^ĞƌǀŝĐĞƐхŝƌĞĐƚŽƌŽĨůŝĞŶƚ^ĞƌǀŝĐĞƐ͘ dLJůĞƌŽŵŵƵŶŝƚLJ ƐŵĞƌŝĐĂ͛ƐůĂƌŐĞƐƚƐŽĨƚǁĂƌĞƉƌŽǀŝĚĞƌĚĞĚŝĐĂƚĞĚƚŽƐĞƌǀŝŶŐƚŚĞƉƵďůŝĐƐĞĐƚŽƌ͕dLJůĞƌŝƐƵŶŝƋƵĞůLJƋƵĂůŝĨŝĞĚƚŽ ůĞǀĞƌĂŐĞƚŚĞĐŽŵďŝŶĞĚĞdžƉĞƌŝĞŶĐĞŽĨƚĞŶƐŽĨƚŚŽƵƐĂŶĚƐŽĨƵƐĞƌƐǁŝƚŚŽƵƌƐƚĂĨĨƐ͛ĚĞĞƉĚŽŵĂŝŶŬŶŽǁůĞĚŐĞƚŽ ďƌŝŶŐĂŽŶĞͲŽĨͲĂͲŬŝŶĚŝŶƚĞƌĂĐƚŝǀĞŽŶůŝŶĞĐŽŵŵƵŶŝƚLJ͘ /ŶƚŚĞdLJůĞƌŽŵŵƵŶŝƚLJĐůŝĞŶƚƐĐŽŶŶĞĐƚǁŝƚŚŽƚŚĞƌƵƐĞƌƐĂŶĚdLJůĞƌƐƚĂĨĨƚŽƐŚĂƌĞŝŶĨŽƌŵĂƚŝŽŶ͕ĐŽůůĂďŽƌĂƚĞ͕ ĂĐĐĞƐƐƐƵƉƉŽƌƚ͕ĂŶĚƌĞĐĞŝǀĞƚƌĂŝŶŝŶŐ͘/ŶƚŚŝƐŝŶƚĞƌĂĐƚŝǀĞĞŶǀŝƌŽŶŵĞŶƚ͕ŝŶĚŝǀŝĚƵĂůŬŶŽǁůĞĚŐĞŝƐĂŵƉůŝĨŝĞĚ ĞdžƉŽŶĞŶƚŝĂůůLJĂĐƌŽƐƐƚŚĞĐŽŵŵƵŶŝƚLJ͘ 'ĞƚĐŽŶŶĞĐƚĞĚ͘ŽŶŶĞĐƚǁŝƚŚĐŽůůĞĂŐƵĞƐĨƌŽŵŶĞŝŐŚďŽƌŝŶŐĐŽŵŵƵŶŝƚŝĞƐŽƌĨƌŽŵĂĐƌŽƐƐƚŚĞĐŽƵŶƚƌLJ͘ŶĚƐƚĂLJ ĐŽŶŶĞĐƚĞĚďLJũŽŝŶŝŶŐŐƌŽƵƉƐǁŝƚŚŽƚŚĞƌƵƐĞƌƐǁŚŽĂƌĞŝŶƚŚĞƐĂŵĞŐĞŽŐƌĂƉŚŝĐƌĞŐŝŽŶ͕ƐŚĂƌĞĐŽŵŵŽŶũŽď ĨƵŶĐƚŝŽŶƐŽƌƵƐĞƚŚĞƐĂŵĞƐŽĨƚǁĂƌĞƉƌŽĚƵĐƚƐ͘ :ŽŝŶƚŚĞŝƐĐƵƐƐŝŽŶ͘:ŽŝŶĚŝƐĐƵƐƐŝŽŶƐŽŶƚŽƉŝĐƐƚŚĂƚŝŵƉĂĐƚLJŽƵƌĚĂŝůLJůŝĨĞ͕ŬĞĞƉƵƉǁŝƚŚƚŚĞůĂƚĞƐƚƐŽĨƚǁĂƌĞƚŝƉƐ ĂŶĚƚƌŝĐŬƐĂŶĚĚŝƐĐŽǀĞƌǁŚĂƚŽƚŚĞƌĂŐĞŶĐŝĞƐĂƌŽƵŶĚƚŚĞŶĂƚŝŽŶĂƌĞĚŽŝŶŐƚŽĐŽŶŶĞĐƚĂŶĚĞŵƉŽǁĞƌƚŚĞŝƌ ĐŽŶƐƚŝƚƵĞŶƚƐ͘ ^ŽĨƚǁĂƌĞhƉĚĂƚĞƐΘDĂŝŶƚĞŶĂŶĐĞ dLJůĞƌŚĂƐƉƌŽǀĞŶŚŝƐƚŽƌLJŽĨƉƌŽǀŝĚŝŶŐƵƉŐƌĂĚĞƐĂŶĚĞŶŚĂŶĐĞŵĞŶƚƌĞůĞĂƐĞƐŽŶĂ ĐŽŶƚŝŶƵĂůďĂƐŝƐ͕ǁŚŝĐŚĂƌĞĂǀĂŝůĂďůĞƚŽĂůůĐůŝĞŶƚƐ͘KƵƌĞǀĞƌŐƌĞĞŶƉŚŝůŽƐŽƉŚLJĞŶƐƵƌĞƐ ƚŚĂƚƚŚŽƐĞƵƉŐƌĂĚĞƐĂŶĚĞŶŚĂŶĐĞŵĞŶƚƐĂƌĞƉƌŽǀŝĚĞĚĂƚŶŽĐŽƐƚƚŽƚŚŽƐĞĐƵƌƌĞŶƚ ǁŝƚŚƚŚĞŝƌĂŶŶƵĂůƐŽĨƚǁĂƌĞŵĂŝŶƚĞŶĂŶĐĞĐŽŶƚƌĂĐƚ͘ŶŚĂŶĐĞŵĞŶƚƌĞůĞĂƐĞƐƚĂŬĞƉůĂĐĞ ĞǀĞƌLJLJĞĂƌĂŶĚĂƌĞƐĐŚĞĚƵůĞĚǁŝƚŚƚŚĞĐůŝĞŶƚƚŽƉƌŽǀŝĚĞƚŚĞďĞƐƚƉŽƐƐŝďůĞƚŝŵĞĨƌĂŵĞ ĨŽƌďŽƚŚƚŚĞĐůŝĞŶƚĂŶĚdLJůĞƌ͘hƉŐƌĂĚĞƐ͕ŚŽǁĞǀĞƌ͕ŽĐĐƵƌƉĞƌŝŽĚŝĐĂůůLJĂŶĚĂƌĞ ŝŶŝƚŝĂƚĞĚďLJƚŚĞĐůŝĞŶƚĂƚĂŶLJƚŝŵĞǀŝĂƚŚĞ/ŶƚĞƌŶĞƚƚŚƌŽƵŐŚĂƉƌŽĐĞƐƐĐĂůůĞĚ>ŝǀĞ hƉĚĂƚĞ͕ŵĂŬŝŶŐƚŚĞƉƌŽĐĞƐƐĂƐĐŽŶǀĞŶŝĞŶƚĂƐƉŽƐƐŝďůĞĨŽƌŽƵƌĐůŝĞŶƚƐ͘WĂƚĐŚĞƐĂŶĚ ĨŝdžĞƐĂƌĞƉƌŽǀŝĚĞĚƚŽƚŚĞĐůŝĞŶƚƚŚƌŽƵŐŚ>ŝǀĞhƉĚĂƚĞĂƐǁĞůů͘ KƵƌĞǀĞƌŐƌĞĞŶĚĞǀĞůŽƉŵĞŶƚƉŚŝůŽƐŽƉŚLJŚĂƐďĞĞŶĂƐƚƌŽŶŐĚŝĨĨĞƌĞŶƚŝĂƚŽƌƚŚĂƚ ƐĞƉĂƌĂƚĞƐƵƐĨƌŽŵŽƵƌĐŽŵƉĞƚŝƚŽƌƐĂŶĚƉƌŽǀŝĚĞƐĂƐŝŐŶŝĨŝĐĂŶƚĐŽƐƚƐĂǀŝŶŐƐƚŽŽƵƌĨĂŵŝůLJŽĨ ĐůŝĞŶƚƐ͘dŚƌŽƵŐŚĞǀĞƌŐƌĞĞŶ͕ŽƵƌĐůŝĞŶƚƐƌĞĐĞŝǀĞƚŚĞůĂƚĞƐƚƚĞĐŚŶŽůŽŐLJĚĞǀĞůŽƉŵĞŶƚƐ͕ƌĞůĞĂƐĞƐ͕ĂŶĚƵƉĚĂƚĞƐ ǁŝƚŚŽƵƚƉĂLJŝŶŐĂĚĚŝƚŝŽŶĂůůŝĐĞŶƐĞĨĞĞƐʹĨŽƌƚŚĞůŝĨĞŽĨƚŚĞŝƌdLJůĞƌƉƌŽĚƵĐƚ͘tŚŝůĞƚŚŝƐŚĂƐƉƌŽǀŝĚĞĚŽƵƌĐůŝĞŶƚƐ ǁŝƚŚĂƌĞƚƵƌŶŽŶŝŶǀĞƐƚŵĞŶƚƚŚĂƚŝƐƵŶƌŝǀĂůĞĚŝŶŽƵƌŝŶĚƵƐƚƌLJ͕ƚŚĞĨƌĞƋƵĞŶĐLJĂŶĚĐŽŵƉůĞdžŝƚLJŽĨƐŽĨƚǁĂƌĞ ƌĞůĞĂƐĞƐĐĂŶƐŽŵĞƚŝŵĞƐĐƌĞĂƚĞĂĐŽŶƐƵŵƉƚŝŽŶŐĂƉĨŽƌŽƵƌĐůŝĞŶƚƐ͘ dŚĞŐĂƉĞdžŝƐƚƐǁŚĞŶŶĞǁĨĞĂƚƵƌĞƐĂƌĞƌĞůĞĂƐĞĚĂŶĚ͕ŽǀĞƌƚŝŵĞ͕ƵƐĞƌƐĚŽŶ͛ƚůĞĂƌŶĂŶĚĂƉƉůLJƚŚĞƐĞĨĞĂƚƵƌĞƐƚŽ ƚŚĞŝƌǁŽƌŬĞŶǀŝƌŽŶŵĞŶƚƐ͘ǀĞƌ'ƵŝĚĞΠŝƐĂdLJůĞƌͲǁŝĚĞĐŽŶƚŝŶƵŽƵƐŝŵƉƌŽǀĞŵĞŶƚŝŶŝƚŝĂƚŝǀĞƚŽĂĚĚƌĞƐƐƚŚĞ ĐŽŶƐƵŵƉƚŝŽŶŐĂƉ͘tŝƚŚǀĞƌ'ƵŝĚĞ͕ŽƵƌŐŽĂůŝƐƚŽŚĞůƉŽƵƌĐůŝĞŶƚƐĐŽŶƚŝŶƵĞƚŽŐƌŽǁĂŶĚĞǀŽůǀĞƚŚĞŝƌƵƐĞŽĨƚŚĞ ĨƵŶĐƚŝŽŶĂůŝƚLJĂŶĚĞŶŚĂŶĐĞŵĞŶƚƐŽĨƚŚĞŝƌdLJůĞƌƉƌŽĚƵĐƚŽǀĞƌƚŝŵĞ͘dŚƌŽƵŐŚŽƵƌǀĞƌ'ƵŝĚĞŝŶŝƚŝĂƚŝǀĞ͕ǁĞǁŝůů͗ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϳ x,ĞůƉĐůŝĞŶƚƐďĞƚƚĞƌůĞǀĞƌĂŐĞƉƌŽĚƵĐƚĞŶŚĂŶĐĞŵĞŶƚƐ xWƌŽǀŝĚĞĂǁŽƌŬĨůŽǁ͞ŵĂƚƵƌŝƚLJŵŽĚĞů͟ĨŽƌĐůŝĞŶƚƐƚŽĨŽůůŽǁ xKĨĨĞƌƐƚƌĂƚĞŐŝĐƉůĂŶŶŝŶŐƐĞƌǀŝĐĞƐĂŶĚƚƌĂŝŶŝŶŐƌĞƐŽƵƌĐĞƐ xKĨĨĞƌĂĐůŝĞŶƚĞdžĞĐƵƚŝǀĞƉƌŽŐƌĂŵƚŽŚĞůƉĐůŝĞŶƚƐďƵŝůĚĂŶĚŝŵƉůĞŵĞŶƚĂĐŽŶƚŝŶƵŽƵƐ xŝŵƉƌŽǀĞŵĞŶƚƉůĂŶ xWƌŽǀŝĚĞĚŽŵĂŝŶĞdžƉĞƌƚŝƐĞ͕ǁŝƚŚĚĞĨŝŶĞĚŝŶƚĞŐƌĂƚŝŽŶƉŽŝŶƚƐĂŶĚĐŽŵŵŽŶƐƵƉƉŽƌƚŵĞƚŚŽĚŽůŽŐLJ tŝƚŚǀĞƌ'ƵŝĚĞ͕ŽƵƌŐŽĂůŝƐƚŽŚĞůƉŽƵƌĐůŝĞŶƚƐĐŽŶƚŝŶƵĞƚŽŐƌŽǁĂŶĚĞǀŽůǀĞƚŚĞŝƌƵƐĞŽĨƚŚĞĨƵŶĐƚŝŽŶĂůŝƚLJĂŶĚ ĞŶŚĂŶĐĞŵĞŶƚƐŽĨƚŚĞŝƌdLJůĞƌƉƌŽĚƵĐƚŽǀĞƌĂůŽŶŐƉĞƌŝŽĚŽĨƚŝŵĞ͘/ƚ͛ƐĂůƐŽŽƵƌŚŽƉĞƚŚĂƚƚŚŝƐŝŶŝƚŝĂƚŝǀĞŝƐĂ ĐĂƚĂůLJƐƚĨŽƌŽƵƌĐůŝĞŶƚƐ͛ŽƌŐĂŶŝnjĂƚŝŽŶƐƚŽĞŵďƌĂĐĞĐŚĂŶŐĞ͕ĐŽŵŵŝƚƚŽƚƌĂŝŶŝŶŐĂŶĚĚĞǀĞůŽƉŝŶŐƚŚĞŝƌƐƚĂĨĨ͕ĂŶĚ ĨƵůůLJƵƐĞƚŚĞǁŝĚĞƌĂŶŐĞƐŽĨdLJůĞƌ͛ƐƐĞƌǀŝĐĞĂŶĚƐƵƉƉŽƌƚŽĨĨĞƌŝŶŐƐĂǀĂŝůĂďůĞƚŽƚŚĞŵ͘ ^ĞĐƚŝŽŶϱ͘ϬKŶŐŽŝŶŐ^ƵƉƉŽƌƚĂŶĚ,ŽƐƚŝŶŐ^ĞƌǀŝĐĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϴ ^ĞĐƚŝŽŶϲ͘ϬͲdžĐĞƉƚŝŽŶƐƚŽZ&W ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϭϵ ^ĞĐƚŝŽŶϲ͘ϬͲdžĐĞƉƚŝŽŶƐƚŽZ&W dLJůĞƌ^ƚĂƚĞŵĞŶƚZĞŐĂƌĚŝŶŐdžĐĞƉƚŝŽŶƐƚŽƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶ͛ƐZ&WĨŽƌŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂů dLJůĞƌ͛ƐWƌŽƉŽƐĂůŝƐďĂƐĞĚŽŶƚŚĞĚĞůŝǀĞƌLJŽĨƚŚĞƌĞƋƵĞƐƚĞĚƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐĂĐĐŽƌĚŝŶŐƚŽdLJůĞƌ͛ƐƐƚĂŶĚĂƌĚ ŝŵƉůĞŵĞŶƚĂƚŝŽŶŵĞƚŚŽĚŽůŽŐLJĂŶĚdLJůĞƌ͛ƐƐƚĂŶĚĂƌĚĐŽŶƚƌĂĐƚ;ƐͿ͘͘dŚĂƚŵĞƚŚŽĚŽůŽŐLJ͕ĂŶĚƚŚĂƚĐŽŶƚƌĂĐƚ;ƐͿ͕ŚĂǀĞ ďĞĞŶƌĞĨŝŶĞĚĂŶĚĞŶŚĂŶĐĞĚŽǀĞƌdLJůĞƌ͛ƐŵĂŶLJLJĞĂƌƐŽĨŽƉĞƌĂƚŝŽŶŝŶƚŚĞƉƵďůŝĐƐĞĐƚŽƌŝŶĨŽƌŵĂƚŝŽŶƚĞĐŚŶŽůŽŐLJ ŵĂƌŬĞƚ͘dLJůĞƌ͛ƐƐƵďŵŝƐƐŝŽŶŽĨŝƚƐWƌŽƉŽƐĂůĚŽĞƐŶŽƚĐŽŶƐƚŝƚƵƚĞĂǁĂŝǀĞƌŽĨdLJůĞƌ͛ƐƌŝŐŚƚƚŽŶĞŐŽƚŝĂƚĞĂŶLJĂŶĚĂůů ƚĞƌŵƐƚŽƚŚĞŵƵƚƵĂůƐĂƚŝƐĨĂĐƚŝŽŶŽĨƚŚĞƉĂƌƚŝĞƐ͘ dLJůĞƌŚĂƐƉƌŽǀŝĚĞĚĂĐŽƉLJŽĨŽƵƌƐƚĂŶĚĂƌĚdĞƌŵƐĂŶĚŽŶĚŝƚŝŽŶƐǁŝƚŚŝŶƚŚŝƐƌĞƐƉŽŶƐĞ͘dLJůĞƌŚĂƐĂůƐŽƉƌŽǀŝĚĞĚ ŝƚƐǀŝĚĞŶĐĞŽĨ/ŶƐƵƌĂŶĐĞĐĞƌƚŝĨŝĐĂƚĞĂŶĚŝƚƐƐŽƵƌĐĞĐŽĚĞĞƐĐƌŽǁĂŐƌĞĞŵĞŶƚǁŝƚŚ/ƌŽŶDŽƵŶƚĂŝŶ;ƚŽƚŚĞĞdžƚĞŶƚ LJŽƵĚĞƐŝƌĞƚŽĞƐĐƌŽǁƚŚĞdLJůĞƌƐŽƵƌĐĞĐŽĚĞƵŶĚĞƌĂƉĞƌƉĞƚƵĂůůŝĐĞŶƐĞĂŐƌĞĞŵĞŶƚͿ͘dLJůĞƌ͛ƐŝŶƐƵƌĂŶĐĞƉƌŽŐƌĂŵ ĂŶĚƐŽƵƌĐĞĐŽĚĞĞƐĐƌŽǁĂƌƌĂŶŐĞŵĞŶƚƐĂƌĞĞƐƚĂďůŝƐŚĞĚĂƚĂĐŽƌƉŽƌĂƚĞůĞǀĞůĂŶĚĂƌĞŶŽƚƐƵďũĞĐƚƚŽĐŚĂŶŐĞŽŶ ĂŶŝŶĚŝǀŝĚƵĂůĐƵƐƚŽŵĞƌďĂƐŝƐ͘ dLJůĞƌǁŝůůĐŽŶƐŝĚĞƌŝƚƐŝŵƉůĞŵĞŶƚĂƚŝŽŶŵĞƚŚŽĚŽůŽŐLJĂŶĚŝƚƐĐŽŶƚƌĂĐƚ;ƐͿƚŽďĞƚŚĞƐƚĂƌƚŝŶŐƉŽŝŶƚĨŽƌƚŚŽƐĞ ŶĞŐŽƚŝĂƚŝŽŶƐƵŶůĞƐƐĞdžƉƌĞƐƐůLJƐƚĂƚĞĚŽƚŚĞƌǁŝƐĞŝŶŝƚƐWƌŽƉŽƐĂů͘dLJůĞƌ͛ƐƐƚĂŶĚĂƌĚĐŽŶƚƌĂĐƚ;ƐͿĂƌĞŝŶĐůƵĚĞĚĨŽƌ LJŽƵƌƌĞĨĞƌĞŶĐĞ͘dŽƚŚĞĞdžƚĞŶƚLJŽƵƌĞƋƵĞƐƚƚŽŝŶĐŽƌƉŽƌĂƚĞLJŽƵƌďŝĚĚŽĐƵŵĞŶƚƐĂŶĚŽƵƌƉƌŽƉŽƐĂůĚŽĐƵŵĞŶƚƐ ŝŶƚŽƚŚĞĐŽŶƚƌĂĐƚƉĂĐŬĂŐĞ͕ǁĞǁŝůůĂŐƌĞĞƚŽĚŽƐŽĂƐůŽŶŐĂƐƚŚĞŽƌĚĞƌŽĨƉƌŝŽƌŝƚLJŝƐ;ĂͿƚŚĞĨŝŶĂů͕ŶĞŐŽƚŝĂƚĞĚ ĐŽŶƚƌĂĐƚ͖;ďͿŽƵƌƉƌŽƉŽƐĂůĚŽĐƵŵĞŶƚĂƚŝŽŶ͖ĂŶĚ;ĐͿLJŽƵƌďŝĚĚŽĐƵŵĞŶƚĂƚŝŽŶ͘ dLJůĞƌƌĞƚĂŝŶƐĂůůŝŶƚĞůůĞĐƚƵĂůƉƌŽƉĞƌƚLJĂŶĚĐŽŶĨŝĚĞŶƚŝĂůŝƚLJƌŝŐŚƚƐŝŶĂŶĚƚŽŽƵƌƉƌŽƉƌŝĞƚĂƌLJĂŶĚͬŽƌĐŽŶĨŝĚĞŶƚŝĂů ŝŶĨŽƌŵĂƚŝŽŶĂŶĚĚĞůŝǀĞƌĂďůĞƐ͘ WůĞĂƐĞƐĞĞƚŚĞĨŽůůŽǁŝŶŐƉĂŐĞƐĨŽƌĞdžĐĞƉƚŝŽŶƐƚŽƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶ͛ƐƚĞƌŵƐŽƵƚůŝŶĞĚǁŝƚŚŝŶƚŚŝƐZ&W͘ ^ĞĐƚŝŽŶϲ͘ϬͲdžĐĞƉƚŝŽŶƐƚŽZ&W ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϬ džĐĞƉƚŝŽŶƐƚŽƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶ͕DŝŶŶĞƐŽƚĂ;͞ůŝĞŶƚ͟ͿZĞƋƵĞƐƚĨŽƌWƌŽƉŽƐĂů͗ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵ dLJůĞƌ͛ƐWƌŽƉŽƐĂůŝƐďĂƐĞĚŽŶƚŚĞĚĞůŝǀĞƌLJŽĨƚŚĞƌĞƋƵĞƐƚĞĚƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐĂĐĐŽƌĚŝŶŐƚŽdLJůĞƌ͛Ɛ ƐƚĂŶĚĂƌĚŝŵƉůĞŵĞŶƚĂƚŝŽŶŵĞƚŚŽĚŽůŽŐLJĂŶĚdLJůĞƌ͛ƐƐƚĂŶĚĂƌĚĐŽŶƚƌĂĐƚ;ƐͿ͘dŚĂƚŵĞƚŚŽĚŽůŽŐLJ͕ĂŶĚƚŚĂƚ ĐŽŶƚƌĂĐƚ;ƐͿ͕ŚĂǀĞďĞĞŶƌĞĨŝŶĞĚĂŶĚĞŶŚĂŶĐĞĚŽǀĞƌdLJůĞƌ͛ƐŵĂŶLJLJĞĂƌƐŽĨŽƉĞƌĂƚŝŽŶŝŶƚŚĞƉƵďůŝĐƐĞĐƚŽƌ ŝŶĨŽƌŵĂƚŝŽŶƚĞĐŚŶŽůŽŐLJŵĂƌŬĞƚ͘dLJůĞƌ͛ƐƐƵďŵŝƐƐŝŽŶŽĨŝƚƐWƌŽƉŽƐĂůĚŽĞƐŶŽƚĐŽŶƐƚŝƚƵƚĞĂǁĂŝǀĞƌŽĨdLJůĞƌ͛Ɛ ƌŝŐŚƚƚŽŶĞŐŽƚŝĂƚĞĂŶLJĂŶĚĂůůƚĞƌŵƐƚŽƚŚĞŵƵƚƵĂůƐĂƚŝƐĨĂĐƚŝŽŶŽĨƚŚĞƉĂƌƚŝĞƐ͘dLJůĞƌƐŚĂůůďĞŽďůŝŐĂƚĞĚƚŽ ƉƌŽǀŝĚĞƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐŽŶůLJƵƉŽŶĞdžĞĐƵƚŝŽŶ͕ĂŶĚƵŶĚĞƌĂŶĚĂĐĐŽƌĚŝŶŐƚŽƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐ͕ŽĨ ƚŚĞŵƵƚƵĂůůLJŶĞŐŽƚŝĂƚĞĚĐŽŶƚƌĂĐƚďĞƚǁĞĞŶdLJůĞƌĂŶĚƚŚĞůŝĞŶƚ͘ dLJůĞƌǁŝůůĐŽŶƐŝĚĞƌŝƚƐŝŵƉůĞŵĞŶƚĂƚŝŽŶŵĞƚŚŽĚŽůŽŐLJĂŶĚŝƚƐĐŽŶƚƌĂĐƚ;ƐͿƚŽďĞƚŚĞƐƚĂƌƚŝŶŐƉŽŝŶƚĨŽƌƚŚŽƐĞ ŶĞŐŽƚŝĂƚŝŽŶƐƵŶůĞƐƐĞdžƉƌĞƐƐůLJƐƚĂƚĞĚŽƚŚĞƌǁŝƐĞŝŶŝƚƐWƌŽƉŽƐĂů͘dLJůĞƌ͛ƐƐƚĂŶĚĂƌĚĐŽŶƚƌĂĐƚ;ƐͿĂƌĞŝŶĐůƵĚĞĚĨŽƌ LJŽƵƌƌĞĨĞƌĞŶĐĞ͘dŽƚŚĞĞdžƚĞŶƚLJŽƵƌĞƋƵĞƐƚƚŽŝŶĐŽƌƉŽƌĂƚĞLJŽƵƌďŝĚĚŽĐƵŵĞŶƚƐĂŶĚŽƵƌƉƌŽƉŽƐĂůĚŽĐƵŵĞŶƚƐ ŝŶƚŽƚŚĞĐŽŶƚƌĂĐƚƉĂĐŬĂŐĞ͕ǁĞǁŝůůĂŐƌĞĞƚŽĚŽƐŽĂƐůŽŶŐĂƐƚŚĞŽƌĚĞƌŽĨƉƌŝŽƌŝƚLJŝƐ;ĂͿƚŚĞĨŝŶĂů͕ŶĞŐŽƚŝĂƚĞĚ ĐŽŶƚƌĂĐƚ͖;ďͿŽƵƌƉƌŽƉŽƐĂůĚŽĐƵŵĞŶƚĂƚŝŽŶ͖ĂŶĚ;ĐͿLJŽƵƌďŝĚĚŽĐƵŵĞŶƚĂƚŝŽŶ͘ ŽŶĚŝƚŝŽŶƐ;^ĞĐƚŝŽŶ͘ϱ͘ϰͿ͖WƌŝĐĞWƌŽƉŽƐĂů;^ĞĐƚŝŽŶ͘ϵͿ͗tĞƌĞƐĞƌǀĞƚŚĞƌŝŐŚƚƚŽŶĞŐŽƚŝĂƚĞƉƌŝĐŝŶŐĂŶĚ ƉĂLJŵĞŶƚƚĞƌŵƐƚŽƚŚĞŵƵƚƵĂůƐĂƚŝƐĨĂĐƚŝŽŶŽĨƚŚĞƉĂƌƚŝĞƐ͘ 'ŽǀĞƌŶŵĞŶƚ͛ƐZŝŐŚƚƐZĞƐĞƌǀĞĚ;^ĞĐƚŝŽŶ͘ϲ͘ϲͿ͖WƌŽƉŽƐĂů^ƵďŵŝƐƐŝŽŶ/ŶƐƚƌƵĐƚŝŽŶƐ;^ĞĐƚŝŽŶ͘ϭϮ͘ϳͿ͗dŚĞůŝĞŶƚ ŵĂLJƵƐĞƚŚĞdLJůĞƌWƌŽƉŽƐĂůĨŽƌŝƚƐŝŶƚĞƌŶĂůƌĞĨĞƌĞŶĐĞŝŶĞǀĂůƵĂƚŝŶŐƉƌŽƉŽƐĂůƐ͘dLJůĞƌƐŚĂůůƌĞƚĂŝŶŽǁŶĞƌƐŚŝƉŽĨ ĂůůƉƌŽƉƌŝĞƚĂƌLJŝŶĨŽƌŵĂƚŝŽŶĐŽŶƚĂŝŶĞĚŝŶĂůůĚĞůŝǀĞƌĂďůĞƐ͘dLJůĞƌƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽƉƌŽƚĞƐƚƚŚĞƉƵďůŝĐ ĚŝƐĐůŽƐƵƌĞŽĨŝƚƐĐŽŶĨŝĚĞŶƚŝĂůĂŶĚƉƌŽƉƌŝĞƚĂƌLJŝŶĨŽƌŵĂƚŝŽŶ͕ĐŽŶƐŝƐƚĞŶƚǁŝƚŚĂƉƉůŝĐĂďůĞƉƵďůŝĐƌĞĐŽƌĚƐůĂǁƐ͘ WƌŽƉŽƐĂů^ƵďŵŝƐƐŝŽŶ/ŶƐƚƌƵĐƚŝŽŶƐ;^ĞĐƚŝŽŶ͘ϭϮ͘ϯͿ͗dLJůĞƌ͛ƐƐŝŐŶĂƚƵƌĞŽŶƚŚĞWƌŽƉŽƐĂůŝŶĚŝĐĂƚĞƐĂĐĐĞƉƚĂŶĐĞďLJ dLJůĞƌŽĨƚĞƌŵƐ͕ĐŽŶĚŝƚŝŽŶƐ͕ĂŶĚƌĞƋƵŝƌĞŵĞŶƚƐƐĞƚĨŽƌƚŚŝŶƚŚĞZ&W͕ĞdžĐĞƉƚĂƐŵŽĚŝĨŝĞĚďLJ͕ƚĂŬĞŶĞdžĐĞƉƚŝŽŶƚŽ͕ ĂŶĚĂƐŽƚŚĞƌǁŝƐĞƉƌŽǀŝĚĞĚŝŶdLJůĞƌ͛ƐWƌŽƉŽƐĂů͘ WƌŽƉŽƐĂů^ƵďŵŝƐƐŝŽŶ/ŶƐƚƌƵĐƚŝŽŶƐ;^ĞĐƚŝŽŶ͘ϭϮ͘ϲͿ͗dŚĞƐŽĨƚǁĂƌĞǁŝůůďĞŝŵƉůĞŵĞŶƚĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚĂ ƐĐŚĞĚƵůĞĚĞƚĞƌŵŝŶĞĚďLJŵƵƚƵĂůĂŐƌĞĞŵĞŶƚŽĨdLJůĞƌĂŶĚƚŚĞůŝĞŶƚ͘ <ĞLJWĞƌƐŽŶŶĞů;^ĞĐƚŝŽŶ͘ϭͿ͗ĞĐĂƵƐĞƉĞƌƐŽŶŶĞůĂƌĞĂƐƐŝŐŶĞĚďĂƐĞĚŽŶĞdžƉĞƌŝĞŶĐĞĂŶĚĂǀĂŝůĂďŝůŝƚLJ͕dLJůĞƌ ĐĂŶŶŽƚĂůůŽǁƚŚĞůŝĞŶƚƚŽŝŶƚĞƌǀŝĞǁĂŶĚĂƉƉƌŽǀĞŬĞLJƉĞƌƐŽŶŶĞů͘/ŶƚŚĞĞǀĞŶƚdLJůĞƌƉĞƌƐŽŶŶĞůƉƌŽǀŝĚĞ ƐĞƌǀŝĐĞƐƚŚĂƚĚŽŶŽƚĐŽŶĨŽƌŵƚŽdLJůĞƌ͛ƐƐĞƌǀŝĐĞƐǁĂƌƌĂŶƚLJ͕dLJůĞƌǁŝůůďĞŐŝǀĞŶĂŶŽƉƉŽƌƚƵŶŝƚLJƚŽĐŽƌƌĞĐƚƚŚĞ ĚĞĨŝĐŝĞŶĐLJ͘/ŶƚŚĞĞǀĞŶƚƚŚĞĚĞĨŝĐŝĞŶĐLJƉĞƌƐŝƐƚƐ͕ƚŚĞůŝĞŶƚŵĂLJƌĞƋƵŝƌĞƚŚĞƌĞŵŽǀĂůŽĨƉĞƌƐŽŶŶĞůŝŶƋƵĞƐƚŝŽŶ͘ dLJůĞƌǁŝůůƵƐĞĐŽŵŵĞƌĐŝĂůůLJƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽŶŽƚƌĞŵŽǀĞdLJůĞƌƉĞƌƐŽŶŶĞůƉƌŽǀŝĚŝŶŐŽŶŐŽŝŶŐƐĞƌǀŝĐĞƐ ĨƌŽŵƚŚĞůŝĞŶƚ͛ƐŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘ tĂƌƌĂŶƚLJ;^ĞĐƚŝŽŶ͘ϮͿ͗&ŽƌĂƐůŽŶŐĂƐƚŚĞůŝĞŶƚŚĂƐĂĐƵƌƌĞŶƚDĂŝŶƚĞŶĂŶĐĞŐƌĞĞŵĞŶƚŝŶƉůĂĐĞ͕dLJůĞƌ ǁĂƌƌĂŶƚƐƚŚĂƚƚŚĞdLJůĞƌƐŽĨƚǁĂƌĞǁŝůůƐƵďƐƚĂŶƚŝĂůůLJĐŽŶĨŽƌŵƚŽƚŚĞĨƵŶĐƚŝŽŶĂůĚĞƐĐƌŝƉƚŝŽŶƐŽĨƚŚĞdLJůĞƌ ƐŽĨƚǁĂƌĞĐŽŶƚĂŝŶĞĚŝŶdLJůĞƌ͛ƐWƌŽƉŽƐĂů͕ŽƌƚŚĞŝƌĨƵŶĐƚŝŽŶĂůĞƋƵŝǀĂůĞŶƚ͘&ƵƚƵƌĞĨƵŶĐƚŝŽŶĂůŝƚLJŵĂLJďĞƵƉĚĂƚĞĚ͕ ŵŽĚŝĨŝĞĚ͕ŽƌŽƚŚĞƌǁŝƐĞĞŶŚĂŶĐĞĚƚŚƌŽƵŐŚŽƵƌŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ĂŶĚƚŚĞŐŽǀĞƌŶŝŶŐ ĨƵŶĐƚŝŽŶĂůĚĞƐĐƌŝƉƚŝŽŶƐĨŽƌƐƵĐŚĨƵƚƵƌĞĨƵŶĐƚŝŽŶĂůŝƚLJǁŝůůďĞƐĞƚĨŽƌƚŚŝŶŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚĚŽĐƵŵĞŶƚĂƚŝŽŶ͘ ^ĞĐƚŝŽŶϲ͘ϬͲdžĐĞƉƚŝŽŶƐƚŽZ&W ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϭ tĂƌƌĂŶƚLJZĞŵĞĚLJ;^ĞĐƚŝŽŶ͘ϯͿ͗/ĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĚŽĞƐŶŽƚƉĞƌĨŽƌŵĂƐǁĂƌƌĂŶƚĞĚ͕ǁĞǁŝůůƵƐĞĂůů ƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐ͕ĐŽŶƐŝƐƚĞŶƚǁŝƚŚŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚƐ͕ƚŽĐƵƌĞƚŚĞĞĨĞĐƚĂƐƐĞƚĨŽƌƚŚŝŶƚŚĞDĂŝŶƚĞŶĂŶĐĞ ĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚ͘ ^LJƐƚĞŵĐĐĞƉƚĂŶĐĞ;^ĞĐƚŝŽŶ͘ϰͿ͗dLJůĞƌŝƐǁŝůůŝŶŐƚŽŶĞŐŽƚŝĂƚĞĂŵƵƚƵĂůůLJĂŐƌĞĞĂďůĞĂĐĐĞƉƚĂŶĐĞƉƌŽĐĞƐƐ ďĂƐĞĚŽŶǁĂƌƌĂŶƚĞĚĨƵŶĐƚŝŽŶĂůŝƚLJ͘ ĚĚŝƚŝŽŶĂůhƐĞƌƐĂŶĚDŽĚƵůĞƐ;^ĞĐƚŝŽŶ͘ϱͿ͗dLJůĞƌǁŝůůŚŽůĚƌĂƚĞƐĨŽƌĂĚĚŝƚŝŽŶĂůƵƐĞƌƐĂŶĚŵŽĚƵůĞƐŝŶƉůĂĐĞ ĨŽƌƚǁĞůǀĞŵŽŶƚŚƐĨƌŽŵƚŚĞĐŽŶƚƌĂĐƚ͛ƐĞĨĨĞĐƚŝǀĞĚĂƚĞ͕ĞdžĐĞƉƚĂƐŽƚŚĞƌǁŝƐĞŵƵƚƵĂůůLJĂŐƌĞĞĚƚŽďLJƚŚĞƉĂƌƚŝĞƐ͘ ĐĐƵƌĂĐLJŽĨWƌŽƉŽƐĂů&ĞĞƐ;^ĞĐƚŝŽŶ͘ϲͿ͗dLJůĞƌƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽŶĞŐŽƚŝĂƚĞƚŚĞůĂŶŐƵĂŐĞŽĨƚŚŝƐƉƌŽǀŝƐŝŽŶ ƚŽƚŚĞŵƵƚƵĂůƐĂƚŝƐĨĂĐƚŝŽŶŽĨƚŚĞƉĂƌƚŝĞƐ͘ ^ĞĐƚŝŽŶϲ͘ϬͲdžĐĞƉƚŝŽŶƐƚŽZ&W ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϮ ^ĞĐƚŝŽŶϳ͘ϬͲĞůŝǀĞƌĂďůĞƐĂŶĚWƌŽũĞĐƚKƵƚĐŽŵĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϯ ^ĞĐƚŝŽŶϳ͘ϬͲĞůŝǀĞƌĂďůĞƐĂŶĚWƌŽũĞĐƚKƵƚĐŽŵĞƐ 7KLVVHFWLRQVKRXOGGHVFULEHSURSRVHGSURMHFWGHOLYHUDEOHVDQGSDVWFOLHQW RXWFRPHVVSHFLILFDOO\DGGUHVVLQJ WKHIROORZLQJ 3URYLGHDOLVWLQJRISURMHFWGHOLYHUDEOHVZRUNSURGXFWVDQGIRUHDFKLGHQWLI\ x3XUSRVHRIGHOLYHUDEOH x([SHFWHGVFRSHFRQWHQWVRIGHOLYHUDEOH x,IGHOLYHUDEOHLVH[SHFWHGWRKDYHYDOXHRXWVLGHWKH(53LPSOHPHQWDWLRQSURMHFW WůĞĂƐĞƐĞĞdLJůĞƌ͛Ɛ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶŝŶ^ĞĐƚŝŽŶϰ͘ϬŽĨƚŚŝƐZ&WZĞƐƉŽŶƐĞĨŽƌĚĞƚĂŝůƐŽŶƉƌŽũĞĐƚĚĞůŝǀĞƌĂďůĞƐ͘ 3URYLGHDQH[FHUSWIURPSURMHFWGHOLYHUDEOHVVKRZLQJSURFHVVGRFXPHQWDWLRQFRQILJXUDWLRQ GRFXPHQWDWLRQWHVWLQJVFULSWVWUDLQLQJPDWHULDOVDQGUHTXLUHPHQWVWUDFHDELOLW\ 7KH*RYHUQPHQWLVORRNLQJWRIXOO\OHYHUDJHWKHKXPDQUHVRXUFHIXQFWLRQDOLW\LQWKHV\VWHP 3OHDVHGHVFULEH DSDVWSURMHFWZKHUH\RXIHHO\RXUFOLHQWHVWDEOLVKHGDQHIIHFWLYHV\VWHPPRGHOHG LQ³EHVWSUDFWLFH´IRU PDQDJLQJDQHPSOR\HH¶VKXPDQUHVRXUFHVIRUHPSOR\HHHYDOXDWLRQV WUDLQLQJVNLOOVFHUWLILFDWLRQV VXFFHVVLRQSODQQLQJDQGUHFUXLWLQJ /ŶĐŽĚĞϭϬŚĂƐƚŚĞĐĂƉĂďŝůŝƚLJŽĨƚƌĂĐŬŝŶŐĞǀĂůƵĂƚŝŽŶƐ͕ƚƌĂŝŶŝŶŐ;ǀĞŶĚŽƌΘŚŽƵƌƐͿĂŶĚĐĞƌƚŝĨŝĐĂƚŝŽŶƐ͘dŚĞƐĞĂƌĞĂůů ŚŽƵƐĞĚŝŶĚŝǀŝĚƵĂůůLJŽŶƚŚĞĞŵƉůŽLJĞĞƉĂŐĞĂŶĚĐĂŶďĞĂĐĐĞƐƐĞĚŝŶǀĂƌŝŽƵƐƌĞƉŽƌƚŝŶŐŵĞƚŚŽĚƐ͘ WĂLJƌŽůůĐĂŶŐŽůŝǀĞĂƚĂŶLJƚŝŵĞŽĨƚŚĞLJĞĂƌ͘KƵƌƌĞĐŽŵŵĞŶĚĂƚŝŽŶǁŽƵůĚďĞƚŽůŽŽŬĂƚƚŚĞƉĂLJƌŽůůĐĂůĞŶĚĂƌĂŶĚ ƉŝĐŬĂƚŝŵĞƚŚĂƚ͛ƐƐůŽǁĂƐĨĂƌĂƐƉĂLJƌŽůůƌĞůĂƚĞĚĐŚĂŶŐĞƐ͘tĞĚŽŶ͛ƚƌĞĐŽŵŵĞŶĚůŝǀĞƉĂLJƌŽůůƚŽďĞƐĐŚĞĚƵůĞĚ ĚƵƌŝŶŐĂƚŝŵĞŽĨŽƉĞŶĞŶƌŽůůŵĞŶƚ͕ƌĂŝƐĞƐ͕ƐĞĂƐŽŶĂůĐŚĂŶŐĞƐ͕ĞĐƚŝĨŝƚĐĂŶďĞĂǀŽŝĚĞĚ͘dŚĞďĞŐŝŶŶŝŶŐŽĨďŽƚŚ ĐĂůĞŶĚĂƌLJĞĂƌĂŶĚĨŝƐĐĂůLJĞĂƌƐĂƌĞƚLJƉŝĐĂůůLJďƵƐLJƚŝŵĞƐŽĨLJĞĂƌǁŝƚŚůŽƚƐŽĨĐŚĂŶŐĞƐŚĂƉƉĞŶŝŶŐ͕ĂŶĚĚĞƉĞŶĚŝŶŐ ŽŶLJŽƵƌƐƚĂĨĨƐŝnjĞŝƚŵĂLJŽƌŵĂLJŶŽƚďĞĂŐŽŽĚƚŝŵĞĨŽƌLJŽƵ͘^ƚĂĨĨĂǀĂŝůĂďŝůŝƚLJĂŶĚǁŽƌŬůŽĂĚĂƌĞǀĞƌLJŝŵƉŽƌƚĂŶƚ ĨĂĐƚŽƌƐǁŚĞŶĚĞƚĞƌŵŝŶŝŶŐƚŝŵŝŶŐŽĨŐŽůŝǀĞ͘ 7KH*RYHUQPHQWGHVLUHVWRDXWRPDWHWKHH[FKDQJHRILQIRUPDWLRQEHWZHHQWKHV\VWHPDQG YDULRXVEHQHILW SURYLGHUV3OHDVHH[SODLQVSHFLILFSDVWFOLHQWH[DPSOHVZKHUH\RXUILUPKHOSHG HVWDEOLVKWKHVHLQWHUIDFHV /ŶĐŽĚĞϭϬĚŽĞƐŶŽƚůŝŶŬƚŽĂŶLJƉƌŽǀŝĚĞƌƐƉĞĐŝĨŝĐĂůůLJ͘ůŝĞŶƚƐŚĂǀĞƚŚĞĐĂƉĂďŝůŝƚLJŽĨƵƉůŽĂĚŝŶŐŽƉƚŝŽŶƐŽĨďĞŶĞĨŝƚ ƐĞůĞĐƚŝŽŶƚŽ^^;ŵƉůŽLJĞĞ^ĞůĨʹ^ĞƌǀŝĐĞͿǁŚŝĐŚĂůůŽǁƐĞŵƉůŽLJĞĞƐƚŽŵĂŬĞƚŚĞŝƌďĞŶĞĨŝƚƐĞůĞĐƚŝŽŶƐ ĞůĞĐƚƌŽŶŝĐĂůůLJ͘dŚŽƐĞƐĞůĞĐƚŝŽŶƐƵƉĚĂƚĞƚŚĞĞŵƉůŽLJĞĞƉĂŐĞĨŽƌŶĞǁŽƉĞŶĞŶƌŽůůŵĞŶƚ͘ 7KH*RYHUQPHQW¶VORQJWHUPILVFDOVXVWDLQDELOLW\GHSHQGVRQDELOLW\WRPDNHVPDUWEXGJHW GHFLVLRQVFUHDWH ORQJUDQJHILQDQFLDOSODQVDQGHIIHFWLYHO\PDQDJHLWVH[LVWLQJFDSLWDO LQIUDVWUXFWXUHDQGHTXLSPHQW3OHDVH GHVFULEHDSDVWSURMHFWZKHUHWKHSURSRVHGVRIWZDUHLVXVHG WRFRPSOHWHWKHIROORZLQJ x&UHDWHDSURJUDPEXGJHW /ŶĐŽĚĞϭϬŽĨĨĞƌƐďŽƚŚ&ŝƐĐĂůzĞĂƌƵĚŐĞƚŝŶŐĂƐǁĞůůĂƐWƌŽũĞĐƚĐĐŽƵŶƚŝŶŐƵĚŐĞƚƐ͘WƌŽũĞĐƚĐĐŽƵŶƚŝŶŐ ƵĚŐĞƚƐĐĂŶĐƌŽƐƐŵƵůƚŝƉůĞLJĞĂƌƐ͘&ŝƐĐĂůƵĚŐĞƚŝŶŐŚĂƐƚŚĞĐĂƉĂďŝůŝƚŝĞƐŽĨWƌŽũĞĐƚŝŽŶ^ĐĞŶĂƌŝŽƐΘEŽƚĞƐΘ ĞƚĂŝůdƌĂĐŬŝŶŐ͕/ŵƉŽƌƚŝŶŐĨƌŽŵĞdžĐĞů͕ƵĚŐĞƚŽŵƉĂƌŝƐŽŶƚŽŶĂŵĞĂĨĞǁ͘ x&RQVLGHUPXOWLSOHVFHQDULRVWKDWLPSDFWVHUYLFHOHYHOV WƌŽũĞĐƚŝŽŶ^ĐĞŶĂƌŝŽƐĂƌĞŽĨƚĞŶƵƐĞĚƚŽĞǀĂůƵĂƚĞďƵĚŐĞƚŶƵŵďĞƌƐǁŝƚŚĚŝĨĨĞƌĞŶƚƐĐĞŶĂƌŝŽƐŝŶ ƉůĂĐĞ͘ ^ĞĐƚŝŽŶϳ͘ϬͲĞůŝǀĞƌĂďůĞƐĂŶĚWƌŽũĞĐƚKƵƚĐŽŵĞƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϰ x&UHDWHORQJWHUPILQDQFLDOSURMHFWLRQV ^ŽŵĞƐŝƚĞƐĐƌĞĂƚĞŵƵůƚŝLJĞĂƌďƵĚŐĞƚƐ͕ƌĞǀŝƐŝƚŝŶŐƚŚĞƐĞĐŽŶĚͬƚŚŝƌĚ͕ĞƚĐ͘ĂƐƚŝŵĞƉƌŽŐƌĞƐƐĞƐ͘dŚĞ ďƵĚŐĞƚĐŽĚĞĨŽƌƚŚĞĂƉƉƌŽƉƌŝĂƚĞLJĞĂƌŝƐŝŶƐƚĂůůĞĚ͘ x'HYHORSDPXOWL\HDU&,3 WƌŽũĞĐƚĐĐŽƵŶƚŝŶŐĐĂŶƐĞƌǀĞĂƐĂĨĂŶƚĂƐƚŝĐƌĞƐŽƵƌĐĞĨŽƌƚŚŝƐ͘/ƚǁŝůůĂůůŽǁŵƵůƚŝLJĞĂƌ͕ďƵĚŐĞƚŝŶŐ ĂŶĚƚƌĂĐŬƌĞǀĞŶƵĞƐͬĞdžƉĞŶƐĞƐ͘ x&UHDWHDVVHWUHSODFHPHQWVFKHGXOHV DŽƌĞŝŶĨŽƌŵĂƚŝŽŶŝƐƌĞƋƵŝƌĞĚƚŽďĞƚƚĞƌƌĞƐƉŽŶĚƚŽƚŚŝƐƌĞƋƵŝƌĞŵĞŶƚ x,GHQWLI\ORQJWHUPIXQGLQJQHHGVIRUFDSLWDOSURMHFWV dŚĞďƵĚŐĞƚŝŶŐŵŽĚƵůĞĐĂŶďĞƵƚŝůŝnjĞĚĨŽƌƚŚŝƐŶĞĞĚ͘ :LWKWKHV\VWHPWKH*RYHUQPHQWH[SHFWVWRLPSURYHWKHHIIHFWLYHQHVVRILWVSXUFKDVLQJIXQFWLRQ DQGD VLJQLILFDQWSDUWRIWKDWZLOOGHSHQGRQWKHDELOLW\WRFROOHFWDQGUHSRUWLQIRUPDWLRQIURPS FDUGV3OHDVH GHVFULEHKRZSDVWFOLHQWVKDYHXVHGSFDUGLQWHJUDWLRQWRWUDFNVSHQGLQJE\YHQGRU W\SHRISXUFKDVHDQG XVHU /ŶĐŽĚĞϭϬŚĂƐƚŚĞĐĂƉĂďŝůŝƚLJŽĨŝŵƉŽƌƚŝŶŐƉĐĂƌĚŝŶĨŽƌŵĂƚŝŽŶĨŽƌŵƚŚĞǀĞŶĚŽƌ͘dŚĞƉƵƌĐŚĂƐĞƐŵĂĚĞŽŶĂƉĐĂƌĚ ĂƌĞůŽĂĚĞĚĂƐƉƵƌĐŚĂƐĞƐŽŶƚŚĞŝŶĚŝǀŝĚƵĂůǀĞŶĚŽƌƐŚŝƐƚŽƌLJƚĂď͘ŽŵŵŽĚŝƚLJĐŽĚĞƐĐĂŶďĞƵƐĞĚĂƐĂǁĂLJƚŽ ƚƌĂĐŬĂƚLJƉĞŽĨƉƵƌĐŚĂƐĞ͘/ŶĐŽĚĞϭϬŝŶƚŚĞǁĞďĚŽĞƐŚĂǀĞƐŽŵĞŶĞǁƵƐĞƌĂƉƉƌŽǀĂůĨƵŶĐƚŝŽŶĂůŝƚLJ͘ :LWKPRGHUQWHFKQRORJ\SURYLGLQJJUHDWHUDFFHVVWRLQIRUPDWLRQ*RYHUQPHQWHPSOR\HHVDQG PDQDJHUVDUH DEOHWREHWWHUXWLOL]HLQIRUPDWLRQIRUGHFLVLRQPDNLQJ+RZHYHUPXFKRIWKLVUHOLHV RQKDYLQJWHFKQRORJ\ WKDWLVWUXO\DFFHVVLEOH 3OHDVHLGHQWLI\KRZDSDVWFOLHQWXVHGPRELOH IHDWXUHVGDVKERDUGVUHSRUWLQJWRROV DQGVHOIVHUYLFHFDSDELOLWLHVWRFUHDWHDVRXUFHRI LQIRUPDWLRQWKDWLVZLGHO\XVHGDFURVVWKHRUJDQL]DWLRQ /ŶĐŽĚĞϭϬŚĂƐŵŽďŝůĞĨĞĂƚƵƌĞƐŝŶǁĞďĂŶĚƚŚĞůŝƐƚŝƐŐƌŽǁŝŶŐĚĂŝůLJ͘^ŵĂƌƚĂƌĚƐĂƌĞƵƐĞĚŽŶĂƐŚďŽĂƌĚǀŝĞǁƐ ĨŽƌƋƵŝĐŬůŽŽŬƐŽĨǁŽƌŬƚŚĂƚ͞ŶĞĞĚƐƚŽďĞĐŽŵƉůĞƚĞĚ͘͟ŵƉůŽLJĞĞ^ĞůĨͲ^ĞƌǀŝĐĞdŝŵĞΘƚƚĞŶĚĂŶĐĞĐĂŶďĞƵƐĞĚ ĨŽƌĞŵƉůŽLJĞĞƵƉĚĂƚĞƐƐƵĐŚĂƐĂĚĚƌĞƐƐĐŚĂŶŐĞƐ͕ƉŚŽŶĞĐŚĂŶŐĞƐ͕ƉƚŽƌĞƋƵĞƐƚƐ͕ǁͲϰŝŶĨŽƌŵĂƚŝŽŶ͕ĐŚĞĐŬ ƐŝŵƵůĂƚŝŽŶ͕ΘďĞŶĞĨŝƚĞŶƌŽůůŵĞŶƚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϱ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ 3URSRVHUVVKRXOGLQFOXGHVDPSOHFRSLHVRIWKHIROORZLQJGRFXPHQWV $Q\VDPSOHDJUHHPHQWVWKDWWKH*RYHUQPHQWZRXOGEHUHTXLUHGWRVLJQXSRQFRQWUDFWDZDUG 7KLVZRXOG LQFOXGHDQ\DSSOLFDEOHVRIWZDUHOLFHQVHDJUHHPHQWVSURIHVVLRQDOVHUYLFHDJUHHPHQWVKRVWLQJDJUHHPHQWV WKLUGSDUW\DJUHHPHQWVHWF WůĞĂƐĞƐĞĞƚŚĞdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƐƚĂŶĚĂƌĚdĞƌŵƐĂŶĚŽŶĚŝƚŝŽŶƐĐŽŶƚƌĂĐƚŝŶƚŚŝƐƐĞĐƚŝŽŶŽĨƚŚŝƐZ&W ZĞƐƉŽŶƐĞ͘dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŝƐǁŝůůŝŶŐƚŽŶĞŐŽƚŝĂƚĞĐŽŶƚƌĂĐƚƚĞƌŵƐƚŽƐƵŝƚďŽƚŚƉĂƌƚŝĞƐƵƉŽŶĂǁĂƌĚŽĨ ĐŽŶƚƌĂĐƚ͘ 6DPSOH3URMHFW3ODQ dLJůĞƌƌĞĐŽŵŵĞŶĚƐĂƉŚĂƐĞĚŝŵƉůĞŵĞŶƚĂƚŝŽŶĂƉƉƌŽĂĐŚ͕ƐƚĂŐŐĞƌŝŶŐƐƚĂƌƚĂŶĚůŝǀĞĚĂƚĞƐĨŽƌĞĂĐŚƉŚĂƐĞŽĨƚŚĞ ƉƌŽũĞĐƚ͘>ŝǀĞĚĂƚĞƐǁŝůůďĞƚĂƌŐĞƚƐďƵƚƐŚŽƵůĚŶŽƚƉůĂĐĞƵŶŶĞĐĞƐƐĂƌLJĐŽŶƐƚƌĂŝŶƚƐŽŶƚŚĞƉƌŽũĞĐƚ͘dŚĞĨŽůůŽǁŝŶŐ ƐĐŚĞĚƵůĞƚĂŬĞƐŝŶƚŽĐŽŶƐŝĚĞƌĂƚŝŽŶƚŚĞŝƚLJ͛ƐŐŽĂůƐĂŶĚdLJůĞƌ͛ƐƌĞĐŽŵŵĞŶĚĞĚĂƉƉƌŽĂĐŚ͕ĂŶĚĂƐƐƵŵĞƐƚŚĞ ƉƌŽĚƵĐƚǁŝůůďĞƵƐĞĚĂƐŝƐ͕ǁŝƚŚŽƵƚĂĚĚŝƚŝŽŶĂůŐŽͲůŝǀĞĐƵƐƚŽŵŝnjĂƚŝŽŶƐ͘ WƌŽƉŽƐĞĚWƌŽũĞĐƚWŚĂƐĞƐ WƌŽƉƌŝĞƚĂƌLJĂŶĚŽŶĨŝĚĞŶƚŝĂůʹ^ƵďũĞĐƚƚŽZĞƐƚƌŝĐƚŝŽŶƐŽŶŝƐĐůŽƐƵƌĞ /ŶĐŽĚĞ&ŝŶĂŶĐŝĂůDĂŶĂŐĞŵĞŶƚdŝŵĞůŝŶĞ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϲ >/E^E^Zs/^'ZDEdϭ dŚŝƐ>ŝĐĞŶƐĞĂŶĚ^ĞƌǀŝĐĞƐŐƌĞĞŵĞŶƚŝƐŵĂĚĞďĞƚǁĞĞŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ĂŶĚůŝĞŶƚ͘ t,Z^͕ůŝĞŶƚƐĞůĞĐƚĞĚdLJůĞƌƚŽůŝĐĞŶƐĞƚŚĞƐŽĨƚǁĂƌĞƉƌŽĚƵĐƚƐĂŶĚƉĞƌĨŽƌŵƚŚĞƐĞƌǀŝĐĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂŶĚdLJůĞƌĚĞƐŝƌĞƐƚŽƉĞƌĨŽƌŵƐƵĐŚĂĐƚŝŽŶƐƵŶĚĞƌƚŚĞƚĞƌŵƐŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͖ EKtd,Z&KZ͕ŝŶĐŽŶƐŝĚĞƌĂƚŝŽŶŽĨƚŚĞĨŽƌĞŐŽŝŶŐĂŶĚŽĨƚŚĞŵƵƚƵĂůĐŽǀĞŶĂŶƚƐĂŶĚƉƌŽŵŝƐĞƐƐĞƚĨŽƌƚŚŝŶ ƚŚŝƐŐƌĞĞŵĞŶƚ͕dLJůĞƌĂŶĚůŝĞŶƚĂŐƌĞĞĂƐĨŽůůŽǁƐ͗ ^d/KEʹ&/E/d/KE^ x͞ŐƌĞĞŵĞŶƚ͟ŵĞĂŶƐƚŚŝƐ>ŝĐĞŶƐĞĂŶĚ^ĞƌǀŝĐĞƐŐƌĞĞŵĞŶƚ͘ x͞ƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJ͟ŵĞĂŶƐŽƵƌďƵƐŝŶĞƐƐƚƌĂǀĞůƉŽůŝĐLJ͘ĐŽƉLJŽĨŽƵƌĐƵƌƌĞŶƚƵƐŝŶĞƐƐ dƌĂǀĞůWŽůŝĐLJŝƐĂƚƚĂĐŚĞĚĂƐ^ĐŚĞĚƵůĞϭƚŽdžŚŝďŝƚ͘ x͞ůŝĞŶƚ͟ŵĞĂŶƐ/E^Zd>/EdED͘ x͞ĞĨĞĐƚ͟ŵĞĂŶƐĂĨĂŝůƵƌĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞƚŽƐƵďƐƚĂŶƚŝĂůůLJĐŽŶĨŽƌŵƚŽƚŚĞĨƵŶĐƚŝŽŶĂů ĚĞƐĐƌŝƉƚŝŽŶƐƐĞƚĨŽƌƚŚŝŶŽƵƌǁƌŝƚƚĞŶƉƌŽƉŽƐĂůƚŽLJŽƵ͕ŽƌƚŚĞŝƌĨƵŶĐƚŝŽŶĂůĞƋƵŝǀĂůĞŶƚ͘&ƵƚƵƌĞ ĨƵŶĐƚŝŽŶĂůŝƚLJŵĂLJďĞƵƉĚĂƚĞĚ͕ŵŽĚŝĨŝĞĚ͕ŽƌŽƚŚĞƌǁŝƐĞĞŶŚĂŶĐĞĚƚŚƌŽƵŐŚŽƵƌŵĂŝŶƚĞŶĂŶĐĞ ĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ĂŶĚƚŚĞŐŽǀĞƌŶŝŶŐĨƵŶĐƚŝŽŶĂůĚĞƐĐƌŝƉƚŝŽŶƐĨŽƌƐƵĐŚĨƵƚƵƌĞĨƵŶĐƚŝŽŶĂůŝƚLJ ǁŝůůďĞƐĞƚĨŽƌƚŚŝŶŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚŽĐƵŵĞŶƚĂƚŝŽŶ͘ x͞ĞĨŝŶĞĚEĂŵĞĚhƐĞƌƐ͟ŵĞĂŶƐƚŚĞŶƵŵďĞƌŽĨŶĂŵĞĚƵƐĞƌƐƚŚĂƚĂƌĞĂƵƚŚŽƌŝnjĞĚƚŽƵƐĞƚŚĞ ŶĞƌ'ŽǀůĂďĞůĞĚŵŽĚƵůĞƐ͘dŚĞĞĨŝŶĞĚEĂŵĞĚhƐĞƌƐĨŽƌƚŚĞŐƌĞĞŵĞŶƚĂƌĞĂƐŝĚĞŶƚŝĨŝĞĚŝŶ ƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ x͞ĞǀĞůŽƉĞƌ͟ŵĞĂŶƐĂƚŚŝƌĚƉĂƌƚLJǁŚŽŽǁŶƐƚŚĞŝŶƚĞůůĞĐƚƵĂůƉƌŽƉĞƌƚLJƌŝŐŚƚƐƚŽdŚŝƌĚWĂƌƚLJ ^ŽĨƚǁĂƌĞ͘ x͞ŽĐƵŵĞŶƚĂƚŝŽŶ͟ŵĞĂŶƐĂŶLJŽŶůŝŶĞŽƌǁƌŝƚƚĞŶĚŽĐƵŵĞŶƚĂƚŝŽŶƌĞůĂƚĞĚƚŽƚŚĞƵƐĞŽƌ ĨƵŶĐƚŝŽŶĂůŝƚLJŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞƚŚĂƚǁĞƉƌŽǀŝĚĞŽƌŽƚŚĞƌǁŝƐĞŵĂŬĞĂǀĂŝůĂďůĞƚŽLJŽƵ͕ ŝŶĐůƵĚŝŶŐŝŶƐƚƌƵĐƚŝŽŶƐ͕ƵƐĞƌŐƵŝĚĞƐ͕ŵĂŶƵĂůƐĂŶĚŽƚŚĞƌƚƌĂŝŶŝŶŐŽƌƐĞůĨͲŚĞůƉĚŽĐƵŵĞŶƚĂƚŝŽŶ͘ x͞ĨĨĞĐƚŝǀĞĂƚĞ͟ŵĞĂŶƐƚŚĞĚĂƚĞďLJǁŚŝĐŚďŽƚŚLJŽƵƌĂŶĚŽƵƌĂƵƚŚŽƌŝnjĞĚƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐ ŚĂǀĞƐŝŐŶĞĚƚŚĞŐƌĞĞŵĞŶƚ͘ x͞&ŽƌĐĞDĂũĞƵƌĞ͟ŵĞĂŶƐĂŶĞǀĞŶƚďĞLJŽŶĚƚŚĞƌĞĂƐŽŶĂďůĞĐŽŶƚƌŽůŽĨLJŽƵŽƌƵƐ͕ŝŶĐůƵĚŝŶŐ͕ ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ŐŽǀĞƌŶŵĞŶƚĂůĂĐƚŝŽŶ͕ǁĂƌ͕ƌŝŽƚŽƌĐŝǀŝůĐŽŵŵŽƚŝŽŶ͕ĨŝƌĞ͕ŶĂƚƵƌĂůĚŝƐĂƐƚĞƌ͕ ϭ,/',>/',dWZKs/^/KE^/E/dWZKs/^/KE^d,dDzKZDzEKdWW>zdKd,WZd/h>Z >/EdͬKEdZd͘hZ/E'KEdZdE'Kd/d/KE^͕d,K^WZKs/^/KE^t/>>:h^d^ E^^Zz͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϳ ŽƌĂŶLJŽƚŚĞƌĐĂƵƐĞƚŚĂƚĐŽƵůĚŶŽƚǁŝƚŚƌĞĂƐŽŶĂďůĞĚŝůŝŐĞŶĐĞďĞĨŽƌĞƐĞĞŶŽƌƉƌĞǀĞŶƚĞĚďLJ LJŽƵŽƌƵƐ͘ x͞/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͟ŵĞĂŶƐƚŚĞĂŐƌĞĞĚƵƉŽŶĐŽƐƚƉƌŽƉŽƐĂůĨŽƌƚŚĞƐŽĨƚǁĂƌĞ͕ƉƌŽĚƵĐƚƐ͕ ĂŶĚƐĞƌǀŝĐĞƐĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͟ŵĞĂŶƐƚŚĞŝŶǀŽŝĐŝŶŐĂŶĚƉĂLJŵĞŶƚƉŽůŝĐLJ͘ĐŽƉLJŽĨŽƵƌ ĐƵƌƌĞŶƚ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJŝƐĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞DĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚ͟ŵĞĂŶƐƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐŐŽǀĞƌŶŝŶŐƚŚĞ ƉƌŽǀŝƐŝŽŶŽĨŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐƚŽĂůůŽĨŽƵƌĐƵƐƚŽŵĞƌƐ͘ĐŽƉLJŽĨŽƵƌ ĐƵƌƌĞŶƚDĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚŝƐĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞^ƚĂƚĞŵĞŶƚŽĨtŽƌŬ͟ŵĞĂŶƐƚŚĞŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚŝŵƉůĞŵĞŶƚĂƚŝŽŶƉůĂŶĚĞƐĐƌŝďŝŶŐŚŽǁŽƵƌ ƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐǁŝůůďĞƉƌŽǀŝĚĞĚƚŽŝŵƉůĞŵĞŶƚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂŶĚŽƵƚůŝŶŝŶŐLJŽƵƌ ĂŶĚŽƵƌƌŽůĞƐĂŶĚƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐŝŶĐŽŶŶĞĐƚŝŽŶǁŝƚŚƚŚĂƚŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dŚĞ^ƚĂƚĞŵĞŶƚ ŽĨtŽƌŬŝƐĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͟ŵĞĂŶƐƚŚĞƐƵƉƉŽƌƚĐĂůůƉƌŽĐĞƐƐĂƉƉůŝĐĂďůĞƚŽĂůůŽĨŽƵƌĐƵƐƚŽŵĞƌƐ ǁŚŽŚĂǀĞůŝĐĞŶƐĞĚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͘ĐŽƉLJŽĨŽƵƌĐƵƌƌĞŶƚ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐŝƐ ĂƚƚĂĐŚĞĚĂƐ^ĐŚĞĚƵůĞϭƚŽdžŚŝďŝƚ͘ x͞dŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͟ŵĞĂŶƐƚŚĞƚŚŝƌĚƉĂƌƚLJŚĂƌĚǁĂƌĞ͕ŝĨĂŶLJ͕ŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJ͘ x͞dŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͟ŵĞĂŶƐƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞĂŶĚdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͘ x͞dŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͟ŵĞĂŶƐƚŚĞƚŚŝƌĚƉĂƌƚLJƐĞƌǀŝĐĞƐ͕ŝĨĂŶLJ͕ŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJ͘ x͞dŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͟ŵĞĂŶƐƚŚĞƚŚŝƌĚƉĂƌƚLJƐŽĨƚǁĂƌĞ͕ŝĨĂŶLJ͕ŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJ͘ x͞dŚŝƌĚWĂƌƚLJdĞƌŵƐ͟ŵĞĂŶƐ͕ŝĨĂŶLJ͕ƚŚĞĞŶĚƵƐĞƌůŝĐĞŶƐĞĂŐƌĞĞŵĞŶƚ;ƐͿŽƌƐŝŵŝůĂƌƚĞƌŵƐĨŽƌ ƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͕ĂƐĂƉƉůŝĐĂďůĞĂŶĚĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞dLJůĞƌ͟ŵĞĂŶƐdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͕͘ĂĞůĂǁĂƌĞĐŽƌƉŽƌĂƚŝŽŶ͘ x͞dLJůĞƌ^ŽĨƚǁĂƌĞ͟ŵĞĂŶƐŽƵƌƉƌŽƉƌŝĞƚĂƌLJƐŽĨƚǁĂƌĞ͕ŝŶĐůƵĚŝŶŐĂŶLJŝŶƚĞŐƌĂƚŝŽŶƐ͕ĐƵƐƚŽŵ ŵŽĚŝĨŝĐĂƚŝŽŶƐ͕ĂŶĚͬŽƌŽƚŚĞƌƌĞůĂƚĞĚŝŶƚĞƌĨĂĐĞƐŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂŶĚ ůŝĐĞŶƐĞĚďLJƵƐƚŽLJŽƵƚŚƌŽƵŐŚƚŚŝƐŐƌĞĞŵĞŶƚ͘ x͞ǁĞ͕͟͞ƵƐ͕͟͞ŽƵƌ͟ĂŶĚƐŝŵŝůĂƌƚĞƌŵƐŵĞĂŶdLJůĞƌ͘ x͞LJŽƵ͟ĂŶĚƐŝŵŝůĂƌƚĞƌŵƐŵĞĂŶůŝĞŶƚ͘ ^d/KEʹ^K&dtZ>/E^ ϭ͘>ŝĐĞŶƐĞ'ƌĂŶƚĂŶĚZĞƐƚƌŝĐƚŝŽŶƐ͘ ϭ͘ϭtĞŐƌĂŶƚƚŽLJŽƵĂůŝĐĞŶƐĞƚŽƵƐĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĨŽƌLJŽƵƌŝŶƚĞƌŶĂůďƵƐŝŶĞƐƐƉƵƌƉŽƐĞƐŽŶůLJ͕ŝŶƚŚĞ ƐĐŽƉĞŽĨƚŚĞŝŶƚĞƌŶĂůďƵƐŝŶĞƐƐƉƵƌƉŽƐĞƐĚŝƐĐůŽƐĞĚƚŽƵƐĂƐŽĨƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘tŝƚŚƌĞƐƉĞĐƚƚŽƚŚĞ ͞ŶĞƌŐŽǀ͟ůĂďĞůĞĚŵŽĚƵůĞƐ͕ƐƵĐŚƵƐĞƐŚĂůůďĞůŝŵŝƚĞĚƚŽƚŚĞŶƵŵďĞƌŽĨĞĨŝŶĞĚEĂŵĞĚhƐĞƌƐ͕ĂƐ ĚĞĨŝŶĞĚŚĞƌĞŝŶ͘zŽƵŵĂLJŵĂŬĞĐŽƉŝĞƐŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĨŽƌďĂĐŬƵƉĂŶĚƚĞƐƚŝŶŐƉƵƌƉŽƐĞƐ͕ƐŽůŽŶŐ ĂƐƐƵĐŚĐŽƉŝĞƐĂƌĞŶŽƚƵƐĞĚŝŶƉƌŽĚƵĐƚŝŽŶĂŶĚƚŚĞƚĞƐƚŝŶŐŝƐĨŽƌŝŶƚĞƌŶĂůƵƐĞŽŶůLJ͘zŽƵƌƌŝŐŚƚƐƚŽƵƐĞ ƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂƌĞƉĞƌƉĞƚƵĂůďƵƚŵĂLJďĞƌĞǀŽŬĞĚŝĨLJŽƵĚŽŶŽƚĐŽŵƉůLJǁŝƚŚƚŚĞƚĞƌŵƐŽĨƚŚŝƐ ŐƌĞĞŵĞŶƚ͘dŽƚŚĞĞdžƚĞŶƚůŝĞŶƚƉƵƌĐŚĂƐĞƐDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ͕ĂĚĚŝƚŝŽŶĂůƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐ ƌĞůĂƚĞĚƚŽƚŚŽƐĞĂƉƉůŝĐĂƚŝŽŶƐĂƌĞƐĞƚĨŽƌƚŚŝŶdžŚŝďŝƚ͕^ĐŚĞĚƵůĞͺͺ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϴ ϭ͘ϮtŝƚŚŽƵƚůŝŵŝƚŝŶŐƚŚĞƚĞƌŵƐŽĨ^ĞĐƚŝŽŶϭ͘ϭ͕LJŽƵƵŶĚĞƌƐƚĂŶĚĂŶĚĂŐƌĞĞƚŚĂƚƚŚĞWŽƐƚĂůyƉƌĞƐƐ͕ dƌĂŶƐƉĂƌĞŶĐLJWŽƌƚĂůĂŶĚdLJůĞƌEŽƚŝĨLJŵŽĚƵůĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂƌĞůŝĐĞŶƐĞĚƚŽ LJŽƵŽŶĂƐƵďƐĐƌŝƉƚŝŽŶďĂƐŝƐ͘/ĨLJŽƵĚŽŶŽƚƉĂLJƚŚĞƌĞƋƵŝƌĞĚĂŶŶƵĂůĨĞĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞ /ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͕LJŽƵƌůŝĐĞŶƐĞƚŽƵƐĞƚŚĞĂƐƐŽĐŝĂƚĞĚŵŽĚƵůĞǁŝůůďĞƐƵƐƉĞŶĚĞĚƵŶůĞƐƐ ĂŶĚƵŶƚŝůƉĂLJŵĞŶƚŝŶĨƵůůŚĂƐďĞĞŶŵĂĚĞ͘ ϭ͘ϯdŚĞŽĐƵŵĞŶƚĂƚŝŽŶŝƐůŝĐĞŶƐĞĚƚŽLJŽƵĂŶĚŵĂLJďĞƵƐĞĚĂŶĚĐŽƉŝĞĚďLJLJŽƵƌĞŵƉůŽLJĞĞƐĨŽƌŝŶƚĞƌŶĂů͕ ŶŽŶͲĐŽŵŵĞƌĐŝĂůƌĞĨĞƌĞŶĐĞƉƵƌƉŽƐĞƐŽŶůLJ͘ ϭ͘ϰzŽƵŵĂLJŶŽƚ͗;ĂͿƚƌĂŶƐĨĞƌŽƌĂƐƐŝŐŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞƚŽĂƚŚŝƌĚƉĂƌƚLJ͖;ďͿƌĞǀĞƌƐĞĞŶŐŝŶĞĞƌ͕ ĚĞĐŽŵƉŝůĞ͕ŽƌĚŝƐĂƐƐĞŵďůĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͖;ĐͿƌĞŶƚ͕ůĞĂƐĞ͕ůĞŶĚ͕ŽƌƉƌŽǀŝĚĞĐŽŵŵĞƌĐŝĂůŚŽƐƚŝŶŐ ƐĞƌǀŝĐĞƐǁŝƚŚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͖Žƌ;ĚͿƉƵďůŝƐŚŽƌŽƚŚĞƌǁŝƐĞĚŝƐĐůŽƐĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŽƌ ŽĐƵŵĞŶƚĂƚŝŽŶƚŽƚŚŝƌĚƉĂƌƚŝĞƐ͘ ϭ͘ϱdŚĞůŝĐĞŶƐĞƚĞƌŵƐŝŶƚŚŝƐŐƌĞĞŵĞŶƚĂƉƉůLJƚŽƵƉĚĂƚĞƐĂŶĚĞŶŚĂŶĐĞŵĞŶƚƐǁĞŵĂLJƉƌŽǀŝĚĞƚŽLJŽƵŽƌ ŵĂŬĞĂǀĂŝůĂďůĞƚŽLJŽƵƚŚƌŽƵŐŚLJŽƵƌDĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚ͘ ϭ͘ϲdŚĞƌŝŐŚƚƚŽƚƌĂŶƐĨĞƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞƚŽĂƌĞƉůĂĐĞŵĞŶƚŚĂƌĚǁĂƌĞƐLJƐƚĞŵŝƐŝŶĐůƵĚĞĚŝŶLJŽƵƌ ůŝĐĞŶƐĞ͘zŽƵǁŝůůŐŝǀĞƵƐĂĚǀĂŶĐĞǁƌŝƚƚĞŶŶŽƚŝĐĞŽĨĂŶLJƐƵĐŚƚƌĂŶƐĨĞƌĂŶĚǁŝůůƉĂLJƵƐĨŽƌĂŶLJƌĞƋƵŝƌĞĚ ŽƌƌĞƋƵĞƐƚĞĚƚĞĐŚŶŝĐĂůĂƐƐŝƐƚĂŶĐĞĨƌŽŵƵƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚƐƵĐŚƚƌĂŶƐĨĞƌ͘ ϭ͘ϳtŚĞƌĞĂƉƉůŝĐĂďůĞǁŝƚŚƌĞƐƉĞĐƚƚŽŽƵƌĂƉƉůŝĐĂƚŝŽŶƐƚŚĂƚƚĂŬĞŽƌƉƌŽĐĞƐƐĐĂƌĚƉĂLJŵĞŶƚĚĂƚĂ͕ǁĞĂƌĞ ƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞƐĞĐƵƌŝƚLJŽĨĐĂƌĚŚŽůĚĞƌĚĂƚĂƚŚĂƚǁĞƉŽƐƐĞƐƐ͕ŝŶĐůƵĚŝŶŐĨƵŶĐƚŝŽŶƐƌĞůĂƚŝŶŐƚŽ ƐƚŽƌŝŶŐ͕ƉƌŽĐĞƐƐŝŶŐ͕ĂŶĚƚƌĂŶƐŵŝƚƚŝŶŐŽĨƚŚĞĐĂƌĚŚŽůĚĞƌĚĂƚĂĂŶĚĂĨĨŝƌŵƚŚĂƚ͕ĂƐŽĨƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͕ ǁĞĐŽŵƉůLJǁŝƚŚĂƉƉůŝĐĂďůĞƌĞƋƵŝƌĞŵĞŶƚƐƚŽďĞĐŽŶƐŝĚĞƌĞĚW/^^ĐŽŵƉůŝĂŶƚĂŶĚŚĂǀĞƉĞƌĨŽƌŵĞĚ ƚŚĞŶĞĐĞƐƐĂƌLJƐƚĞƉƐƚŽǀĂůŝĚĂƚĞĐŽŵƉůŝĂŶĐĞǁŝƚŚƚŚĞW/^^͘tĞĂŐƌĞĞƚŽƐƵƉƉůLJƚŚĞĐƵƌƌĞŶƚƐƚĂƚƵƐ ŽĨŽƵƌW/^^ĐŽŵƉůŝĂŶĐĞƉƌŽŐƌĂŵŝŶƚŚĞĨŽƌŵŽĨĂŶŽĨĨŝĐŝĂůƚƚĞƐƚĂƚŝŽŶŽĨŽŵƉůŝĂŶĐĞ͕ǁŚŝĐŚĐĂŶ ďĞĨŽƵŶĚĂƚŚƚƚƉƐ͗ͬͬǁǁǁ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵͬĂďŽƵƚͲƵƐͬĐŽŵƉůŝĂŶĐĞ͕ĂŶĚŝŶƚŚĞĞǀĞŶƚŽĨĂŶLJĐŚĂŶŐĞŝŶŽƵƌ ƐƚĂƚƵƐ͕ǁŝůůĐŽŵƉůLJǁŝƚŚĂƉƉůŝĐĂďůĞŶŽƚŝĐĞƌĞƋƵŝƌĞŵĞŶƚƐ͘ ϭ͘ϴtĞƌĞƐĞƌǀĞĂůůƌŝŐŚƚƐŶŽƚĞdžƉƌĞƐƐůLJŐƌĂŶƚĞĚƚŽLJŽƵŝŶƚŚŝƐŐƌĞĞŵĞŶƚ͘dŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚ ŽĐƵŵĞŶƚĂƚŝŽŶĂƌĞƉƌŽƚĞĐƚĞĚďLJĐŽƉLJƌŝŐŚƚĂŶĚŽƚŚĞƌŝŶƚĞůůĞĐƚƵĂůƉƌŽƉĞƌƚLJůĂǁƐĂŶĚƚƌĞĂƚŝĞƐ͘tĞ ŽǁŶƚŚĞƚŝƚůĞ͕ĐŽƉLJƌŝŐŚƚ͕ĂŶĚŽƚŚĞƌŝŶƚĞůůĞĐƚƵĂůƉƌŽƉĞƌƚLJƌŝŐŚƚƐŝŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚƚŚĞ ŽĐƵŵĞŶƚĂƚŝŽŶ͘dŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐůŝĐĞŶƐĞĚ͕ŶŽƚƐŽůĚ͘ Ϯ͘>ŝĐĞŶƐĞ&ĞĞƐ͘zŽƵĂŐƌĞĞƚŽƉĂLJƵƐƚŚĞůŝĐĞŶƐĞĨĞĞƐŝŶƚŚĞĂŵŽƵŶƚƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJ͘dŚŽƐĞĂŵŽƵŶƚƐĂƌĞƉĂLJĂďůĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͘ ϯ͘ƐĐƌŽǁ͘tĞŵĂŝŶƚĂŝŶĂŶĞƐĐƌŽǁĂŐƌĞĞŵĞŶƚǁŝƚŚĂƚŚŝƌĚƉĂƌƚLJƵŶĚĞƌǁŚŝĐŚǁĞƉůĂĐĞƚŚĞƐŽƵƌĐĞ ĐŽĚĞĨŽƌĞĂĐŚŵĂũŽƌƌĞůĞĂƐĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͘zŽƵŵĂLJďĞĂĚĚĞĚĂƐĂďĞŶĞĨŝĐŝĂƌLJƚŽƚŚĞĞƐĐƌŽǁ ĂŐƌĞĞŵĞŶƚďLJĐŽŵƉůĞƚŝŶŐĂƐƚĂŶĚĂƌĚďĞŶĞĨŝĐŝĂƌLJĞŶƌŽůůŵĞŶƚĨŽƌŵĂŶĚƉĂLJŝŶŐƚŚĞĂƉƉůŝĐĂďůĞĂŶŶƵĂů ďĞŶĞĨŝĐŝĂƌLJĨĞĞ͘zŽƵǁŝůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌŵĂŝŶƚĂŝŶŝŶŐLJŽƵƌŽŶŐŽŝŶŐƐƚĂƚƵƐĂƐĂďĞŶĞĨŝĐŝĂƌLJ͕ ŝŶĐůƵĚŝŶŐƉĂLJŵĞŶƚŽĨƚŚĞƚŚĞŶͲĐƵƌƌĞŶƚĂŶŶƵĂůďĞŶĞĨŝĐŝĂƌLJĨĞĞƐ͘ZĞůĞĂƐĞŽĨƐŽƵƌĐĞĐŽĚĞĨŽƌƚŚĞdLJůĞƌ ^ŽĨƚǁĂƌĞŝƐƐƚƌŝĐƚůLJŐŽǀĞƌŶĞĚďLJƚŚĞƚĞƌŵƐŽĨƚŚĞĞƐĐƌŽǁĂŐƌĞĞŵĞŶƚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϮϵ ϰ͘>ŝŵŝƚĞĚtĂƌƌĂŶƚLJ͘tĞǁĂƌƌĂŶƚƚŚĂƚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞǁŝůůďĞǁŝƚŚŽƵƚĞĨĞĐƚ;ƐͿĂƐůŽŶŐĂƐLJŽƵŚĂǀĞ ĂDĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚŝŶĞĨĨĞĐƚ͘/ĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĚŽĞƐŶŽƚƉĞƌĨŽƌŵĂƐ ǁĂƌƌĂŶƚĞĚ͕ǁĞǁŝůůƵƐĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐ͕ĐŽŶƐŝƐƚĞŶƚǁŝƚŚŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚƐ͕ƚŽĐƵƌĞƚŚĞĞĨĞĐƚ ĂƐƐĞƚĨŽƌƚŚŝŶƚŚĞDĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚ͘ ^d/KEʹWZK&^^/KE>^Zs/^ ϭ͘^ĞƌǀŝĐĞƐ͘tĞǁŝůůƉƌŽǀŝĚĞLJŽƵƚŚĞǀĂƌŝŽƵƐŝŵƉůĞŵĞŶƚĂƚŝŽŶͲƌĞůĂƚĞĚƐĞƌǀŝĐĞƐŝƚĞŵŝnjĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJĂŶĚĚĞƐĐƌŝďĞĚŝŶƚŚĞ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬͬŽƵƌŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚŝŵƉůĞŵĞŶƚĂƚŝŽŶƉůĂŶ͘tĞǁŝůů ĨŝŶĂůŝnjĞƚŚĂƚĚŽĐƵŵĞŶƚĂƚŝŽŶǁŝƚŚLJŽƵƵƉŽŶĞdžĞĐƵƚŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘ Ϯ͘WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ&ĞĞƐ͘zŽƵĂŐƌĞĞƚŽƉĂLJƵƐƚŚĞƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐĨĞĞƐŝŶƚŚĞĂŵŽƵŶƚƐƐĞƚĨŽƌƚŚŝŶ ƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘dŚŽƐĞĂŵŽƵŶƚƐĂƌĞƉĂLJĂďůĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚ WŽůŝĐLJ͘zŽƵĂĐŬŶŽǁůĞĚŐĞƚŚĂƚƚŚĞĨĞĞƐƐƚĂƚĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂƌĞŐŽŽĚͲĨĂŝƚŚĞƐƚŝŵĂƚĞƐŽĨ ƚŚĞĂŵŽƵŶƚŽĨƚŝŵĞĂŶĚŵĂƚĞƌŝĂůƐƌĞƋƵŝƌĞĚĨŽƌLJŽƵƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘tĞǁŝůůďŝůůLJŽƵƚŚĞĂĐƚƵĂůĨĞĞƐ ŝŶĐƵƌƌĞĚďĂƐĞĚŽŶƚŚĞŝŶͲƐĐŽƉĞƐĞƌǀŝĐĞƐƉƌŽǀŝĚĞĚƚŽLJŽƵ͘ŶLJĚŝƐĐƌĞƉĂŶĐŝĞƐŝŶƚŚĞƚŽƚĂůǀĂůƵĞƐƐĞƚĨŽƌƚŚ ŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJǁŝůůďĞƌĞƐŽůǀĞĚďLJŵƵůƚŝƉůLJŝŶŐƚŚĞĂƉƉůŝĐĂďůĞŚŽƵƌůLJƌĂƚĞďLJƚŚĞƋƵŽƚĞĚ ŚŽƵƌƐ͘ ϯ͘ĚĚŝƚŝŽŶĂů^ĞƌǀŝĐĞƐ͘dŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĐŽŶƚĂŝŶƐ͕ĂŶĚƚŚĞ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬĚĞƐĐƌŝďĞƐ͕ƚŚĞ ƐĐŽƉĞŽĨƐĞƌǀŝĐĞƐĂŶĚƌĞůĂƚĞĚĐŽƐƚƐ;ŝŶĐůƵĚŝŶŐƉƌŽŐƌĂŵŵŝŶŐĂŶĚͬŽƌŝŶƚĞƌĨĂĐĞĞƐƚŝŵĂƚĞƐͿƌĞƋƵŝƌĞĚĨŽƌƚŚĞ ƉƌŽũĞĐƚďĂƐĞĚŽŶŽƵƌƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐLJŽƵƐƵƉƉůŝĞĚ͘/ĨĂĚĚŝƚŝŽŶĂůǁŽƌŬŝƐƌĞƋƵŝƌĞĚ͕Žƌ ŝĨLJŽƵƵƐĞŽƌƌĞƋƵĞƐƚĂĚĚŝƚŝŽŶĂůƐĞƌǀŝĐĞƐ͕ǁĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚĂŶĂĚĚĞŶĚƵŵŽƌĐŚĂŶŐĞŽƌĚĞƌ͕ĂƐ ĂƉƉůŝĐĂďůĞ͕ŽƵƚůŝŶŝŶŐƚŚĞĐŽƐƚƐĨŽƌƚŚĞĂĚĚŝƚŝŽŶĂůǁŽƌŬ͘dŚĞƉƌŝĐĞƋƵŽƚĞƐŝŶƚŚĞĂĚĚĞŶĚƵŵŽƌĐŚĂŶŐĞ ŽƌĚĞƌǁŝůůďĞǀĂůŝĚĨŽƌƚŚŝƌƚLJ;ϯϬͿĚĂLJƐĨƌŽŵƚŚĞĚĂƚĞŽĨƚŚĞƋƵŽƚĞ͘ ϰ͘ĂŶĐĞůůĂƚŝŽŶ͘tĞŵĂŬĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƐĐŚĞĚƵůĞŽƵƌƉĞƌƐŽŶŶĞůĨŽƌƚƌĂǀĞů͕ŝŶĐůƵĚŝŶŐĂƌƌĂŶŐŝŶŐ ƚƌĂǀĞůƌĞƐĞƌǀĂƚŝŽŶƐ͕ĂƚůĞĂƐƚƚǁŽ;ϮͿǁĞĞŬƐŝŶĂĚǀĂŶĐĞŽĨĐŽŵŵŝƚŵĞŶƚƐ͘dŚĞƌĞĨŽƌĞ͕ŝĨLJŽƵĐĂŶĐĞůƐĞƌǀŝĐĞƐ ůĞƐƐƚŚĂŶƚǁŽ;ϮͿǁĞĞŬƐŝŶĂĚǀĂŶĐĞ;ŽƚŚĞƌƚŚĂŶĨŽƌ&ŽƌĐĞDĂũĞƵƌĞŽƌďƌĞĂĐŚďLJƵƐͿ͕LJŽƵǁŝůůďĞůŝĂďůĞĨŽƌ Ăůů;ĂͿŶŽŶͲƌĞĨƵŶĚĂďůĞĞdžƉĞŶƐĞƐŝŶĐƵƌƌĞĚďLJƵƐŽŶLJŽƵƌďĞŚĂůĨ͕ĂŶĚ;ďͿĚĂŝůLJĨĞĞƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚ ĐĂŶĐĞůůĞĚƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐŝĨǁĞĂƌĞƵŶĂďůĞƚŽƌĞĂƐƐŝŐŶŽƵƌƉĞƌƐŽŶŶĞů͘tĞǁŝůůŵĂŬĞĂůůƌĞĂƐŽŶĂďůĞ ĞĨĨŽƌƚƐƚŽƌĞĂƐƐŝŐŶƉĞƌƐŽŶŶĞůŝŶƚŚĞĞǀĞŶƚLJŽƵĐĂŶĐĞůǁŝƚŚŝŶƚǁŽ;ϮͿǁĞĞŬƐŽĨƐĐŚĞĚƵůĞĚĐŽŵŵŝƚŵĞŶƚƐ͘ ϱ͘^ĞƌǀŝĐĞƐtĂƌƌĂŶƚLJ͘tĞǁŝůůƉĞƌĨŽƌŵƚŚĞƐĞƌǀŝĐĞƐŝŶĂƉƌŽĨĞƐƐŝŽŶĂů͕ǁŽƌŬŵĂŶůŝŬĞŵĂŶŶĞƌ͕ĐŽŶƐŝƐƚĞŶƚǁŝƚŚ ŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚƐ͘/ŶƚŚĞĞǀĞŶƚǁĞƉƌŽǀŝĚĞƐĞƌǀŝĐĞƐƚŚĂƚĚŽŶŽƚĐŽŶĨŽƌŵƚŽƚŚŝƐǁĂƌƌĂŶƚLJ͕ǁĞǁŝůůƌĞͲ ƉĞƌĨŽƌŵƐƵĐŚƐĞƌǀŝĐĞƐĂƚŶŽĂĚĚŝƚŝŽŶĂůĐŽƐƚƚŽLJŽƵ͘ ϲ͘^ŝƚĞĐĐĞƐƐĂŶĚZĞƋƵŝƌĞŵĞŶƚƐ͘ƚŶŽĐŽƐƚƚŽƵƐ͕LJŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĨƵůůĂŶĚĨƌĞĞĂĐĐĞƐƐƚŽLJŽƵƌ ƉĞƌƐŽŶŶĞů͕ĨĂĐŝůŝƚŝĞƐ͕ĂŶĚĞƋƵŝƉŵĞŶƚĂƐŵĂLJďĞƌĞĂƐŽŶĂďůLJŶĞĐĞƐƐĂƌLJĨŽƌƵƐƚŽƉƌŽǀŝĚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶ ƐĞƌǀŝĐĞƐ͕ƐƵďũĞĐƚƚŽĂŶLJƌĞĂƐŽŶĂďůĞƐĞĐƵƌŝƚLJƉƌŽƚŽĐŽůƐŽƌŽƚŚĞƌǁƌŝƚƚĞŶƉŽůŝĐŝĞƐƉƌŽǀŝĚĞĚƚŽƵƐĂƐŽĨƚŚĞ ĨĨĞĐƚŝǀĞĂƚĞ͕ĂŶĚƚŚĞƌĞĂĨƚĞƌĂƐŵƵƚƵĂůůLJĂŐƌĞĞĚƚŽďLJLJŽƵĂŶĚƵƐ͘zŽƵĨƵƌƚŚĞƌĂŐƌĞĞƚŽƉƌŽǀŝĚĞĂ ƌĞĂƐŽŶĂďůLJƐƵŝƚĂďůĞĞŶǀŝƌŽŶŵĞŶƚ͕ůŽĐĂƚŝŽŶ͕ĂŶĚƐƉĂĐĞĨŽƌƚŚĞŝŶƐƚĂůůĂƚŝŽŶŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚĂŶLJ dŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͕ŝŶĐůƵĚŝŶŐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ƐƵĨĨŝĐŝĞŶƚĞůĞĐƚƌŝĐĂůĐŝƌĐƵŝƚƐ͕ĐĂďůĞƐ͕ĂŶĚŽƚŚĞƌ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϬ ƌĞĂƐŽŶĂďůLJŶĞĐĞƐƐĂƌLJŝƚĞŵƐƌĞƋƵŝƌĞĚĨŽƌƚŚĞŝŶƐƚĂůůĂƚŝŽŶĂŶĚŽƉĞƌĂƚŝŽŶŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚĂŶLJ dŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘ ϳ͘ůŝĞŶƚƐƐŝƐƚĂŶĐĞ͘zŽƵĂĐŬŶŽǁůĞĚŐĞƚŚĂƚƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐĂĐŽŽƉĞƌĂƚŝǀĞ ƉƌŽĐĞƐƐƌĞƋƵŝƌŝŶŐƚŚĞƚŝŵĞĂŶĚƌĞƐŽƵƌĐĞƐŽĨLJŽƵƌƉĞƌƐŽŶŶĞů͘zŽƵĂŐƌĞĞƚŽƵƐĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽ ĐŽŽƉĞƌĂƚĞǁŝƚŚĂŶĚĂƐƐŝƐƚƵƐĂƐŵĂLJďĞƌĞĂƐŽŶĂďůLJƌĞƋƵŝƌĞĚƚŽŵĞĞƚƚŚĞĂŐƌĞĞĚƵƉŽŶƉƌŽũĞĐƚĚĞĂĚůŝŶĞƐ ĂŶĚŽƚŚĞƌŵŝůĞƐƚŽŶĞƐĨŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dŚŝƐĐŽŽƉĞƌĂƚŝŽŶŝŶĐůƵĚĞƐĂƚůĞĂƐƚǁŽƌŬŝŶŐǁŝƚŚƵƐƚŽ ƐĐŚĞĚƵůĞƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶͲƌĞůĂƚĞĚƐĞƌǀŝĐĞƐŽƵƚůŝŶĞĚŝŶƚŚŝƐŐƌĞĞŵĞŶƚ͘tĞǁŝůůŶŽƚďĞůŝĂďůĞĨŽƌ ĨĂŝůƵƌĞƚŽŵĞĞƚĂŶLJĚĞĂĚůŝŶĞƐĂŶĚŵŝůĞƐƚŽŶĞƐǁŚĞŶƐƵĐŚĨĂŝůƵƌĞŝƐĚƵĞƚŽ&ŽƌĐĞDĂũĞƵƌĞŽƌƚŽƚŚĞĨĂŝůƵƌĞ ďLJLJŽƵƌƉĞƌƐŽŶŶĞůƚŽƉƌŽǀŝĚĞƐƵĐŚĐŽŽƉĞƌĂƚŝŽŶĂŶĚĂƐƐŝƐƚĂŶĐĞ;ĞŝƚŚĞƌƚŚƌŽƵŐŚĂĐƚŝŽŶŽƌŽŵŝƐƐŝŽŶͿ͘ ϴ͘ĂĐŬŐƌŽƵŶĚŚĞĐŬƐ͘&ŽƌĂƚůĞĂƐƚƚŚĞƉĂƐƚƚǁĞůǀĞ;ϭϮͿLJĞĂƌƐ͕ĂůůŽĨŽƵƌĞŵƉůŽLJĞĞƐŚĂǀĞƵŶĚĞƌŐŽŶĞ ĐƌŝŵŝŶĂůďĂĐŬŐƌŽƵŶĚĐŚĞĐŬƐƉƌŝŽƌƚŽŚŝƌĞ͘ůůĞŵƉůŽLJĞĞƐƐŝŐŶŽƵƌĐŽŶĨŝĚĞŶƚŝĂůŝƚLJĂŐƌĞĞŵĞŶƚĂŶĚƐĞĐƵƌŝƚLJ ƉŽůŝĐŝĞƐ͘ ^d/KEʹD/EdEEE^hWWKZd dŚŝƐŐƌĞĞŵĞŶƚŝŶĐůƵĚĞƐƚŚĞƉĞƌŝŽĚŽĨĨƌĞĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀŽŝĐŝŶŐ ĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͘/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚŽŶŐŽŝŶŐŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ĂŶĚĐŽŶƚŝŶƵĞƚŽ ŵĂŬĞƚŝŵĞůLJƉĂLJŵĞŶƚƐĨŽƌƚŚĞŵĂĐĐŽƌĚŝŶŐƚŽŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͕ǁĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚ ŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐĨŽƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞƵŶĚĞƌƚŚĞƚĞƌŵƐŽĨŽƵƌƐƚĂŶĚĂƌĚDĂŝŶƚĞŶĂŶĐĞ ĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚ͘ /ĨLJŽƵŚĂǀĞŽƉƚĞĚŶŽƚƚŽƉƵƌĐŚĂƐĞŽŶŐŽŝŶŐŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐĨŽƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ƚŚĞ DĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚĚŽĞƐŶŽƚĂƉƉůLJƚŽLJŽƵ͘/ŶƐƚĞĂĚ͕LJŽƵǁŝůůŽŶůLJƌĞĐĞŝǀĞŽŶŐŽŝŶŐ ŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚŽŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŽŶĂƚŝŵĞĂŶĚŵĂƚĞƌŝĂůƐďĂƐŝƐ͘/ŶĂĚĚŝƚŝŽŶ͕LJŽƵǁŝůů͗ ;ŝͿƌĞĐĞŝǀĞƚŚĞůŽǁĞƐƚƉƌŝŽƌŝƚLJƵŶĚĞƌŽƵƌ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͖ ;ŝŝͿďĞƌĞƋƵŝƌĞĚƚŽƉƵƌĐŚĂƐĞŶĞǁƌĞůĞĂƐĞƐŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ŝŶĐůƵĚŝŶŐĨŝdžĞƐ͕ĞŶŚĂŶĐĞŵĞŶƚƐ ĂŶĚƉĂƚĐŚĞƐ͖ ;ŝŝŝͿďĞĐŚĂƌŐĞĚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚƌĂƚĞƐĨŽƌƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ŽƌƐƵĐŚŽƚŚĞƌƌĂƚĞƐƚŚĂƚǁĞŵĂLJ ĐŽŶƐŝĚĞƌŶĞĐĞƐƐĂƌLJƚŽĂĐĐŽƵŶƚĨŽƌLJŽƵƌůĂĐŬŽĨŽŶŐŽŝŶŐƚƌĂŝŶŝŶŐŽŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͖ ;ŝǀͿďĞĐŚĂƌŐĞĚĨŽƌĂŵŝŶŝŵƵŵŽĨƚǁŽ;ϮͿŚŽƵƌƐŽĨƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐĨŽƌĞǀĞƌLJƐƵƉƉŽƌƚĐĂůů͖ĂŶĚ ;ǀͿŶŽƚďĞŐƌĂŶƚĞĚĂĐĐĞƐƐƚŽƚŚĞƐƵƉƉŽƌƚǁĞďƐŝƚĞĨŽƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŽƌƚŚĞdLJůĞƌŽŵŵƵŶŝƚLJ &ŽƌƵŵ͘ ^d/KEʹd,/ZWZdzWZKhd^ dŽƚŚĞĞdžƚĞŶƚƚŚĞƌĞĂƌĞĂŶLJdŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͕ƚŚĞĨŽůůŽǁŝŶŐƚĞƌŵƐ ĂŶĚĐŽŶĚŝƚŝŽŶƐǁŝůůĂƉƉůLJ͗ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϭ ϭ͘dŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͘tĞǁŝůůƐĞůů͕ĚĞůŝǀĞƌ͕ĂŶĚŝŶƐƚĂůůŽŶƐŝƚĞƚŚĞdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͕ŝĨLJŽƵŚĂǀĞ ƉƵƌĐŚĂƐĞĚĂŶLJ͕ĨŽƌƚŚĞƉƌŝĐĞƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘dŚŽƐĞĂŵŽƵŶƚƐĂƌĞƉĂLJĂďůĞŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͘ Ϯ͘dŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͘hƉŽŶƉĂLJŵĞŶƚŝŶĨƵůůŽĨƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞůŝĐĞŶƐĞĨĞĞƐ͕LJŽƵǁŝůůƌĞĐĞŝǀĞĂ ŶŽŶͲƚƌĂŶƐĨĞƌĂďůĞůŝĐĞŶƐĞƚŽƵƐĞƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞĂŶĚƌĞůĂƚĞĚĚŽĐƵŵĞŶƚĂƚŝŽŶĨŽƌLJŽƵƌŝŶƚĞƌŶĂů ďƵƐŝŶĞƐƐƉƵƌƉŽƐĞƐŽŶůLJ͘zŽƵƌůŝĐĞŶƐĞƌŝŐŚƚƐƚŽƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞǁŝůůďĞŐŽǀĞƌŶĞĚďLJƚŚĞdŚŝƌĚ WĂƌƚLJdĞƌŵƐ͘ Ϯ͘ϭtĞǁŝůůŝŶƐƚĂůůŽŶƐŝƚĞƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͘dŚĞŝŶƐƚĂůůĂƚŝŽŶĐŽƐƚŝƐŝŶĐůƵĚĞĚŝŶƚŚĞŝŶƐƚĂůůĂƚŝŽŶĨĞĞ ŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ Ϯ͘Ϯ/ĨƚŚĞĞǀĞůŽƉĞƌĐŚĂƌŐĞƐĂĨĞĞĨŽƌĨƵƚƵƌĞƵƉĚĂƚĞƐ͕ƌĞůĞĂƐĞƐ͕ŽƌŽƚŚĞƌĞŶŚĂŶĐĞŵĞŶƚƐƚŽƚŚĞdŚŝƌĚ WĂƌƚLJ^ŽĨƚǁĂƌĞ͕LJŽƵǁŝůůďĞƌĞƋƵŝƌĞĚƚŽƉĂLJƐƵĐŚĂĚĚŝƚŝŽŶĂůĨƵƚƵƌĞĨĞĞ͘ Ϯ͘ϯdŚĞƌŝŐŚƚƚŽƚƌĂŶƐĨĞƌƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞƚŽĂƌĞƉůĂĐĞŵĞŶƚŚĂƌĚǁĂƌĞƐLJƐƚĞŵŝƐŐŽǀĞƌŶĞĚďLJƚŚĞ ĞǀĞůŽƉĞƌ͘zŽƵǁŝůůŐŝǀĞƵƐĂĚǀĂŶĐĞǁƌŝƚƚĞŶŶŽƚŝĐĞŽĨĂŶLJƐƵĐŚƚƌĂŶƐĨĞƌĂŶĚǁŝůůƉĂLJƵƐĨŽƌĂŶLJ ƌĞƋƵŝƌĞĚŽƌƌĞƋƵĞƐƚĞĚƚĞĐŚŶŝĐĂůĂƐƐŝƐƚĂŶĐĞĨƌŽŵƵƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚƐƵĐŚƚƌĂŶƐĨĞƌ͘ ϯ͘dŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐtĂƌƌĂŶƚŝĞƐ͘ ϯ͘ϭtĞĂƌĞĂƵƚŚŽƌŝnjĞĚďLJĞĂĐŚĞǀĞůŽƉĞƌƚŽŐƌĂŶƚŽƌƚƌĂŶƐĨĞƌƚŚĞůŝĐĞŶƐĞƐƚŽƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͘ ϯ͘ϮdŚĞdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞǁŝůůďĞŶĞǁĂŶĚƵŶƵƐĞĚ͕ĂŶĚƵƉŽŶƉĂLJŵĞŶƚŝŶĨƵůů͕LJŽƵǁŝůůƌĞĐĞŝǀĞĨƌĞĞ ĂŶĚĐůĞĂƌƚŝƚůĞƚŽƚŚĞdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͘ ϯ͘ϯzŽƵĂĐŬŶŽǁůĞĚŐĞƚŚĂƚǁĞĂƌĞŶŽƚƚŚĞŵĂŶƵĨĂĐƚƵƌĞƌŽĨƚŚĞdŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘tĞĚŽŶŽƚǁĂƌƌĂŶƚ ŽƌŐƵĂƌĂŶƚĞĞƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞdŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘,ŽǁĞǀĞƌ͕ǁĞŐƌĂŶƚĂŶĚƉĂƐƐƚŚƌŽƵŐŚƚŽ LJŽƵĂŶLJǁĂƌƌĂŶƚLJƚŚĂƚǁĞŵĂLJƌĞĐĞŝǀĞĨƌŽŵƚŚĞĞǀĞůŽƉĞƌŽƌƐƵƉƉůŝĞƌŽĨƚŚĞdŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘ ϰ͘dŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͘/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚdŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͕ƚŚŽƐĞƐĞƌǀŝĐĞƐǁŝůůďĞƉƌŽǀŝĚĞĚ ŝŶĚĞƉĞŶĚĞŶƚŽĨdLJůĞƌďLJƐƵĐŚƚŚŝƌĚͲƉĂƌƚLJĂƚƚŚĞƌĂƚĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂŶĚŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͘ ϱ͘DĂŝŶƚĞŶĂŶĐĞ͘/ĨLJŽƵŚĂǀĞĂDĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚŝŶĞĨĨĞĐƚ͕LJŽƵŵĂLJƌĞƉŽƌƚĚĞĨĞĐƚƐĂŶĚ ŽƚŚĞƌŝƐƐƵĞƐƌĞůĂƚĞĚƚŽƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞĚŝƌĞĐƚůLJƚŽƵƐ͕ĂŶĚǁĞǁŝůů;ĂͿĚŝƌĞĐƚůLJĂĚĚƌĞƐƐƚŚĞĚĞĨĞĐƚ ŽƌŝƐƐƵĞ͕ƚŽƚŚĞĞdžƚĞŶƚŝƚƌĞůĂƚĞƐƚŽŽƵƌŝŶƚĞƌĨĂĐĞǁŝƚŚƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͖ĂŶĚͬŽƌ;ďͿĨĂĐŝůŝƚĂƚĞ ƌĞƐŽůƵƚŝŽŶǁŝƚŚƚŚĞĞǀĞůŽƉĞƌ͕ƵŶůĞƐƐƚŚĂƚĞǀĞůŽƉĞƌƌĞƋƵŝƌĞƐƚŚĂƚLJŽƵŚĂǀĞĂƐĞƉĂƌĂƚĞ͕ĚŝƌĞĐƚ ŵĂŝŶƚĞŶĂŶĐĞĂŐƌĞĞŵĞŶƚŝŶĞĨĨĞĐƚǁŝƚŚƚŚĂƚĞǀĞůŽƉĞƌ͘/ŶĂůůĞǀĞŶƚƐ͕ŝĨLJŽƵĚŽŶŽƚŚĂǀĞĂDĂŝŶƚĞŶĂŶĐĞ ĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚŝŶĞĨĨĞĐƚǁŝƚŚƵƐ͕LJŽƵǁŝůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌƌĞƐŽůǀŝŶŐĚĞĨĞĐƚƐĂŶĚŽƚŚĞƌŝƐƐƵĞƐ ƌĞůĂƚĞĚƚŽƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞĚŝƌĞĐƚůLJǁŝƚŚƚŚĞĞǀĞůŽƉĞƌ͘ ^d/KE&ʹ/EsK//E'EWzDEd͖/EsK//^Whd^ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϮ ϭ͘/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚ͘tĞǁŝůůŝŶǀŽŝĐĞLJŽƵĨŽƌĂůůĨĞĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJƉĞƌŽƵƌ /ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͕ƐƵďũĞĐƚƚŽ^ĞĐƚŝŽŶ&;ϮͿ͘ Ϯ͘/ŶǀŽŝĐĞŝƐƉƵƚĞƐ͘/ĨLJŽƵďĞůŝĞǀĞĂŶLJĚĞůŝǀĞƌĞĚƐŽĨƚǁĂƌĞŽƌƐĞƌǀŝĐĞĚŽĞƐŶŽƚĐŽŶĨŽƌŵƚŽƚŚĞǁĂƌƌĂŶƚŝĞƐŝŶ ƚŚŝƐŐƌĞĞŵĞŶƚ͕LJŽƵǁŝůůƉƌŽǀŝĚĞƵƐǁŝƚŚǁƌŝƚƚĞŶŶŽƚŝĐĞǁŝƚŚŝŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨLJŽƵƌƌĞĐĞŝƉƚŽĨƚŚĞ ĂƉƉůŝĐĂďůĞŝŶǀŽŝĐĞ͘dŚĞǁƌŝƚƚĞŶŶŽƚŝĐĞŵƵƐƚĐŽŶƚĂŝŶƌĞĂƐŽŶĂďůĞĚĞƚĂŝůŽĨƚŚĞŝƐƐƵĞƐLJŽƵĐŽŶƚĞŶĚĂƌĞŝŶ ĚŝƐƉƵƚĞƐŽƚŚĂƚǁĞĐĂŶĐŽŶĨŝƌŵƚŚĞŝƐƐƵĞĂŶĚƌĞƐƉŽŶĚƚŽLJŽƵƌŶŽƚŝĐĞǁŝƚŚĞŝƚŚĞƌĂũƵƐƚŝĨŝĐĂƚŝŽŶŽĨƚŚĞ ŝŶǀŽŝĐĞ͕ĂŶĂĚũƵƐƚŵĞŶƚƚŽƚŚĞŝŶǀŽŝĐĞ͕ŽƌĂƉƌŽƉŽƐĂůĂĚĚƌĞƐƐŝŶŐƚŚĞŝƐƐƵĞƐƉƌĞƐĞŶƚĞĚŝŶLJŽƵƌŶŽƚŝĐĞ͘tĞ ǁŝůůǁŽƌŬǁŝƚŚLJŽƵĂƐŵĂLJďĞŶĞĐĞƐƐĂƌLJƚŽĚĞǀĞůŽƉĂŶĂĐƚŝŽŶƉůĂŶƚŚĂƚŽƵƚůŝŶĞƐƌĞĂƐŽŶĂďůĞƐƚĞƉƐƚŽďĞ ƚĂŬĞŶďLJĞĂĐŚŽĨƵƐƚŽƌĞƐŽůǀĞĂŶLJŝƐƐƵĞƐƉƌĞƐĞŶƚĞĚŝŶLJŽƵƌŶŽƚŝĐĞ͘zŽƵŵĂLJǁŝƚŚŚŽůĚƉĂLJŵĞŶƚŽĨƚŚĞ ĂŵŽƵŶƚ;ƐͿĂĐƚƵĂůůLJŝŶĚŝƐƉƵƚĞ͕ĂŶĚŽŶůLJƚŚŽƐĞĂŵŽƵŶƚƐ͕ƵŶƚŝůǁĞĐŽŵƉůĞƚĞƚŚĞĂĐƚŝŽŶŝƚĞŵƐŽƵƚůŝŶĞĚŝŶ ƚŚĞƉůĂŶ͘/ĨǁĞĂƌĞƵŶĂďůĞƚŽĐŽŵƉůĞƚĞƚŚĞĂĐƚŝŽŶŝƚĞŵƐŽƵƚůŝŶĞĚŝŶƚŚĞĂĐƚŝŽŶƉůĂŶďĞĐĂƵƐĞŽĨLJŽƵƌ ĨĂŝůƵƌĞƚŽĐŽŵƉůĞƚĞƚŚĞŝƚĞŵƐĂŐƌĞĞĚƚŽďĞĚŽŶĞďLJLJŽƵ͕ƚŚĞŶLJŽƵǁŝůůƌĞŵŝƚĨƵůůƉĂLJŵĞŶƚŽĨƚŚĞŝŶǀŽŝĐĞ͘ tĞƌĞƐĞƌǀĞƚŚĞƌŝŐŚƚƚŽƐƵƐƉĞŶĚĚĞůŝǀĞƌLJŽĨĂůůƐĞƌǀŝĐĞƐ͕ŝŶĐůƵĚŝŶŐŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ŝĨ LJŽƵĨĂŝůƚŽƉĂLJĂŶŝŶǀŽŝĐĞŶŽƚĚŝƐƉƵƚĞĚĂƐĚĞƐĐƌŝďĞĚĂďŽǀĞǁŝƚŚŝŶĨŝĨƚĞĞŶ;ϭϱͿĚĂLJƐŽĨŶŽƚŝĐĞŽĨŽƵƌŝŶƚĞŶƚ ƚŽĚŽƐŽ͘ ^d/KE'ʹdZD/Ed/KE ϭ͘dĞƌŵŝŶĂƚŝŽŶ͘dŚŝƐŐƌĞĞŵĞŶƚŵĂLJďĞƚĞƌŵŝŶĂƚĞĚĂƐƐĞƚĨŽƌƚŚďĞůŽǁ͘/ŶƚŚĞĞǀĞŶƚŽĨƚĞƌŵŝŶĂƚŝŽŶ͕LJŽƵ ǁŝůůƉĂLJƵƐĨŽƌĂůůƵŶĚŝƐƉƵƚĞĚĨĞĞƐĂŶĚĞdžƉĞŶƐĞƐƌĞůĂƚĞĚƚŽƚŚĞƐŽĨƚǁĂƌĞ͕ƉƌŽĚƵĐƚƐ͕ĂŶĚͬŽƌƐĞƌǀŝĐĞƐLJŽƵ ŚĂǀĞƌĞĐĞŝǀĞĚ͕ŽƌǁĞŚĂǀĞŝŶĐƵƌƌĞĚŽƌĚĞůŝǀĞƌĞĚ͕ƉƌŝŽƌƚŽƚŚĞĞĨĨĞĐƚŝǀĞĚĂƚĞŽĨƚĞƌŵŝŶĂƚŝŽŶ͘ŝƐƉƵƚĞĚ ĨĞĞƐĂŶĚĞdžƉĞŶƐĞƐŝŶĂůůƚĞƌŵŝŶĂƚŝŽŶƐŽƚŚĞƌƚŚĂŶLJŽƵƌƚĞƌŵŝŶĂƚŝŽŶĨŽƌĐĂƵƐĞŵƵƐƚŚĂǀĞďĞĞŶƐƵďŵŝƚƚĞĚ ĂƐŝŶǀŽŝĐĞĚŝƐƉƵƚĞƐŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚ^ĞĐƚŝŽŶ&;ϮͿ͘ ϭ͘ϭ&ŽƌĂƵƐĞ͘/ĨLJŽƵďĞůŝĞǀĞǁĞŚĂǀĞŵĂƚĞƌŝĂůůLJďƌĞĂĐŚĞĚƚŚŝƐŐƌĞĞŵĞŶƚ͕LJŽƵǁŝůůŝŶǀŽŬĞƚŚĞŝƐƉƵƚĞ ZĞƐŽůƵƚŝŽŶĐůĂƵƐĞƐĞƚĨŽƌƚŚŝŶ^ĞĐƚŝŽŶ/;ϯͿ͘zŽƵŵĂLJƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚĨŽƌĐĂƵƐĞŝŶƚŚĞĞǀĞŶƚ ǁĞĚŽŶŽƚĐƵƌĞ͕ŽƌĐƌĞĂƚĞĂŵƵƚƵĂůůLJĂŐƌĞĞĂďůĞĂĐƚŝŽŶƉůĂŶƚŽĂĚĚƌĞƐƐ͕ĂŵĂƚĞƌŝĂůďƌĞĂĐŚŽĨƚŚŝƐ ŐƌĞĞŵĞŶƚǁŝƚŚŝŶƚŚĞƚŚŝƌƚLJ;ϯϬͿĚĂLJǁŝŶĚŽǁƐĞƚĨŽƌƚŚŝŶ^ĞĐƚŝŽŶ/;ϯͿ͘ ϭ͘Ϯ&ŽƌĐĞDĂũĞƵƌĞ͘ŝƚŚĞƌƉĂƌƚLJŚĂƐƚŚĞƌŝŐŚƚƚŽƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚŝĨĂ&ŽƌĐĞDĂũĞƵƌĞĞǀĞŶƚ ƐƵƐƉĞŶĚƐƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚŝƐŐƌĞĞŵĞŶƚĨŽƌĂƉĞƌŝŽĚŽĨĨŽƌƚLJͲĨŝǀĞ;ϰϱͿĚĂLJƐŽƌŵŽƌĞ͘ ϭ͘ϯ>ĂĐŬŽĨƉƉƌŽƉƌŝĂƚŝŽŶƐ͘/ĨLJŽƵƐŚŽƵůĚŶŽƚĂƉƉƌŽƉƌŝĂƚĞŽƌŽƚŚĞƌǁŝƐĞƌĞĐĞŝǀĞĨƵŶĚƐƐƵĨĨŝĐŝĞŶƚƚŽ ƉƵƌĐŚĂƐĞ͕ůĞĂƐĞ͕ŽƉĞƌĂƚĞ͕ŽƌŵĂŝŶƚĂŝŶƚŚĞƐŽĨƚǁĂƌĞŽƌƐĞƌǀŝĐĞƐƐĞƚĨŽƌƚŚŝŶƚŚŝƐŐƌĞĞŵĞŶƚ͕LJŽƵŵĂLJ ƵŶŝůĂƚĞƌĂůůLJƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚƵƉŽŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐǁƌŝƚƚĞŶŶŽƚŝĐĞƚŽƵƐ͘zŽƵǁŝůůŶŽƚďĞ ĞŶƚŝƚůĞĚƚŽĂƌĞĨƵŶĚŽƌŽĨĨƐĞƚŽĨƉƌĞǀŝŽƵƐůLJƉĂŝĚůŝĐĞŶƐĞĂŶĚŽƚŚĞƌĨĞĞƐ͘zŽƵĂŐƌĞĞŶŽƚƚŽƵƐĞ ƚĞƌŵŝŶĂƚŝŽŶĨŽƌůĂĐŬŽĨĂƉƉƌŽƉƌŝĂƚŝŽŶƐĂƐĂƐƵďƐƚŝƚƵƚĞĨŽƌƚĞƌŵŝŶĂƚŝŽŶĨŽƌĐŽŶǀĞŶŝĞŶĐĞ͘ ^d/KE,ʹ/EDE/&/d/KE͕>/D/dd/KEK&>//>/dzE/E^hZE ϭ͘/ŶƚĞůůĞĐƚƵĂůWƌŽƉĞƌƚLJ/ŶĨƌŝŶŐĞŵĞŶƚ/ŶĚĞŵŶŝĨŝĐĂƚŝŽŶ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϯ ϭ͘ϭtĞǁŝůůĚĞĨĞŶĚLJŽƵĂŐĂŝŶƐƚĂŶLJƚŚŝƌĚƉĂƌƚLJĐůĂŝŵ;ƐͿƚŚĂƚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŽƌŽĐƵŵĞŶƚĂƚŝŽŶ ŝŶĨƌŝŶŐĞƐƚŚĂƚƚŚŝƌĚƉĂƌƚLJ͛ƐƉĂƚĞŶƚ͕ĐŽƉLJƌŝŐŚƚ͕ŽƌƚƌĂĚĞŵĂƌŬ͕ŽƌŵŝƐĂƉƉƌŽƉƌŝĂƚĞƐŝƚƐƚƌĂĚĞƐĞĐƌĞƚƐ͕ĂŶĚ ǁŝůůƉĂLJƚŚĞĂŵŽƵŶƚŽĨĂŶLJƌĞƐƵůƚŝŶŐĂĚǀĞƌƐĞĨŝŶĂůũƵĚŐŵĞŶƚ;ŽƌƐĞƚƚůĞŵĞŶƚƚŽǁŚŝĐŚǁĞĐŽŶƐĞŶƚͿ͘ zŽƵŵƵƐƚŶŽƚŝĨLJƵƐƉƌŽŵƉƚůLJŝŶǁƌŝƚŝŶŐŽĨƚŚĞĐůĂŝŵĂŶĚŐŝǀĞƵƐƐŽůĞĐŽŶƚƌŽůŽǀĞƌŝƚƐĚĞĨĞŶƐĞŽƌ ƐĞƚƚůĞŵĞŶƚ͘zŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚƌĞĂƐŽŶĂďůĞĂƐƐŝƐƚĂŶĐĞ͕ĐŽŽƉĞƌĂƚŝŽŶ͕ĂŶĚŝŶĨŽƌŵĂƚŝŽŶŝŶ ĚĞĨĞŶĚŝŶŐƚŚĞĐůĂŝŵĂƚŽƵƌĞdžƉĞŶƐĞ͘ ϭ͘ϮKƵƌŽďůŝŐĂƚŝŽŶƐƵŶĚĞƌƚŚŝƐ^ĞĐƚŝŽŶ,;ϭͿǁŝůůŶŽƚĂƉƉůLJƚŽƚŚĞĞdžƚĞŶƚƚŚĞĐůĂŝŵŽƌĂĚǀĞƌƐĞĨŝŶĂů ũƵĚŐŵĞŶƚŝƐďĂƐĞĚŽŶLJŽƵƌ͗;ĂͿƵƐĞŽĨĂƉƌĞǀŝŽƵƐǀĞƌƐŝŽŶŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚƚŚĞĐůĂŝŵǁŽƵůĚ ŚĂǀĞďĞĞŶĂǀŽŝĚĞĚŚĂĚLJŽƵŝŶƐƚĂůůĞĚĂŶĚƵƐĞĚƚŚĞĐƵƌƌĞŶƚǀĞƌƐŝŽŶŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂŶĚǁĞ ƉƌŽǀŝĚĞĚŶŽƚŝĐĞŽĨƚŚĂƚƌĞƋƵŝƌĞŵĞŶƚƚŽLJŽƵ͖;ďͿĐŽŵďŝŶŝŶŐƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞǁŝƚŚĂŶLJƉƌŽĚƵĐƚŽƌ ĚĞǀŝĐĞŶŽƚƉƌŽǀŝĚĞĚ͕ĐŽŶƚĞŵƉůĂƚĞĚ͕ŽƌĂƉƉƌŽǀĞĚďLJƵƐ͖;ĐͿĂůƚĞƌŝŶŐŽƌŵŽĚŝĨLJŝŶŐƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ ŝŶĐůƵĚŝŶŐĂŶLJŵŽĚŝĨŝĐĂƚŝŽŶďLJƚŚŝƌĚƉĂƌƚŝĞƐĂƚLJŽƵƌĚŝƌĞĐƚŝŽŶŽƌŽƚŚĞƌǁŝƐĞƉĞƌŵŝƚƚĞĚďLJLJŽƵ͖;ĚͿƵƐĞ ŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝŶĐŽŶƚƌĂĚŝĐƚŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͕ŝŶĐůƵĚŝŶŐǁŝƚŚŶŽŶͲůŝĐĞŶƐĞĚƚŚŝƌĚƉĂƌƚŝĞƐ͖ Žƌ;ĞͿǁŝůůĨƵůŝŶĨƌŝŶŐĞŵĞŶƚ͕ŝŶĐůƵĚŝŶŐƵƐĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂĨƚĞƌǁĞŶŽƚŝĨLJLJŽƵƚŽĚŝƐĐŽŶƚŝŶƵĞƵƐĞ ĚƵĞƚŽƐƵĐŚĂĐůĂŝŵ͘ ϭ͘ϯ/ĨǁĞƌĞĐĞŝǀĞŝŶĨŽƌŵĂƚŝŽŶĐŽŶĐĞƌŶŝŶŐĂŶŝŶĨƌŝŶŐĞŵĞŶƚŽƌŵŝƐĂƉƉƌŽƉƌŝĂƚŝŽŶĐůĂŝŵƌĞůĂƚĞĚƚŽƚŚĞdLJůĞƌ ^ŽĨƚǁĂƌĞ͕ǁĞŵĂLJ͕ĂƚŽƵƌĞdžƉĞŶƐĞĂŶĚǁŝƚŚŽƵƚŽďůŝŐĂƚŝŽŶƚŽĚŽƐŽ͕ĞŝƚŚĞƌ͗;ĂͿƉƌŽĐƵƌĞĨŽƌLJŽƵƚŚĞ ƌŝŐŚƚƚŽĐŽŶƚŝŶƵĞŝƚƐƵƐĞ͖;ďͿŵŽĚŝĨLJŝƚƚŽŵĂŬĞŝƚŶŽŶͲŝŶĨƌŝŶŐŝŶŐ͖Žƌ;ĐͿƌĞƉůĂĐĞŝƚǁŝƚŚĂĨƵŶĐƚŝŽŶĂů ĞƋƵŝǀĂůĞŶƚ͕ŝŶǁŚŝĐŚĐĂƐĞLJŽƵǁŝůůƐƚŽƉƌƵŶŶŝŶŐƚŚĞĂůůĞŐĞĚůLJŝŶĨƌŝŶŐŝŶŐdLJůĞƌ^ŽĨƚǁĂƌĞŝŵŵĞĚŝĂƚĞůLJ͘ ůƚĞƌŶĂƚŝǀĞůLJ͕ǁĞŵĂLJĚĞĐŝĚĞƚŽůŝƚŝŐĂƚĞƚŚĞĐůĂŝŵƚŽũƵĚŐŵĞŶƚ͕ŝŶǁŚŝĐŚĐĂƐĞLJŽƵŵĂLJĐŽŶƚŝŶƵĞƚŽ ƵƐĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞƚĞƌŵƐŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘ ϭ͘ϰ/ĨĂŶŝŶĨƌŝŶŐĞŵĞŶƚŽƌŵŝƐĂƉƉƌŽƉƌŝĂƚŝŽŶĐůĂŝŵŝƐĨƵůůLJůŝƚŝŐĂƚĞĚĂŶĚLJŽƵƌƵƐĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐ ĞŶũŽŝŶĞĚďLJĂĐŽƵƌƚŽĨĐŽŵƉĞƚĞŶƚũƵƌŝƐĚŝĐƚŝŽŶ͕ŝŶĂĚĚŝƚŝŽŶƚŽƉĂLJŝŶŐĂŶLJĂĚǀĞƌƐĞĨŝŶĂůũƵĚŐŵĞŶƚ;Žƌ ƐĞƚƚůĞŵĞŶƚƚŽǁŚŝĐŚǁĞĐŽŶƐĞŶƚͿ͕ǁĞǁŝůů͕ĂƚŽƵƌŽƉƚŝŽŶ͕ĞŝƚŚĞƌ͗;ĂͿƉƌŽĐƵƌĞƚŚĞƌŝŐŚƚƚŽĐŽŶƚŝŶƵĞŝƚƐ ƵƐĞ͖;ďͿŵŽĚŝĨLJŝƚƚŽŵĂŬĞŝƚŶŽŶͲŝŶĨƌŝŶŐŝŶŐ͖;ĐͿƌĞƉůĂĐĞŝƚǁŝƚŚĂĨƵŶĐƚŝŽŶĂůĞƋƵŝǀĂůĞŶƚ͖Žƌ;ĚͿ ƚĞƌŵŝŶĂƚĞLJŽƵƌůŝĐĞŶƐĞĂŶĚƌĞĨƵŶĚƚŚĞůŝĐĞŶƐĞĨĞĞƐƉĂŝĚĨŽƌƚŚĞŝŶĨƌŝŶŐŝŶŐdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂƐ ĚĞƉƌĞĐŝĂƚĞĚŽŶĂƐƚƌĂŝŐŚƚͲůŝŶĞďĂƐŝƐŵĞĂƐƵƌĞĚŽǀĞƌƐĞǀĞŶ;ϳͿLJĞĂƌƐĨƌŽŵƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘tĞǁŝůů ƉƵƌƐƵĞƚŚŽƐĞŽƉƚŝŽŶƐŝŶƚŚĞŽƌĚĞƌůŝƐƚĞĚŚĞƌĞŝŶ͘dŚŝƐƐĞĐƚŝŽŶƉƌŽǀŝĚĞƐLJŽƵƌĞdžĐůƵƐŝǀĞƌĞŵĞĚLJĨŽƌ ƚŚŝƌĚƉĂƌƚLJĐŽƉLJƌŝŐŚƚ͕ƉĂƚĞŶƚ͕ŽƌƚƌĂĚĞŵĂƌŬŝŶĨƌŝŶŐĞŵĞŶƚĂŶĚƚƌĂĚĞƐĞĐƌĞƚŵŝƐĂƉƉƌŽƉƌŝĂƚŝŽŶĐůĂŝŵƐ͘ Ϯ͘'ĞŶĞƌĂů/ŶĚĞŵŶŝĨŝĐĂƚŝŽŶ͘ Ϯ͘ϭtĞǁŝůůŝŶĚĞŵŶŝĨLJĂŶĚŚŽůĚŚĂƌŵůĞƐƐLJŽƵĂŶĚLJŽƵƌĂŐĞŶƚƐ͕ŽĨĨŝĐŝĂůƐ͕ĂŶĚĞŵƉůŽLJĞĞƐĨƌŽŵĂŶĚĂŐĂŝŶƐƚ ĂŶLJĂŶĚĂůůƚŚŝƌĚͲƉĂƌƚLJĐůĂŝŵƐ͕ůŽƐƐĞƐ͕ůŝĂďŝůŝƚŝĞƐ͕ĚĂŵĂŐĞƐ͕ĐŽƐƚƐ͕ĂŶĚĞdžƉĞŶƐĞƐ;ŝŶĐůƵĚŝŶŐƌĞĂƐŽŶĂďůĞ ĂƚƚŽƌŶĞLJΖƐĨĞĞƐĂŶĚĐŽƐƚƐͿĨŽƌ;ĂͿƉĞƌƐŽŶĂůŝŶũƵƌLJŽƌƉƌŽƉĞƌƚLJĚĂŵĂŐĞƚŽƚŚĞĞdžƚĞŶƚĐĂƵƐĞĚďLJŽƵƌ ŶĞŐůŝŐĞŶĐĞŽƌǁŝůůĨƵůŵŝƐĐŽŶĚƵĐƚ͖Žƌ;ďͿŽƵƌǀŝŽůĂƚŝŽŶŽĨW/^^ƌĞƋƵŝƌĞŵĞŶƚƐŽƌĂůĂǁĂƉƉůŝĐĂďůĞƚŽ ŽƵƌƉĞƌĨŽƌŵĂŶĐĞƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘zŽƵŵƵƐƚŶŽƚŝĨLJƵƐƉƌŽŵƉƚůLJŝŶǁƌŝƚŝŶŐŽĨƚŚĞĐůĂŝŵĂŶĚ ŐŝǀĞƵƐƐŽůĞĐŽŶƚƌŽůŽǀĞƌŝƚƐĚĞĨĞŶƐĞŽƌƐĞƚƚůĞŵĞŶƚ͘zŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚƌĞĂƐŽŶĂďůĞ ĂƐƐŝƐƚĂŶĐĞ͕ĐŽŽƉĞƌĂƚŝŽŶ͕ĂŶĚŝŶĨŽƌŵĂƚŝŽŶŝŶĚĞĨĞŶĚŝŶŐƚŚĞĐůĂŝŵĂƚŽƵƌĞdžƉĞŶƐĞ͘ Ϯ͘ϮdŽƚŚĞĞdžƚĞŶƚƉĞƌŵŝƚƚĞĚďLJĂƉƉůŝĐĂďůĞůĂǁ͕LJŽƵǁŝůůŝŶĚĞŵŶŝĨLJĂŶĚŚŽůĚŚĂƌŵůĞƐƐƵƐĂŶĚŽƵƌĂŐĞŶƚƐ͕ ŽĨĨŝĐŝĂůƐ͕ĂŶĚĞŵƉůŽLJĞĞƐĨƌŽŵĂŶĚĂŐĂŝŶƐƚĂŶLJĂŶĚĂůůƚŚŝƌĚͲƉĂƌƚLJĐůĂŝŵƐ͕ůŽƐƐĞƐ͕ůŝĂďŝůŝƚŝĞƐ͕ĚĂŵĂŐĞƐ͕ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϰ ĐŽƐƚƐ͕ĂŶĚĞdžƉĞŶƐĞƐ;ŝŶĐůƵĚŝŶŐƌĞĂƐŽŶĂďůĞĂƚƚŽƌŶĞLJΖƐĨĞĞƐĂŶĚĐŽƐƚƐͿĨŽƌƉĞƌƐŽŶĂůŝŶũƵƌLJŽƌƉƌŽƉĞƌƚLJ ĚĂŵĂŐĞƚŽƚŚĞĞdžƚĞŶƚĐĂƵƐĞĚďLJLJŽƵƌŶĞŐůŝŐĞŶĐĞŽƌǁŝůůĨƵůŵŝƐĐŽŶĚƵĐƚ͖Žƌ;ďͿLJŽƵƌǀŝŽůĂƚŝŽŶŽĨĂůĂǁ ĂƉƉůŝĐĂďůĞƚŽLJŽƵƌƉĞƌĨŽƌŵĂŶĐĞƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘tĞǁŝůůŶŽƚŝĨLJLJŽƵƉƌŽŵƉƚůLJŝŶǁƌŝƚŝŶŐŽĨƚŚĞ ĐůĂŝŵĂŶĚǁŝůůŐŝǀĞLJŽƵƐŽůĞĐŽŶƚƌŽůŽǀĞƌŝƚƐĚĞĨĞŶƐĞŽƌƐĞƚƚůĞŵĞŶƚ͘tĞĂŐƌĞĞƚŽƉƌŽǀŝĚĞLJŽƵǁŝƚŚ ƌĞĂƐŽŶĂďůĞĂƐƐŝƐƚĂŶĐĞ͕ĐŽŽƉĞƌĂƚŝŽŶ͕ĂŶĚŝŶĨŽƌŵĂƚŝŽŶŝŶĚĞĨĞŶĚŝŶŐƚŚĞĐůĂŝŵĂƚLJŽƵƌĞdžƉĞŶƐĞ͘ ϯ͘/^>/DZ͘yWd&KZd,yWZ^^tZZEd/^WZKs//Ed,/^'ZDEdEdKd, Dy/DhDydEdWZD/ddzWW>/>>t͕t,Zz/^>/D>>Kd,ZtZZEd/^ EKE/d/KE^͕t,d,ZyWZ^^͕/DW>/͕KZ^ddhdKZz͕/E>h/E'͕hdEKd>/D/ddK͕ Ez/DW>/tZZEd/^͕hd/^͕KZKE/d/KE^K&DZ,Ed/>/dzKZ&/dE^^&KZ WZd/h>ZWhZWK^͘ ϰ͘>/D/dd/KEK&>//>/dz͘yWd^Kd,Zt/^yWZ^^>z^d&KZd,/Ed,/^'ZDEd͕KhZ >//>/dz&KZD'^Z/^/E'KhdK&d,/^'ZDEd͕t,d,Z^KEd,KZzK& KEdZdKZdKZd͕/E>h/E'E'>/'EE^dZ/d>//>/dz͕^,>>>/D/ddKzKhZ dh>/ZdD'^͕EKddKy;ͿWZ/KZdK&KZD>dZE^/d/KEdKD/EdEE E^hWWKZd͕d,dKd>KEͲd/D&^^d&KZd,/Ed,/Es^dDEd^hDDZz͖KZ;Ϳ&dZ &KZD>dZE^/d/KEdKD/EdEEE^hWWKZd͕d,d,EͲhZZEdEEh>D/EdEE E^hWWKZd&͘d,WZd/^<EKt>'E'Zd,dd,WZ/^^d&KZd,/Ed,/^ 'ZDEdZ^d/EZ>/EhWKEd,/^>/D/dd/KEK&>//>/dzEdKd,Dy/DhD ydEd>>KthEZWW>/>>t͕d,y>h^/KEK&Zd/ED'^͕E, ^,>>WW>zZ'Z>^^K&d,&/>hZK&E^^Ed/>WhZWK^K&EzZDz͘d, &KZ'K/E'>/D/dd/KEK&>//>/dz^,>>EKdWW>zdK>/D^d,dZ^h:ddK^d/KE^ ,;ϭͿE,;ϮͿ͘ ϱ͘y>h^/KEK&Zd/ED'^͘dKd,Dy/DhDydEdWZD/ddzWW>/>>t͕/E EKsEd^,>>t>/>&KZEz^W/>͕/E/Ed>͕WhE/d/s͕/E/Zd͕KZ KE^YhEd/>D'^t,d^KsZ͕sE/&t,sEs/^K&d,WK^^//>/dzK& ^h,D'^͘ ϲ͘/ŶƐƵƌĂŶĐĞ͘ƵƌŝŶŐƚŚĞĐŽƵƌƐĞŽĨƉĞƌĨŽƌŵŝŶŐƐĞƌǀŝĐĞƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͕ǁĞĂŐƌĞĞƚŽŵĂŝŶƚĂŝŶƚŚĞ ĨŽůůŽǁŝŶŐůĞǀĞůƐŽĨŝŶƐƵƌĂŶĐĞ͗;ĂͿŽŵŵĞƌĐŝĂů'ĞŶĞƌĂů>ŝĂďŝůŝƚLJŽĨĂƚůĞĂƐƚΨϭ͕ϬϬϬ͕ϬϬϬ͖;ďͿƵƚŽŵŽďŝůĞ >ŝĂďŝůŝƚLJŽĨĂƚůĞĂƐƚΨϭ͕ϬϬϬ͕ϬϬϬ͖;ĐͿWƌŽĨĞƐƐŝŽŶĂů>ŝĂďŝůŝƚLJŽĨĂƚůĞĂƐƚΨϭ͕ϬϬϬ͕ϬϬϬ͖;ĚͿtŽƌŬĞƌƐ ŽŵƉĞŶƐĂƚŝŽŶĐŽŵƉůLJŝŶŐǁŝƚŚĂƉƉůŝĐĂďůĞƐƚĂƚƵƚŽƌLJƌĞƋƵŝƌĞŵĞŶƚƐ͖ĂŶĚ;ĞͿdžĐĞƐƐͬhŵďƌĞůůĂ>ŝĂďŝůŝƚLJŽĨĂƚ ůĞĂƐƚΨϱ͕ϬϬϬ͕ϬϬϬ͘tĞǁŝůůĂĚĚLJŽƵĂƐĂŶĂĚĚŝƚŝŽŶĂůŝŶƐƵƌĞĚƚŽŽƵƌŽŵŵĞƌĐŝĂů'ĞŶĞƌĂů>ŝĂďŝůŝƚLJĂŶĚ ƵƚŽŵŽďŝůĞ>ŝĂďŝůŝƚLJƉŽůŝĐŝĞƐ͕ǁŚŝĐŚǁŝůůĂƵƚŽŵĂƚŝĐĂůůLJĂĚĚLJŽƵĂƐĂŶĂĚĚŝƚŝŽŶĂůŝŶƐƵƌĞĚƚŽŽƵƌ džĐĞƐƐͬhŵďƌĞůůĂ>ŝĂďŝůŝƚLJƉŽůŝĐLJĂƐǁĞůů͘tĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚĐŽƉŝĞƐŽĨĐĞƌƚŝĨŝĐĂƚĞƐŽĨŝŶƐƵƌĂŶĐĞ ƵƉŽŶLJŽƵƌǁƌŝƚƚĞŶƌĞƋƵĞƐƚ͘ ^d/KE/ʹ'EZ>dZD^EKE/d/KE^ ϭ͘ĚĚŝƚŝŽŶĂůWƌŽĚƵĐƚƐĂŶĚ^ĞƌǀŝĐĞƐ͘zŽƵŵĂLJƉƵƌĐŚĂƐĞĂĚĚŝƚŝŽŶĂůƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐĂƚƚŚĞƌĂƚĞƐƐĞƚ ĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĨŽƌƚǁĞůǀĞ;ϭϮͿŵŽŶƚŚƐĨƌŽŵƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͕ĂŶĚƚŚĞƌĞĂĨƚĞƌĂƚŽƵƌ ƚŚĞŶͲĐƵƌƌĞŶƚůŝƐƚƉƌŝĐĞ͕ďLJĞdžĞĐƵƚŝŶŐĂŵƵƚƵĂůůLJĂŐƌĞĞĚĂĚĚĞŶĚƵŵ͘/ĨŶŽƌĂƚĞŝƐƉƌŽǀŝĚĞĚŝŶƚŚĞ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϱ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͕ŽƌƚŚŽƐĞƚǁĞůǀĞ;ϭϮͿŵŽŶƚŚƐŚĂǀĞĞdžƉŝƌĞĚ͕LJŽƵŵĂLJƉƵƌĐŚĂƐĞĂĚĚŝƚŝŽŶĂůƉƌŽĚƵĐƚƐ ĂŶĚƐĞƌǀŝĐĞƐĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚůŝƐƚƉƌŝĐĞ͕ĂůƐŽďLJĞdžĞĐƵƚŝŶŐĂŵƵƚƵĂůůLJĂŐƌĞĞĚĂĚĚĞŶĚƵŵ͘dŚĞƚĞƌŵƐŽĨ ƚŚŝƐŐƌĞĞŵĞŶƚǁŝůůĐŽŶƚƌŽůĂŶLJƐƵĐŚĂĚĚŝƚŝŽŶĂůƉƵƌĐŚĂƐĞ;ƐͿ͕ƵŶůĞƐƐŽƚŚĞƌǁŝƐĞƐƉĞĐŝĨŝĐĂůůLJƉƌŽǀŝĚĞĚŝŶƚŚĞ ĂĚĚĞŶĚƵŵ͘ Ϯ͘KƉƚŝŽŶĂů/ƚĞŵƐ͘WƌŝĐŝŶŐĨŽƌĂŶLJůŝƐƚĞĚŽƉƚŝŽŶĂůƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJǁŝůůďĞ ǀĂůŝĚĨŽƌƚǁĞůǀĞ;ϭϮͿŵŽŶƚŚƐĨƌŽŵƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘ ϯ͘ŝƐƉƵƚĞZĞƐŽůƵƚŝŽŶ͘zŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚǁƌŝƚƚĞŶŶŽƚŝĐĞǁŝƚŚŝŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨďĞĐŽŵŝŶŐ ĂǁĂƌĞŽĨĂĚŝƐƉƵƚĞ͘zŽƵĂŐƌĞĞƚŽĐŽŽƉĞƌĂƚĞǁŝƚŚƵƐŝŶƚƌLJŝŶŐƚŽƌĞĂƐŽŶĂďůLJƌĞƐŽůǀĞĂůůĚŝƐƉƵƚĞƐ͕ ŝŶĐůƵĚŝŶŐ͕ŝĨƌĞƋƵĞƐƚĞĚďLJĞŝƚŚĞƌƉĂƌƚLJ͕ĂƉƉŽŝŶƚŝŶŐĂƐĞŶŝŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞƚŽŵĞĞƚĂŶĚĞŶŐĂŐĞŝŶŐŽŽĚ ĨĂŝƚŚŶĞŐŽƚŝĂƚŝŽŶƐǁŝƚŚŽƵƌĂƉƉŽŝŶƚĞĚƐĞŶŝŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞ͘^ĞŶŝŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐǁŝůůĐŽŶǀĞŶĞǁŝƚŚŝŶ ƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨƚŚĞǁƌŝƚƚĞŶĚŝƐƉƵƚĞŶŽƚŝĐĞ͕ƵŶůĞƐƐŽƚŚĞƌǁŝƐĞĂŐƌĞĞĚ͘ůůŵĞĞƚŝŶŐƐĂŶĚĚŝƐĐƵƐƐŝŽŶƐ ďĞƚǁĞĞŶƐĞŶŝŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐǁŝůůďĞĚĞĞŵĞĚĐŽŶĨŝĚĞŶƚŝĂůƐĞƚƚůĞŵĞŶƚĚŝƐĐƵƐƐŝŽŶƐŶŽƚƐƵďũĞĐƚƚŽ ĚŝƐĐůŽƐƵƌĞƵŶĚĞƌ&ĞĚĞƌĂůZƵůĞŽĨǀŝĚĞŶĐĞϰϬϴŽƌĂŶLJƐŝŵŝůĂƌĂƉƉůŝĐĂďůĞƐƚĂƚĞƌƵůĞ͘/ĨǁĞĨĂŝůƚŽƌĞƐŽůǀĞ ƚŚĞĚŝƐƉƵƚĞ͕ƚŚĞŶƚŚĞƉĂƌƚŝĞƐƐŚĂůůƉĂƌƚŝĐŝƉĂƚĞŝŶŶŽŶͲďŝŶĚŝŶŐŵĞĚŝĂƚŝŽŶŝŶĂŶĞĨĨŽƌƚƚŽƌĞƐŽůǀĞƚŚĞ ĚŝƐƉƵƚĞ͘/ĨƚŚĞĚŝƐƉƵƚĞƌĞŵĂŝŶƐƵŶƌĞƐŽůǀĞĚĂĨƚĞƌŵĞĚŝĂƚŝŽŶ͕ƚŚĞŶĞŝƚŚĞƌŽĨƵƐŵĂLJĂƐƐĞƌƚŽƵƌƌĞƐƉĞĐƚŝǀĞ ƌŝŐŚƚƐĂŶĚƌĞŵĞĚŝĞƐŝŶĂĐŽƵƌƚŽĨĐŽŵƉĞƚĞŶƚũƵƌŝƐĚŝĐƚŝŽŶ͘EŽƚŚŝŶŐŝŶƚŚŝƐƐĞĐƚŝŽŶƐŚĂůůƉƌĞǀĞŶƚLJŽƵŽƌƵƐ ĨƌŽŵƐĞĞŬŝŶŐŶĞĐĞƐƐĂƌLJŝŶũƵŶĐƚŝǀĞƌĞůŝĞĨĚƵƌŝŶŐƚŚĞĚŝƐƉƵƚĞƌĞƐŽůƵƚŝŽŶƉƌŽĐĞĚƵƌĞƐ͘ ϰ͘dĂdžĞƐ͘dŚĞĨĞĞƐŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĚŽŶŽƚŝŶĐůƵĚĞĂŶLJƚĂdžĞƐ͕ŝŶĐůƵĚŝŶŐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ ƐĂůĞƐ͕ƵƐĞ͕ŽƌĞdžĐŝƐĞƚĂdž͘/ĨLJŽƵĂƌĞĂƚĂdžͲĞdžĞŵƉƚĞŶƚŝƚLJ͕LJŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĂƚĂdžͲĞdžĞŵƉƚ ĐĞƌƚŝĨŝĐĂƚĞ͘KƚŚĞƌǁŝƐĞ͕ǁĞǁŝůůƉĂLJĂůůĂƉƉůŝĐĂďůĞƚĂdžĞƐƚŽƚŚĞƉƌŽƉĞƌĂƵƚŚŽƌŝƚŝĞƐĂŶĚLJŽƵǁŝůůƌĞŝŵďƵƌƐĞ ƵƐĨŽƌƐƵĐŚƚĂdžĞƐ͘/ĨLJŽƵŚĂǀĞĂǀĂůŝĚĚŝƌĞĐƚͲƉĂLJƉĞƌŵŝƚ͕LJŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĂĐŽƉLJ͘&ŽƌĐůĂƌŝƚLJ͕ ǁĞĂƌĞƌĞƐƉŽŶƐŝďůĞĨŽƌƉĂLJŝŶŐŽƵƌŝŶĐŽŵĞƚĂdžĞƐ͕ďŽƚŚĨĞĚĞƌĂůĂŶĚƐƚĂƚĞ͕ĂƐĂƉƉůŝĐĂďůĞ͕ĂƌŝƐŝŶŐĨƌŽŵŽƵƌ ƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘ ϱ͘EŽŶĚŝƐĐƌŝŵŝŶĂƚŝŽŶ͘tĞǁŝůůŶŽƚĚŝƐĐƌŝŵŝŶĂƚĞĂŐĂŝŶƐƚĂŶLJƉĞƌƐŽŶĞŵƉůŽLJĞĚŽƌĂƉƉůLJŝŶŐĨŽƌĞŵƉůŽLJŵĞŶƚ ĐŽŶĐĞƌŶŝŶŐƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨŽƵƌƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘dŚŝƐĚŝƐĐƌŝŵŝŶĂƚŝŽŶ ƉƌŽŚŝďŝƚŝŽŶǁŝůůĂƉƉůLJƚŽĂůůŵĂƚƚĞƌƐŽĨŝŶŝƚŝĂůĞŵƉůŽLJŵĞŶƚ͕ƚĞŶƵƌĞ͕ĂŶĚƚĞƌŵƐŽĨĞŵƉůŽLJŵĞŶƚ͕Žƌ ŽƚŚĞƌǁŝƐĞǁŝƚŚƌĞƐƉĞĐƚƚŽĂŶLJŵĂƚƚĞƌĚŝƌĞĐƚůLJŽƌŝŶĚŝƌĞĐƚůLJƌĞůĂƚŝŶŐƚŽĞŵƉůŽLJŵĞŶƚĐŽŶĐĞƌŶŝŶŐƌĂĐĞ͕ ĐŽůŽƌ͕ƌĞůŝŐŝŽŶ͕ŶĂƚŝŽŶĂůŽƌŝŐŝŶ͕ĂŐĞ͕ƐĞdž͕ƐĞdžƵĂůŽƌŝĞŶƚĂƚŝŽŶ͕ĂŶĐĞƐƚƌLJ͕ĚŝƐĂďŝůŝƚLJƚŚĂƚŝƐƵŶƌĞůĂƚĞĚƚŽƚŚĞ ŝŶĚŝǀŝĚƵĂůΖƐĂďŝůŝƚLJƚŽƉĞƌĨŽƌŵƚŚĞĚƵƚŝĞƐŽĨĂƉĂƌƚŝĐƵůĂƌũŽďŽƌƉŽƐŝƚŝŽŶ͕ŚĞŝŐŚƚ͕ǁĞŝŐŚƚ͕ŵĂƌŝƚĂůƐƚĂƚƵƐ͕Žƌ ƉŽůŝƚŝĐĂůĂĨĨŝůŝĂƚŝŽŶ͘tĞǁŝůůƉŽƐƚ͕ǁŚĞƌĞĂƉƉƌŽƉƌŝĂƚĞ͕ĂůůŶŽƚŝĐĞƐƌĞůĂƚĞĚƚŽŶŽŶĚŝƐĐƌŝŵŝŶĂƚŝŽŶĂƐŵĂLJďĞ ƌĞƋƵŝƌĞĚďLJĂƉƉůŝĐĂďůĞůĂǁ͘ ϲ͘ͲsĞƌŝĨLJ͘tĞŚĂǀĞĐŽŵƉůŝĞĚ͕ĂŶĚǁŝůůĐŽŵƉůLJ͕ǁŝƚŚƚŚĞͲsĞƌŝĨLJƉƌŽĐĞĚƵƌĞƐĂĚŵŝŶŝƐƚĞƌĞĚďLJƚŚĞh͘^͘ ŝƚŝnjĞŶƐŚŝƉĂŶĚ/ŵŵŝŐƌĂƚŝŽŶ^ĞƌǀŝĐĞƐsĞƌŝĨŝĐĂƚŝŽŶŝǀŝƐŝŽŶĨŽƌĂůůŽĨŽƵƌĞŵƉůŽLJĞĞƐĂƐƐŝŐŶĞĚƚŽLJŽƵƌ ƉƌŽũĞĐƚ͘ ϳ͘^ƵďĐŽŶƚƌĂĐƚŽƌƐ͘tĞǁŝůůŶŽƚƐƵďĐŽŶƚƌĂĐƚĂŶLJƐĞƌǀŝĐĞƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚǁŝƚŚŽƵƚLJŽƵƌƉƌŝŽƌǁƌŝƚƚĞŶ ĐŽŶƐĞŶƚ͕ŶŽƚƚŽďĞƵŶƌĞĂƐŽŶĂďůLJǁŝƚŚŚĞůĚ͘ ϴ͘ŝŶĚŝŶŐĨĨĞĐƚ͖EŽƐƐŝŐŶŵĞŶƚ͘dŚŝƐŐƌĞĞŵĞŶƚƐŚĂůůďĞďŝŶĚŝŶŐŽŶ͕ĂŶĚƐŚĂůůďĞĨŽƌƚŚĞďĞŶĞĨŝƚŽĨ͕ ĞŝƚŚĞƌLJŽƵƌŽƌŽƵƌƐƵĐĐĞƐƐŽƌ;ƐͿŽƌƉĞƌŵŝƚƚĞĚĂƐƐŝŐŶ;ƐͿ͘EĞŝƚŚĞƌƉĂƌƚLJŵĂLJĂƐƐŝŐŶƚŚŝƐŐƌĞĞŵĞŶƚǁŝƚŚŽƵƚ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϲ ƚŚĞƉƌŝŽƌǁƌŝƚƚĞŶĐŽŶƐĞŶƚŽĨƚŚĞŽƚŚĞƌƉĂƌƚLJ͖ƉƌŽǀŝĚĞĚ͕ŚŽǁĞǀĞƌ͕LJŽƵƌĐŽŶƐĞŶƚŝƐŶŽƚƌĞƋƵŝƌĞĚĨŽƌĂŶ ĂƐƐŝŐŶŵĞŶƚďLJƵƐĂƐĂƌĞƐƵůƚŽĨĂĐŽƌƉŽƌĂƚĞƌĞŽƌŐĂŶŝnjĂƚŝŽŶ͕ŵĞƌŐĞƌ͕ĂĐƋƵŝƐŝƚŝŽŶ͕ŽƌƉƵƌĐŚĂƐĞŽĨ ƐƵďƐƚĂŶƚŝĂůůLJĂůůŽĨŽƵƌĂƐƐĞƚƐ͘ ϵ͘&ŽƌĐĞDĂũĞƵƌĞ͘džĐĞƉƚĨŽƌLJŽƵƌƉĂLJŵĞŶƚŽďůŝŐĂƚŝŽŶƐ͕ŶĞŝƚŚĞƌƉĂƌƚLJǁŝůůďĞůŝĂďůĞĨŽƌĚĞůĂLJƐŝŶƉĞƌĨŽƌŵŝŶŐ ŝƚƐŽďůŝŐĂƚŝŽŶƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚƚŽƚŚĞĞdžƚĞŶƚƚŚĂƚƚŚĞĚĞůĂLJŝƐĐĂƵƐĞĚďLJ&ŽƌĐĞDĂũĞƵƌĞ͖ƉƌŽǀŝĚĞĚ͕ ŚŽǁĞǀĞƌ͕ƚŚĂƚǁŝƚŚŝŶƚĞŶ;ϭϬͿďƵƐŝŶĞƐƐĚĂLJƐŽĨƚŚĞ&ŽƌĐĞDĂũĞƵƌĞĞǀĞŶƚ͕ƚŚĞƉĂƌƚLJǁŚŽƐĞƉĞƌĨŽƌŵĂŶĐĞŝƐ ĚĞůĂLJĞĚƉƌŽǀŝĚĞƐƚŚĞŽƚŚĞƌƉĂƌƚLJǁŝƚŚǁƌŝƚƚĞŶŶŽƚŝĐĞĞdžƉůĂŝŶŝŶŐƚŚĞĐĂƵƐĞĂŶĚĞdžƚĞŶƚƚŚĞƌĞŽĨ͕ĂƐǁĞůůĂƐ ĂƌĞƋƵĞƐƚĨŽƌĂƌĞĂƐŽŶĂďůĞƚŝŵĞĞdžƚĞŶƐŝŽŶĞƋƵĂůƚŽƚŚĞĞƐƚŝŵĂƚĞĚĚƵƌĂƚŝŽŶŽĨƚŚĞ&ŽƌĐĞDĂũĞƵƌĞĞǀĞŶƚ͘ ϭϬ͘EŽ/ŶƚĞŶĚĞĚdŚŝƌĚWĂƌƚLJĞŶĞĨŝĐŝĂƌŝĞƐ͘dŚŝƐŐƌĞĞŵĞŶƚŝƐĞŶƚĞƌĞĚŝŶƚŽƐŽůĞůLJĨŽƌƚŚĞďĞŶĞĨŝƚŽĨLJŽƵĂŶĚ ƵƐ͘EŽƚŚŝƌĚƉĂƌƚLJǁŝůůďĞĚĞĞŵĞĚĂďĞŶĞĨŝĐŝĂƌLJŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͕ĂŶĚŶŽƚŚŝƌĚƉĂƌƚLJǁŝůůŚĂǀĞƚŚĞƌŝŐŚƚ ƚŽŵĂŬĞĂŶLJĐůĂŝŵŽƌĂƐƐĞƌƚĂŶLJƌŝŐŚƚƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘dŚŝƐƉƌŽǀŝƐŝŽŶĚŽĞƐŶŽƚĂĨĨĞĐƚƚŚĞƌŝŐŚƚƐŽĨ ƚŚŝƌĚƉĂƌƚŝĞƐƵŶĚĞƌĂŶLJdŚŝƌĚWĂƌƚLJdĞƌŵƐ͘ ϭϭ͘ŶƚŝƌĞŐƌĞĞŵĞŶƚ͖ŵĞŶĚŵĞŶƚ͘dŚŝƐŐƌĞĞŵĞŶƚƌĞƉƌĞƐĞŶƚƐƚŚĞĞŶƚŝƌĞĂŐƌĞĞŵĞŶƚďĞƚǁĞĞŶLJŽƵĂŶĚƵƐ ǁŝƚŚƌĞƐƉĞĐƚƚŽƚŚĞƐƵďũĞĐƚŵĂƚƚĞƌŚĞƌĞŽĨ͕ĂŶĚƐƵƉĞƌƐĞĚĞƐĂŶLJƉƌŝŽƌĂŐƌĞĞŵĞŶƚƐ͕ƵŶĚĞƌƐƚĂŶĚŝŶŐƐ͕ĂŶĚ ƌĞƉƌĞƐĞŶƚĂƚŝŽŶƐ͕ǁŚĞƚŚĞƌǁƌŝƚƚĞŶ͕ŽƌĂů͕ĞdžƉƌĞƐƐĞĚ͕ŝŵƉůŝĞĚ͕ŽƌƐƚĂƚƵƚŽƌLJ͘WƵƌĐŚĂƐĞŽƌĚĞƌƐƐƵďŵŝƚƚĞĚďLJ LJŽƵ͕ŝĨĂŶLJ͕ĂƌĞĨŽƌLJŽƵƌŝŶƚĞƌŶĂůĂĚŵŝŶŝƐƚƌĂƚŝǀĞƉƵƌƉŽƐĞƐŽŶůLJ͕ĂŶĚƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐĐŽŶƚĂŝŶĞĚ ŝŶƚŚŽƐĞƉƵƌĐŚĂƐĞŽƌĚĞƌƐǁŝůůŚĂǀĞŶŽĨŽƌĐĞŽƌĞĨĨĞĐƚ͘dŚŝƐŐƌĞĞŵĞŶƚŵĂLJŽŶůLJďĞŵŽĚŝĨŝĞĚďLJĂǁƌŝƚƚĞŶ ĂŵĞŶĚŵĞŶƚƐŝŐŶĞĚďLJĂŶĂƵƚŚŽƌŝnjĞĚƌĞƉƌĞƐĞŶƚĂƚŝǀĞŽĨĞĂĐŚƉĂƌƚLJ͘ ϭϮ͘^ĞǀĞƌĂďŝůŝƚLJ͘/ĨĂŶLJƚĞƌŵŽƌƉƌŽǀŝƐŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚŝƐŚĞůĚŝŶǀĂůŝĚŽƌƵŶĞŶĨŽƌĐĞĂďůĞ͕ƚŚĞƌĞŵĂŝŶĚĞƌ ŽĨƚŚŝƐŐƌĞĞŵĞŶƚǁŝůůďĞĐŽŶƐŝĚĞƌĞĚǀĂůŝĚĂŶĚĞŶĨŽƌĐĞĂďůĞƚŽƚŚĞĨƵůůĞƐƚĞdžƚĞŶƚƉĞƌŵŝƚƚĞĚďLJůĂǁ͘ ϭϯ͘EŽtĂŝǀĞƌ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐŽĨƚŚŝƐŐƌĞĞŵĞŶƚĂƌĞŶŽƚƐƚƌŝĐƚůLJĞŶĨŽƌĐĞĚďLJ ĞŝƚŚĞƌƉĂƌƚLJ͕ƐƵĐŚŶŽŶͲĞŶĨŽƌĐĞŵĞŶƚǁŝůůŶŽƚĂĐƚĂƐŽƌďĞĚĞĞŵĞĚƚŽĂĐƚĂƐĂǁĂŝǀĞƌŽƌŵŽĚŝĨŝĐĂƚŝŽŶŽĨ ƚŚŝƐŐƌĞĞŵĞŶƚ͕ŶŽƌǁŝůůƐƵĐŚŶŽŶͲĞŶĨŽƌĐĞŵĞŶƚƉƌĞǀĞŶƚƐƵĐŚƉĂƌƚLJĨƌŽŵĞŶĨŽƌĐŝŶŐĞĂĐŚĂŶĚĞǀĞƌLJƚĞƌŵ ŽĨƚŚŝƐŐƌĞĞŵĞŶƚƚŚĞƌĞĂĨƚĞƌ͘ ϭϰ͘/ŶĚĞƉĞŶĚĞŶƚŽŶƚƌĂĐƚŽƌ͘tĞĂƌĞĂŶŝŶĚĞƉĞŶĚĞŶƚĐŽŶƚƌĂĐƚŽƌĨŽƌĂůůƉƵƌƉŽƐĞƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘ ϭϱ͘EŽƚŝĐĞƐ͘ůůŶŽƚŝĐĞƐŽƌĐŽŵŵƵŶŝĐĂƚŝŽŶƐƌĞƋƵŝƌĞĚŽƌƉĞƌŵŝƚƚĞĚĂƐĂƉĂƌƚŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͕ƐƵĐŚĂƐ ŶŽƚŝĐĞŽĨĂŶĂůůĞŐĞĚŵĂƚĞƌŝĂůďƌĞĂĐŚĨŽƌĂƚĞƌŵŝŶĂƚŝŽŶĨŽƌĐĂƵƐĞŽƌĂĚŝƐƉƵƚĞƚŚĂƚŵƵƐƚďĞƐƵďŵŝƚƚĞĚƚŽ ĚŝƐƉƵƚĞƌĞƐŽůƵƚŝŽŶ͕ŵƵƐƚďĞŝŶǁƌŝƚŝŶŐĂŶĚǁŝůůďĞĚĞĞŵĞĚĚĞůŝǀĞƌĞĚƵƉŽŶƚŚĞĞĂƌůŝĞƌŽĨƚŚĞĨŽůůŽǁŝŶŐ͗;ĂͿ ĂĐƚƵĂůƌĞĐĞŝƉƚďLJƚŚĞƌĞĐĞŝǀŝŶŐƉĂƌƚLJ͖;ďͿƵƉŽŶƌĞĐĞŝƉƚďLJƐĞŶĚĞƌŽĨĂĐĞƌƚŝĨŝĞĚŵĂŝů͕ƌĞƚƵƌŶƌĞĐĞŝƉƚƐŝŐŶĞĚ ďLJĂŶĞŵƉůŽLJĞĞŽƌĂŐĞŶƚŽĨƚŚĞƌĞĐĞŝǀŝŶŐƉĂƌƚLJ͖;ĐͿƵƉŽŶƌĞĐĞŝƉƚďLJƐĞŶĚĞƌŽĨƉƌŽŽĨŽĨĞŵĂŝůĚĞůŝǀĞƌLJ͖Žƌ ;ĚͿŝĨŶŽƚĂĐƚƵĂůůLJƌĞĐĞŝǀĞĚ͕ĨŝǀĞ;ϱͿĚĂLJƐĂĨƚĞƌĚĞƉŽƐŝƚǁŝƚŚƚŚĞhŶŝƚĞĚ^ƚĂƚĞƐWŽƐƚĂů^ĞƌǀŝĐĞĂƵƚŚŽƌŝnjĞĚ ŵĂŝůĐĞŶƚĞƌǁŝƚŚƉƌŽƉĞƌƉŽƐƚĂŐĞ;ĐĞƌƚŝĨŝĞĚŵĂŝů͕ƌĞƚƵƌŶƌĞĐĞŝƉƚƌĞƋƵĞƐƚĞĚͿĂĨĨŝdžĞĚĂŶĚĂĚĚƌĞƐƐĞĚƚŽƚŚĞ ŽƚŚĞƌƉĂƌƚLJĂƚƚŚĞĂĚĚƌĞƐƐƐĞƚĨŽƌƚŚŽŶƚŚĞƐŝŐŶĂƚƵƌĞƉĂŐĞŚĞƌĞƚŽŽƌƐƵĐŚŽƚŚĞƌĂĚĚƌĞƐƐĂƐƚŚĞƉĂƌƚLJŵĂLJ ŚĂǀĞĚĞƐŝŐŶĂƚĞĚďLJƉƌŽƉĞƌŶŽƚŝĐĞ͘dŚĞĐŽŶƐĞƋƵĞŶĐĞƐĨŽƌƚŚĞĨĂŝůƵƌĞƚŽƌĞĐĞŝǀĞĂŶŽƚŝĐĞĚƵĞƚŽŝŵƉƌŽƉĞƌ ŶŽƚŝĨŝĐĂƚŝŽŶďLJƚŚĞŝŶƚĞŶĚĞĚƌĞĐĞŝǀŝŶŐƉĂƌƚLJŽĨĂĐŚĂŶŐĞŝŶĂĚĚƌĞƐƐǁŝůůďĞďŽƌŶĞďLJƚŚĞŝŶƚĞŶĚĞĚ ƌĞĐĞŝǀŝŶŐƉĂƌƚLJ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϳ ϭϲ͘ůŝĞŶƚ>ŝƐƚƐ͘zŽƵĂŐƌĞĞƚŚĂƚǁĞŵĂLJŝĚĞŶƚŝĨLJLJŽƵďLJŶĂŵĞŝŶĐůŝĞŶƚůŝƐƚƐ͕ŵĂƌŬĞƚŝŶŐƉƌĞƐĞŶƚĂƚŝŽŶƐ͕ĂŶĚ ƉƌŽŵŽƚŝŽŶĂůŵĂƚĞƌŝĂůƐ͘ ϭϳ͘ŽŶĨŝĚĞŶƚŝĂůŝƚLJ͘ŽƚŚƉĂƌƚŝĞƐƌĞĐŽŐŶŝnjĞƚŚĂƚƚŚĞŝƌƌĞƐƉĞĐƚŝǀĞĞŵƉůŽLJĞĞƐĂŶĚĂŐĞŶƚƐ͕ŝŶƚŚĞĐŽƵƌƐĞŽĨ ƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͕ŵĂLJďĞĞdžƉŽƐĞĚƚŽĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶĂŶĚƚŚĂƚĚŝƐĐůŽƐƵƌĞŽĨƐƵĐŚ ŝŶĨŽƌŵĂƚŝŽŶĐŽƵůĚǀŝŽůĂƚĞƌŝŐŚƚƐƚŽƉƌŝǀĂƚĞŝŶĚŝǀŝĚƵĂůƐĂŶĚĞŶƚŝƚŝĞƐ͕ŝŶĐůƵĚŝŶŐƚŚĞƉĂƌƚŝĞƐ͘ŽŶĨŝĚĞŶƚŝĂů ŝŶĨŽƌŵĂƚŝŽŶŝƐŶŽŶƉƵďůŝĐŝŶĨŽƌŵĂƚŝŽŶƚŚĂƚĂƌĞĂƐŽŶĂďůĞƉĞƌƐŽŶǁŽƵůĚďĞůŝĞǀĞƚŽďĞĐŽŶĨŝĚĞŶƚŝĂůĂŶĚ ŝŶĐůƵĚĞƐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ƉĞƌƐŽŶĂůŝĚĞŶƚŝĨLJŝŶŐŝŶĨŽƌŵĂƚŝŽŶ;Ğ͘Ő͕͘ƐŽĐŝĂůƐĞĐƵƌŝƚLJŶƵŵďĞƌƐͿĂŶĚƚƌĂĚĞ ƐĞĐƌĞƚƐ͕ĞĂĐŚĂƐĚĞĨŝŶĞĚďLJĂƉƉůŝĐĂďůĞƐƚĂƚĞůĂǁ͘ĂĐŚƉĂƌƚLJĂŐƌĞĞƐƚŚĂƚŝƚǁŝůůŶŽƚĚŝƐĐůŽƐĞĂŶLJ ĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶŽĨƚŚĞŽƚŚĞƌƉĂƌƚLJĂŶĚĨƵƌƚŚĞƌĂŐƌĞĞƐƚŽƚĂŬĞĂůůƌĞĂƐŽŶĂďůĞĂŶĚĂƉƉƌŽƉƌŝĂƚĞ ĂĐƚŝŽŶƚŽƉƌĞǀĞŶƚƐƵĐŚĚŝƐĐůŽƐƵƌĞďLJŝƚƐĞŵƉůŽLJĞĞƐŽƌĂŐĞŶƚƐ͘dŚĞĐŽŶĨŝĚĞŶƚŝĂůŝƚLJĐŽǀĞŶĂŶƚƐĐŽŶƚĂŝŶĞĚ ŚĞƌĞŝŶǁŝůůƐƵƌǀŝǀĞƚŚĞƚĞƌŵŝŶĂƚŝŽŶŽƌĐĂŶĐĞůůĂƚŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘dŚŝƐŽďůŝŐĂƚŝŽŶŽĨĐŽŶĨŝĚĞŶƚŝĂůŝƚLJ ǁŝůůŶŽƚĂƉƉůLJƚŽŝŶĨŽƌŵĂƚŝŽŶƚŚĂƚ͗ ;ĂͿŝƐŝŶƚŚĞƉƵďůŝĐĚŽŵĂŝŶ͕ĞŝƚŚĞƌĂƚƚŚĞƚŝŵĞŽĨĚŝƐĐůŽƐƵƌĞŽƌĂĨƚĞƌǁĂƌĚƐ͕ĞdžĐĞƉƚďLJďƌĞĂĐŚŽĨƚŚŝƐ ŐƌĞĞŵĞŶƚďLJĂƉĂƌƚLJŽƌŝƚƐĞŵƉůŽLJĞĞƐŽƌĂŐĞŶƚƐ͖ ;ďͿĂƉĂƌƚLJĐĂŶĞƐƚĂďůŝƐŚďLJƌĞĂƐŽŶĂďůĞƉƌŽŽĨǁĂƐŝŶƚŚĂƚƉĂƌƚLJΖƐƉŽƐƐĞƐƐŝŽŶĂƚƚŚĞƚŝŵĞŽĨŝŶŝƚŝĂů ĚŝƐĐůŽƐƵƌĞ͖ ;ĐͿĂƉĂƌƚLJƌĞĐĞŝǀĞƐĨƌŽŵĂƚŚŝƌĚƉĂƌƚLJǁŚŽŚĂƐĂƌŝŐŚƚƚŽĚŝƐĐůŽƐĞŝƚƚŽƚŚĞƌĞĐĞŝǀŝŶŐƉĂƌƚLJ͖Žƌ ;ĚͿŝƐƚŚĞƐƵďũĞĐƚŽĨĂůĞŐŝƚŝŵĂƚĞĚŝƐĐůŽƐƵƌĞƌĞƋƵĞƐƚƵŶĚĞƌƚŚĞŽƉĞŶƌĞĐŽƌĚƐůĂǁƐŽƌƐŝŵŝůĂƌ ĂƉƉůŝĐĂďůĞƉƵďůŝĐĚŝƐĐůŽƐƵƌĞůĂǁƐŐŽǀĞƌŶŝŶŐƚŚŝƐŐƌĞĞŵĞŶƚ͖ƉƌŽǀŝĚĞĚ͕ŚŽǁĞǀĞƌ͕ƚŚĂƚŝŶƚŚĞ ĞǀĞŶƚLJŽƵƌĞĐĞŝǀĞĂŶŽƉĞŶƌĞĐŽƌĚƐŽƌŽƚŚĞƌƐŝŵŝůĂƌĂƉƉůŝĐĂďůĞƌĞƋƵĞƐƚ͕LJŽƵǁŝůůŐŝǀĞƵƐƉƌŽŵƉƚ ŶŽƚŝĐĞĂŶĚŽƚŚĞƌǁŝƐĞƉĞƌĨŽƌŵƚŚĞĨƵŶĐƚŝŽŶƐƌĞƋƵŝƌĞĚďLJĂƉƉůŝĐĂďůĞůĂǁ͘ ϭϴ͘ƵƐŝŶĞƐƐ>ŝĐĞŶƐĞ͘/ŶƚŚĞĞǀĞŶƚĂůŽĐĂůďƵƐŝŶĞƐƐůŝĐĞŶƐĞŝƐƌĞƋƵŝƌĞĚĨŽƌƵƐƚŽƉĞƌĨŽƌŵƐĞƌǀŝĐĞƐŚĞƌĞƵŶĚĞƌ͕ LJŽƵǁŝůůƉƌŽŵƉƚůLJŶŽƚŝĨLJƵƐĂŶĚƉƌŽǀŝĚĞƵƐǁŝƚŚƚŚĞŶĞĐĞƐƐĂƌLJƉĂƉĞƌǁŽƌŬĂŶĚͬŽƌĐŽŶƚĂĐƚŝŶĨŽƌŵĂƚŝŽŶƐŽ ƚŚĂƚǁĞŵĂLJƚŝŵĞůLJŽďƚĂŝŶƐƵĐŚůŝĐĞŶƐĞ͘ ϭϵ͘'ŽǀĞƌŶŝŶŐ>Ăǁ͘dŚŝƐŐƌĞĞŵĞŶƚǁŝůůďĞŐŽǀĞƌŶĞĚďLJĂŶĚĐŽŶƐƚƌƵĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞůĂǁƐŽĨLJŽƵƌ ƐƚĂƚĞŽĨĚŽŵŝĐŝůĞ͕ǁŝƚŚŽƵƚƌĞŐĂƌĚƚŽŝƚƐƌƵůĞƐŽŶĐŽŶĨůŝĐƚƐŽĨůĂǁ͘ ϮϬ͘DƵůƚŝƉůĞKƌŝŐŝŶĂůƐĂŶĚƵƚŚŽƌŝnjĞĚ^ŝŐŶĂƚƵƌĞƐ͘dŚŝƐŐƌĞĞŵĞŶƚŵĂLJďĞĞdžĞĐƵƚĞĚŝŶŵƵůƚŝƉůĞŽƌŝŐŝŶĂůƐ͕ ĂŶLJŽĨǁŚŝĐŚǁŝůůďĞŝŶĚĞƉĞŶĚĞŶƚůLJƚƌĞĂƚĞĚĂƐĂŶŽƌŝŐŝŶĂůĚŽĐƵŵĞŶƚ͘ŶLJĞůĞĐƚƌŽŶŝĐ͕ĨĂdžĞĚ͕ƐĐĂŶŶĞĚ͕ ƉŚŽƚŽĐŽƉŝĞĚ͕ŽƌƐŝŵŝůĂƌůLJƌĞƉƌŽĚƵĐĞĚƐŝŐŶĂƚƵƌĞŽŶƚŚŝƐŐƌĞĞŵĞŶƚŽƌĂŶLJĂŵĞŶĚŵĞŶƚŚĞƌĞƚŽǁŝůůďĞ ĚĞĞŵĞĚĂŶŽƌŝŐŝŶĂůƐŝŐŶĂƚƵƌĞĂŶĚǁŝůůďĞĨƵůůLJĞŶĨŽƌĐĞĂďůĞĂƐŝĨĂŶŽƌŝŐŝŶĂůƐŝŐŶĂƚƵƌĞ͘ĂĐŚƉĂƌƚLJ ƌĞƉƌĞƐĞŶƚƐƚŽƚŚĞŽƚŚĞƌƚŚĂƚƚŚĞƐŝŐŶĂƚŽƌLJƐĞƚĨŽƌƚŚďĞůŽǁŝƐĚƵůLJĂƵƚŚŽƌŝnjĞĚƚŽďŝŶĚƚŚĂƚƉĂƌƚLJƚŽƚŚŝƐ ŐƌĞĞŵĞŶƚ͘ Ϯϭ͘ŽŽƉĞƌĂƚŝǀĞWƌŽĐƵƌĞŵĞŶƚ͘dŽƚŚĞŵĂdžŝŵƵŵĞdžƚĞŶƚƉĞƌŵŝƚƚĞĚďLJĂƉƉůŝĐĂďůĞůĂǁ͕ǁĞĂŐƌĞĞƚŚĂƚƚŚŝƐ ŐƌĞĞŵĞŶƚŵĂLJďĞƵƐĞĚĂƐĂĐŽŽƉĞƌĂƚŝǀĞƉƌŽĐƵƌĞŵĞŶƚǀĞŚŝĐůĞďLJĞůŝŐŝďůĞũƵƌŝƐĚŝĐƚŝŽŶƐ͘tĞƌĞƐĞƌǀĞƚŚĞ ƌŝŐŚƚƚŽŶĞŐŽƚŝĂƚĞĂŶĚĐƵƐƚŽŵŝnjĞƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐƐĞƚĨŽƌƚŚŚĞƌĞŝŶ͕ŝŶĐůƵĚŝŶŐďƵƚŶŽƚůŝŵŝƚĞĚƚŽ ƉƌŝĐŝŶŐ͕ƚŽƚŚĞƐĐŽƉĞĂŶĚĐŝƌĐƵŵƐƚĂŶĐĞƐŽĨƚŚĂƚĐŽŽƉĞƌĂƚŝǀĞƉƌŽĐƵƌĞŵĞŶƚ͘ ϮϮ͘WĞƌĨŽƌŵĂŶĐĞŽŶĚ͘dLJůĞƌǁŝůůƐĞĐƵƌĞĂƉĞƌĨŽƌŵĂŶĐĞďŽŶĚ;͞ŽŶĚ͟ͿĂŐƌĞĞĂďůĞƚŽďŽƚŚƉĂƌƚŝĞƐǁŝƚŚŝŶƚĞŶ ;ϭϬͿďƵƐŝŶĞƐƐĚĂLJƐĂĨƚĞƌĞdžĞĐƵƚŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚŝŶƚŚĞĨĂĐĞĂŵŽƵŶƚŽĨΨy͘dŚĞĐŽƐƚŽĨƚŚĞŽŶĚ͕ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϴ ĞƋƵĂůƚŽΨz͕ŝƐďĂƐĞĚŽŶƚŚĞƚŽƚĂůĐŽŶƚƌĂĐƚĚŽůůĂƌĂŵŽƵŶƚŽĨƚŚŝƐŐƌĞĞŵĞŶƚĨŽƌĂŶŝŶŝƚŝĂůƚĞƌŵŽĨ ƚǁĞŶƚLJͲĨŽƵƌ;ϮϰͿŵŽŶƚŚƐĂŶĚŝƐƉĂLJĂďůĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞƚĞƌŵƐƐĞƚĨŽƌƚŚŝŶdžŚŝďŝƚ͘ůŝĞŶƚ ĂĐŬŶŽǁůĞĚŐĞƐĂŶĚĂŐƌĞĞƐƚŚĂƚŝƚǁŝůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĂŶLJŝŶĐƌĞĂƐĞŝŶŽŶĚƉƌĞŵŝƵŵƐĚƵƌŝŶŐƚŚĞĨŝƌƐƚ ƚǁŽLJĞĂƌƐŽĨƚŚĞŐƌĞĞŵĞŶƚĐĂƵƐĞĚďLJůŝĞŶƚ͛ƐĞůĞĐƚŝŽŶƚŽŝŶĐƌĞĂƐĞƚŚĞŐƌĞĞŵĞŶƚĂŶĚŽŶĚĚŽůůĂƌ ĂŵŽƵŶƚ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚŝŵƉůĞŵĞŶƚĂƚŝŽŶĂĐƚŝǀŝƚŝĞƐĂƌĞŶŽƚĐŽŵƉůĞƚĞĂĨƚĞƌƚŚĞĞdžƉŝƌĂƚŝŽŶŽĨƚŚĞŝŶŝƚŝĂů ƚǁĞŶƚLJͲĨŽƵƌ;ϮϰͿŵŽŶƚŚƚĞƌŵ͕ůŝĞŶƚŵĂLJĞůĞĐƚƚŽƌĞŶĞǁŽƌĞdžƚĞŶĚƚŚĞƚĞƌŵŽĨƚŚĞƉĞƌĨŽƌŵĂŶĐĞďŽŶĚ͕ ĂŶĚůŝĞŶƚƐŚĂůůďĞƐŽůĞůLJƌĞƐƉŽŶƐŝďůĞĨŽƌƉƌŽǀŝĚŝŶŐƵƐǁŝƚŚŶŽƚŝĐĞĂŶĚĨŽƌĂŶLJĂĚĚŝƚŝŽŶĂůďŽŶĚƉƌĞŵŝƵŵƐ͘ ůůďŽŶĚƌĞŶĞǁĂůƐƐŚĂůůďĞƐƵďũĞĐƚƚŽƵŶĚĞƌǁƌŝƚŝŶŐŽƌƐƵƌĞƚLJĂƉƉƌŽǀĂů͘ Ϯϯ͘ŽŶƚƌĂĐƚŽĐƵŵĞŶƚƐ͘dŚŝƐŐƌĞĞŵĞŶƚŝŶĐůƵĚĞƐƚŚĞĨŽůůŽǁŝŶŐĞdžŚŝďŝƚƐ͗ džŚŝďŝƚ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ džŚŝďŝƚ /ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ ^ĐŚĞĚƵůĞϭ͗ƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJ džŚŝďŝƚ DĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚ ^ĐŚĞĚƵůĞϭ͗^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ džŚŝďŝƚ dŚŝƌĚWĂƌƚLJdĞƌŵƐ džŚŝďŝƚ ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬ /Et/dE^^t,ZK&͕ĂĚƵůLJĂƵƚŚŽƌŝnjĞĚƌĞƉƌĞƐĞŶƚĂƚŝǀĞŽĨĞĂĐŚƉĂƌƚLJŚĂƐĞdžĞĐƵƚĞĚƚŚŝƐŐƌĞĞŵĞŶƚĂƐŽĨ ƚŚĞĚĂƚĞ;ƐͿƐĞƚĨŽƌƚŚďĞůŽǁ͘ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘/E^Zd>/EdED LJ͗LJ͗ EĂŵĞ͗EĂŵĞ͗ dŝƚůĞ͗dŝƚůĞ͗ ĂƚĞ͗ĂƚĞ͗ ĚĚƌĞƐƐĨŽƌEŽƚŝĐĞƐ͗ĚĚƌĞƐƐĨŽƌEŽƚŝĐĞƐ͗ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ /E^Zd>/EdED KŶĞdLJůĞƌƌŝǀĞ /E^Zd>/EdZ^^ zĂƌŵŽƵƚŚ͕DϬϰϬϵϲ /E^Zd>/EdZ^^ ƚƚĞŶƚŝŽŶ͗ŚŝĞĨ>ĞŐĂůKĨĨŝĐĞƌ ƚƚĞŶƚŝŽŶ͗ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϯϵ džŚŝďŝƚ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ dŚĞĨŽůůŽǁŝŶŐ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĚĞƚĂŝůƐƚŚĞƐŽĨƚǁĂƌĞ͕ƉƌŽĚƵĐƚƐ͕ĂŶĚƐĞƌǀŝĐĞƐƚŽďĞĚĞůŝǀĞƌĞĚďLJƵƐƚŽLJŽƵ ƵŶĚĞƌƚŚĞŐƌĞĞŵĞŶƚ͘dŚŝƐ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJŝƐĞĨĨĞĐƚŝǀĞĂƐŽĨƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘ĂƉŝƚĂůŝnjĞĚƚĞƌŵƐŶŽƚ ŽƚŚĞƌǁŝƐĞĚĞĨŝŶĞĚǁŝůůŚĂǀĞƚŚĞŵĞĂŶŝŶŐĂƐƐŝŐŶĞĚƚŽƐƵĐŚƚĞƌŵƐŝŶƚŚĞŐƌĞĞŵĞŶƚ͘ dLJůĞƌƐĂůĞƐƋƵŽƚĂƚŝŽŶƚŽďĞŝŶƐĞƌƚĞĚƉƌŝŽƌƚŽŐƌĞĞŵĞŶƚĞdžĞĐƵƚŝŽŶ͘ ZD/EZK&W'/EdEd/KE>>z>&d>E< ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϬ džŚŝďŝƚ /ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ tĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚƚŚĞƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ĂƉŝƚĂůŝnjĞĚƚĞƌŵƐ ŶŽƚŽƚŚĞƌǁŝƐĞĚĞĨŝŶĞĚǁŝůůŚĂǀĞƚŚĞŵĞĂŶŝŶŐĂƐƐŝŐŶĞĚƚŽƐƵĐŚƚĞƌŵƐŝŶƚŚĞŐƌĞĞŵĞŶƚ͘ /ŶǀŽŝĐŝŶŐ͗tĞǁŝůůŝŶǀŽŝĐĞLJŽƵĨŽƌƚŚĞĂƉƉůŝĐĂďůĞůŝĐĞŶƐĞĂŶĚƐĞƌǀŝĐĞƐĨĞĞƐŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂƐƐĞƚ ĨŽƌƚŚďĞůŽǁ͘zŽƵƌƌŝŐŚƚƐƚŽĚŝƐƉƵƚĞĂŶLJŝŶǀŽŝĐĞĂƌĞƐĞƚĨŽƌƚŚŝŶƚŚĞŐƌĞĞŵĞŶƚ͘ ϭ͘dLJůĞƌ^ŽĨƚǁĂƌĞ͘ ϭ͘ϭ>ŝĐĞŶƐĞ&ĞĞƐ͗>ŝĐĞŶƐĞĨĞĞƐĂƌĞŝŶǀŽŝĐĞĚĂƐĨŽůůŽǁƐ͗;ĂͿϮϱйŽŶƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͖;ďͿϲϬйŽŶƚŚĞ ĚĂƚĞǁŚĞŶǁĞŵĂŬĞƚŚĞĂƉƉůŝĐĂďůĞdLJůĞƌ^ŽĨƚǁĂƌĞĂǀĂŝůĂďůĞƚŽLJŽƵĨŽƌĚŽǁŶůŽĂĚŝŶŐ;ƚŚĞ ͞ǀĂŝůĂďůĞŽǁŶůŽĂĚĂƚĞ͟Ϳ͖ĂŶĚ;ĐͿϭϱйŽŶƚŚĞĞĂƌůŝĞƌŽĨƵƐĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝŶůŝǀĞ ƉƌŽĚƵĐƚŝŽŶŽƌϭϴϬĚĂLJƐĂĨƚĞƌƚŚĞǀĂŝůĂďůĞŽǁŶůŽĂĚĂƚĞ͘ ϭ͘ϮDĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚ&ĞĞƐ͗zĞĂƌϭŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐĂƌĞǁĂŝǀĞĚƚŚƌŽƵŐŚƚŚĞ ĞĂƌůŝĞƌŽĨ;ĂͿĂǀĂŝůĂďŝůŝƚLJŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĨŽƌƵƐĞŝŶĂůŝǀĞƉƌŽĚƵĐƚŝŽŶĞŶǀŝƌŽŶŵĞŶƚ͖Žƌ;ďͿ ŽŶĞ;ϭͿLJĞĂƌĨƌŽŵƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘zĞĂƌϮŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐ͕ĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚ ƌĂƚĞƐ͕ĂƌĞƉĂLJĂďůĞŽŶƚŚĂƚĞĂƌůŝĞƌͲŽĨĚĂƚĞ͕ĂŶĚƐƵďƐĞƋƵĞŶƚŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐĂƌĞ ŝŶǀŽŝĐĞĚĂŶŶƵĂůůLJŝŶĂĚǀĂŶĐĞŽĨĞĂĐŚĂŶŶŝǀĞƌƐĂƌLJƚŚĞƌĞŽĨ͘zŽƵƌĨĞĞƐĨŽƌĞĂĐŚƐƵďƐĞƋƵĞŶƚLJĞĂƌ ǁŝůůďĞƐĞƚĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚƌĂƚĞƐ͘ ϭ͘ϯ^ƵďƐĐƌŝƉƚŝŽŶ&ĞĞƐ͗zŽƵƌŝŶŝƚŝĂůƐƵďƐĐƌŝƉƚŝŽŶĨĞĞƐĨŽƌWŽƐƚĂůyƉƌĞƐƐ͕dLJůĞƌdƌĂŶƐƉĂƌĞŶĐLJĂŶĚdLJůĞƌ EŽƚŝĨLJĂƌĞŝŶǀŽŝĐĞĚǁŚĞŶǁĞŵĂŬĞƚŚĞƉƌŽĚƵĐƚĂǀĂŝůĂďůĞƚŽLJŽƵ͘^ƵďƐĞƋƵĞŶƚƐƵďƐĐƌŝƉƚŝŽŶĨĞĞƐ ĂƌĞĚƵĞĂŶŶƵĂůůLJŝŶĂĚǀĂŶĐĞŽŶƚŚĞĂŶŶŝǀĞƌƐĂƌLJŽĨƚŚĂƚĚĂƚĞĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚƌĂƚĞƐ͘ Ϯ͘WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ͘ Ϯ͘ϭ/ŵƉůĞŵĞŶƚĂƚŝŽŶĂŶĚKƚŚĞƌWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ;ŝŶĐůƵĚŝŶŐƚƌĂŝŶŝŶŐͿ͗/ŵƉůĞŵĞŶƚĂƚŝŽŶĂŶĚŽƚŚĞƌ ƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐ;ŝŶĐůƵĚŝŶŐƚƌĂŝŶŝŶŐͿĂƌĞďŝůůĞĚĂŶĚŝŶǀŽŝĐĞĚĂƐĚĞůŝǀĞƌĞĚ͕ĂƚƚŚĞƌĂƚĞƐƐĞƚ ĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ Ϯ͘ϮŽŶƐƵůƚŝŶŐ^ĞƌǀŝĐĞƐ͗/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚĂŶLJƵƐŝŶĞƐƐWƌŽĐĞƐƐŽŶƐƵůƚŝŶŐƐĞƌǀŝĐĞƐ͕ŝĨƚŚĞLJŚĂǀĞ ďĞĞŶƋƵŽƚĞĚĂƐĨŝdžĞĚͲĨĞĞƐĞƌǀŝĐĞƐ͕ƚŚĞLJǁŝůůďĞŝŶǀŽŝĐĞĚϱϬйƵƉŽŶĚĞůŝǀĞƌLJŽĨƚŚĞĞƐƚWƌĂĐƚŝĐĞ ZĞĐŽŵŵĞŶĚĂƚŝŽŶƐ͕ďLJŵŽĚƵůĞ͕ĂŶĚϱϬйƵƉŽŶĚĞůŝǀĞƌLJŽĨĐƵƐƚŽŵĚĞƐŬƚŽƉƉƌŽĐĞĚƵƌĞƐ͕ďLJ ŵŽĚƵůĞ͘/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚĂŶLJƵƐŝŶĞƐƐWƌŽĐĞƐƐŽŶƐƵůƚŝŶŐƐĞƌǀŝĐĞƐĂŶĚƚŚĞLJĂƌĞƋƵŽƚĞĚĂƐ ĂŶĞƐƚŝŵĂƚĞ͕ƚŚĞŶǁĞǁŝůůďŝůůLJŽƵƚŚĞĂĐƚƵĂůƐĞƌǀŝĐĞƐĚĞůŝǀĞƌĞĚŽŶĂƚŝŵĞĂŶĚŵĂƚĞƌŝĂůƐďĂƐŝƐ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϭ Ϯ͘ϯŽŶǀĞƌƐŝŽŶƐ͗&ŝdžĞĚͲĨĞĞĐŽŶǀĞƌƐŝŽŶƐĂƌĞŝŶǀŽŝĐĞĚϱϬйƵƉŽŶŝŶŝƚŝĂůĚĞůŝǀĞƌLJŽĨƚŚĞĐŽŶǀĞƌƚĞĚĚĂƚĂ͕ ďLJĐŽŶǀĞƌƐŝŽŶŽƉƚŝŽŶ͕ĂŶĚϱϬйƵƉŽŶůŝĞŶƚĂĐĐĞƉƚĂŶĐĞƚŽůŽĂĚƚŚĞĐŽŶǀĞƌƚĞĚĚĂƚĂŝŶƚŽ >ŝǀĞͬWƌŽĚƵĐƚŝŽŶĞŶǀŝƌŽŶŵĞŶƚ͕ďLJĐŽŶǀĞƌƐŝŽŶŽƉƚŝŽŶ͘tŚĞƌĞĐŽŶǀĞƌƐŝŽŶƐĂƌĞƋƵŽƚĞĚĂƐ ĞƐƚŝŵĂƚĞĚ͕ǁĞǁŝůůďŝůůLJŽƵƚŚĞĂĐƚƵĂůƐĞƌǀŝĐĞƐĚĞůŝǀĞƌĞĚŽŶĂƚŝŵĞĂŶĚŵĂƚĞƌŝĂůƐďĂƐŝƐ͘ Ϯ͘ϰZĞƋƵĞƐƚĞĚDŽĚŝĨŝĐĂƚŝŽŶƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͗ZĞƋƵĞƐƚĞĚŵŽĚŝĨŝĐĂƚŝŽŶƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ ĂƌĞŝŶǀŽŝĐĞĚϱϬйƵƉŽŶĚĞůŝǀĞƌLJŽĨƐƉĞĐŝĨŝĐĂƚŝŽŶƐĂŶĚϱϬйƵƉŽŶĚĞůŝǀĞƌLJŽĨƚŚĞĂƉƉůŝĐĂďůĞ ŵŽĚŝĨŝĐĂƚŝŽŶ͘zŽƵŵƵƐƚƌĞƉŽƌƚĂŶLJĨĂŝůƵƌĞŽĨƚŚĞŵŽĚŝĨŝĐĂƚŝŽŶƚŽĐŽŶĨŽƌŵƚŽƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐ ǁŝƚŚŝŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨĚĞůŝǀĞƌLJ͖ŽƚŚĞƌǁŝƐĞ͕ƚŚĞŵŽĚŝĨŝĐĂƚŝŽŶǁŝůůďĞĚĞĞŵĞĚƚŽďĞŝŶ ĐŽŵƉůŝĂŶĐĞǁŝƚŚƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐĂĨƚĞƌƚŚĞϯϬͲĚĂLJǁŝŶĚŽǁŚĂƐƉĂƐƐĞĚ͘zŽƵŵĂLJƐƚŝůůƌĞƉŽƌƚ ĞĨĞĐƚƐƚŽƵƐĂƐƐĞƚĨŽƌƚŚŝŶƚŚĞDĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚ͘ Ϯ͘ϱKƚŚĞƌ&ŝdžĞĚWƌŝĐĞ^ĞƌǀŝĐĞƐ͗džĐĞƉƚĂƐŽƚŚĞƌǁŝƐĞƉƌŽǀŝĚĞĚ͕ŽƚŚĞƌĨŝdžĞĚƉƌŝĐĞƐĞƌǀŝĐĞƐĂƌĞŝŶǀŽŝĐĞĚ ĂƐĚĞůŝǀĞƌĞĚ͕ĂƚƚŚĞƌĂƚĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘&ŽƌƚŚĞĂǀŽŝĚĂŶĐĞŽĨĚŽƵďƚ͕ ǁŚĞƌĞ͞WƌŽũĞĐƚWůĂŶŶŝŶŐ^ĞƌǀŝĐĞƐ͟ĂƌĞƉƌŽǀŝĚĞĚ͕ƉĂLJŵĞŶƚǁŝůůďĞĚƵĞƵƉŽŶĚĞůŝǀĞƌLJŽĨƚŚĞ /ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶŶŝŶŐĚŽĐƵŵĞŶƚ͘ ĞĚŝĐĂƚĞĚWƌŽũĞĐƚDĂŶĂŐĞŵĞŶƚƐĞƌǀŝĐĞƐ͕ŝĨĂŶLJ͕ǁŝůůďĞďŝůůĞĚŵŽŶƚŚůLJŝŶĂƌƌĞĂƌƐ͕ďĞŐŝŶŶŝŶŐŽŶ ƚŚĞĨŝƌƐƚĚĂLJŽĨƚŚĞŵŽŶƚŚŝŵŵĞĚŝĂƚĞůLJĨŽůůŽǁŝŶŐŝŶŝƚŝĂƚŝŽŶŽĨƉƌŽũĞĐƚƉůĂŶŶŝŶŐ͘ ŚĂŶŐĞDĂŶĂŐĞŵĞŶƚ^ĞƌǀŝĐĞƐ͗/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚĂŶLJĐŚĂŶŐĞŵĂŶĂŐĞŵĞŶƚƐĞƌǀŝĐĞƐ͕ƚŚŽƐĞ ƐĞƌǀŝĐĞƐǁŝůůďĞŝŶǀŽŝĐĞĚŝŶƚŚĞĨŽůůŽǁŝŶŐĂŵŽƵŶƚƐĂŶĚƵƉŽŶƚŚĞ ĨŽůůŽǁŝŶŐŵŝůĞƐƚŽŶĞƐ͗ ĐĐĞƉƚĂŶĐĞŽĨŚĂŶŐĞDĂŶĂŐĞŵĞŶƚŝƐĐŽǀĞƌLJŶĂůLJƐŝƐϭϱй ĞůŝǀĞƌLJŽĨŚĂŶŐĞDĂŶĂŐĞŵĞŶƚWůĂŶĂŶĚ^ƚƌĂƚĞŐLJWƌĞƐĞŶƚĂƚŝŽŶϭϬй ĐĐĞƉƚĂŶĐĞŽĨdžĞĐƵƚŝǀĞWůĂLJŬϭϱй ĐĐĞƉƚĂŶĐĞŽĨZĞƐŝƐƚĂŶĐĞDĂŶĂŐĞŵĞŶƚWůĂŶϭϱй ĐĐĞƉƚĂŶĐĞŽĨWƌŽĐĞĚƵƌĂůŚĂŶŐĞŽŵŵƵŶŝĐĂƚŝŽŶƐWůĂŶϭϬй ŚĂŶŐĞDĂŶĂŐĞŵĞŶƚŽĂĐŚdƌĂŝŶŝŶŐϮϬй ŚĂŶŐĞDĂŶĂŐĞŵĞŶƚĨƚĞƌͲĐƚŝŽŶZĞǀŝĞǁϭϱй ϯ͘KƚŚĞƌ^ĞƌǀŝĐĞƐĂŶĚ&ĞĞƐ͘/ŶĐůƵĚĞĂƐĂƉƉůŝĐĂďůĞ ϯ͘ϭ^LJƐƚĞŵƐDĂŶĂŐĞŵĞŶƚ͗^LJƐƚĞŵƐDĂŶĂŐĞŵĞŶƚ^ĞƌǀŝĐĞƐĂƌĞŝŶǀŽŝĐĞĚŽŶƚŚĞǀĂŝůĂďůĞŽǁŶůŽĂĚ ĂƚĞĂŶĚĂƌĞƉƌŽǀŝĚĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞŐƌĞĞŵĞŶƚĨŽƌdLJůĞƌ^LJƐƚĞŵƐDĂŶĂŐĞŵĞŶƚ ĂƚƚĂĐŚĞĚƚŽƚŚŝƐŐƌĞĞŵĞŶƚĂƐdžŚŝďŝƚͺͺͺ͘^LJƐƚĞŵƐDĂŶĂŐĞŵĞŶƚ^ĞƌǀŝĐĞƐǁŝůůƌĞŶĞǁ ĂƵƚŽŵĂƚŝĐĂůůLJĨŽƌĂĚĚŝƚŝŽŶĂůŽŶĞ;ϭͿLJĞĂƌƚĞƌŵƐĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚ^LJƐƚĞŵƐDĂŶĂŐĞŵĞŶƚ ^ĞƌǀŝĐĞƐĨĞĞ͕ƵŶůĞƐƐƚĞƌŵŝŶĂƚĞĚŝŶǁƌŝƚŝŶŐďLJĞŝƚŚĞƌƉĂƌƚLJĂƚůĞĂƐƚƚŚŝƌƚLJ;ϯϬͿĚĂLJƐƉƌŝŽƌƚŽƚŚĞĞŶĚ ŽĨƚŚĞƚŚĞŶͲĐƵƌƌĞŶƚƚĞƌŵ͘ ϯ͘ϮŝƐĂƐƚĞƌZĞĐŽǀĞƌLJ^ĞƌǀŝĐĞƐ͗ŝƐĂƐƚĞƌZĞĐŽǀĞƌLJ^ĞƌǀŝĐĞƐĂƌĞŝŶǀŽŝĐĞĚĂŶŶƵĂůůLJŝŶĂĚǀĂŶĐĞƵƉŽŶ ŽƵƌƌĞĐĞŝƉƚŽĨLJŽƵƌĚĂƚĂ͘ŝƐĂƐƚĞƌZĞĐŽǀĞƌLJƐĞƌǀŝĐĞƐǁŝůůďĞƉƌŽǀŝĚĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞ ƚĞƌŵƐŽĨŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚŝƐĂƐƚĞƌZĞĐŽǀĞƌLJŐƌĞĞŵĞŶƚĂŶĚǁŝůůƌĞŶĞǁĂƵƚŽŵĂƚŝĐĂůůLJĨŽƌ ĂĚĚŝƚŝŽŶĂůŽŶĞ;ϭͿLJĞĂƌƚĞƌŵƐĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚŝƐĂƐƚĞƌZĞĐŽǀĞƌLJĨĞĞ͕ƵŶůĞƐƐƚĞƌŵŝŶĂƚĞĚŝŶ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϮ ǁƌŝƚŝŶŐďLJĞŝƚŚĞƌƉĂƌƚLJĂƚůĞĂƐƚƚŚŝƌƚLJ;ϯϬͿĚĂLJƐƉƌŝŽƌƚŽƚŚĞĞŶĚŽĨƚŚĞƚŚĞŶͲĐƵƌƌĞŶƚƚĞƌŵ͘KƵƌ ĐƵƌƌĞŶƚŝƐĂƐƚĞƌZĞĐŽǀĞƌLJŐƌĞĞŵĞŶƚŝƐĂƚƚĂĐŚĞĚƚŽƚŚŝƐŐƌĞĞŵĞŶƚĂƐdžŚŝďŝƚͺͺͺ͘ ϯ͘ϯWĂLJƌŽůůdĂdždĂďůĞhƉĚĂƚĞ&ĞĞ͗dŚĞĨŝƌƐƚLJĞĂƌWĂLJƌŽůůdĂdždĂďůĞhƉĚĂƚĞ&ĞĞĨŽƌƚŚĞŽŶĞͲLJĞĂƌ ƉĞƌŝŽĚĐŽŵŵĞŶĐŝŶŐŽŶƚŚĞǀĂŝůĂďůĞŽǁŶůŽĂĚĂƚĞŝƐǁĂŝǀĞĚ͘^ƵďƐĞƋƵĞŶƚĂŶŶƵĂůWĂLJƌŽůůdĂdž dĂďůĞhƉĚĂƚĞĨĞĞƐǁŝůůďĞĚƵĞŽŶƚŚĞĂŶŶŝǀĞƌƐĂƌLJŽĨƚŚĞǀĂŝůĂďůĞŽǁŶůŽĂĚĂƚĞ͘ŶŶƵĂů WĂLJƌŽůůdĂdždĂďůĞhƉĚĂƚĞƐĞƌǀŝĐĞƐǁŝůůƌĞŶĞǁĂƵƚŽŵĂƚŝĐĂůůLJĨŽƌĂĚĚŝƚŝŽŶĂůŽŶĞͲLJĞĂƌƚĞƌŵƐĂƚŽƵƌ ƚŚĞŶͲĐƵƌƌĞŶƚŶŶƵĂůWĂLJƌŽůůdĂdždĂďůĞhƉĚĂƚĞƐĞƌǀŝĐĞĨĞĞ͕ƵŶůĞƐƐƚĞƌŵŝŶĂƚĞĚŝŶǁƌŝƚŝŶŐďLJĞŝƚŚĞƌ ƉĂƌƚLJĂƚůĞĂƐƚƚŚŝƌƚLJ;ϯϬͿĚĂLJƐƉƌŝŽƌƚŽƚŚĞĞŶĚŽĨƚŚĞƚŚĞŶͲĐƵƌƌĞŶƚƚĞƌŵ͘ ϯ͘ϰWĞƌĨŽƌŵĂŶĐĞŽŶĚ͗tĞǁŝůůŝŶǀŽŝĐĞLJŽƵƚŚĞĨĞĞƐĨŽƌƚŚĞƉĞƌĨŽƌŵĂŶĐĞďŽŶĚ͕ƐĞƚĨŽƌƚŚŝŶƚŚĞ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͕ǁŝƚŚŝŶƚĞŶ;ϭϬͿĚĂLJƐŽĨƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘ ϯ͘ϱƌĂnjŽƐ,ŽƐƚŝŶŐ&ĞĞƐ͗,ŽƐƚŝŶŐĨĞĞƐĨŽƌƚŚĞƌĂnjŽƐƐŽĨƚǁĂƌĞĂƌĞŝŶǀŽŝĐĞĚĂŶŶƵĂůůLJŝŶĂĚǀĂŶĐĞ͕ ďĞŐŝŶŶŝŶŐŽŶƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘zĞĂƌϭĨĞĞƐĂƌĞĂƚƚŚĞƌĂƚĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJ͘^ƵďƐĞƋƵĞŶƚĂŶŶƵĂůĨĞĞƐǁŝůůďĞĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚƌĂƚĞƐ͘ ϯ͘ϲŶŶƵĂů&ĞĞƐ͗ŶŶƵĂůĨĞĞƐĨŽƌƚŚĞdLJůĞƌ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ ĂƌĞŝŶǀŽŝĐĞĚŽŶƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘^ƵďƐĞƋƵĞŶƚĨĞĞƐĂƌĞĚƵĞĂŶŶƵĂůůLJŝŶĂĚǀĂŶĐĞŽĨĞĂĐŚ ĂŶŶŝǀĞƌƐĂƌLJƚŚĞƌĞŽĨĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚƌĂƚĞƐ͘ ϰ͘dŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘ ϰ͘ϭdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ>ŝĐĞŶƐĞ&ĞĞƐ͗>ŝĐĞŶƐĞĨĞĞƐĨŽƌdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͕ŝĨĂŶLJ͕ĂƌĞŝŶǀŽŝĐĞĚ ǁŚĞŶǁĞŵĂŬĞŝƚĂǀĂŝůĂďůĞƚŽLJŽƵĨŽƌĚŽǁŶůŽĂĚŝŶŐ͘ ϰ͘ϮdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞDĂŝŶƚĞŶĂŶĐĞ͗dŚĞĨŝƌƐƚLJĞĂƌŵĂŝŶƚĞŶĂŶĐĞĨĞĞƐĨŽƌƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͕ ŝĨĂŶLJ͕ŝƐŝŶǀŽŝĐĞĚǁŚĞŶǁĞŵĂŬĞƚŚĂƚdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞĂǀĂŝůĂďůĞƚŽLJŽƵĨŽƌĚŽǁŶůŽĂĚŝŶŐ͘ ϰ͘ϯdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͗dŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞĐŽƐƚƐ͕ŝĨĂŶLJ͕ĂƌĞŝŶǀŽŝĐĞĚƵƉŽŶĚĞůŝǀĞƌLJ͘ ϰ͘ϰdŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͗&ĞĞƐĨŽƌdŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͕ŝĨĂŶLJ͕ĂƌĞŝŶǀŽŝĐĞĚĂƐĚĞůŝǀĞƌĞĚ͕ĂůŽŶŐǁŝƚŚ ĂƉƉůŝĐĂďůĞĞdžƉĞŶƐĞƐ͕ĂƚƚŚĞƌĂƚĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ ϰ͘ϱdLJůĞƌEŽƚŝĨLJDŝŶƵƚĞƐĂŶĚDĞƐƐĂŐĞƐ͗dLJůĞƌEŽƚŝĨLJDŝŶƵƚĞƐĂŶĚDĞƐƐĂŐĞƐĂƌĞŝŶǀŽŝĐĞĚǁŚĞŶǁĞ ŵĂŬĞdLJůĞƌEŽƚŝĨLJĂǀĂŝůĂďůĞƚŽLJŽƵ͘^ƵďƐĞƋƵĞŶƚĨĞĞƐĨŽƌŵŝŶƵƚĞƐĂŶĚŵĞƐƐĂŐĞƐ͕ĂƚŽƵƌƚŚĞŶͲ ĐƵƌƌĞŶƚƌĂƚĞƐ͕ǁŝůůďĞĚƵĞǁŚĞŶLJŽƵƌĞƋƵĞƐƚĂĚĚŝƚŝŽŶĂůŵŝŶƵƚĞƐĂŶĚŵĞƐƐĂŐĞƐĂŶĚƚŚĞLJĂƌĞ ŵĂĚĞĂǀĂŝůĂďůĞƚŽLJŽƵ͘ ϱ͘džƉĞŶƐĞƐ͘dŚĞƐĞƌǀŝĐĞƌĂƚĞƐŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĚŽŶŽƚŝŶĐůƵĚĞƚƌĂǀĞůĞdžƉĞŶƐĞƐ͘džƉĞŶƐĞƐ ĨŽƌdLJůĞƌĚĞůŝǀĞƌĞĚƐĞƌǀŝĐĞƐǁŝůůďĞďŝůůĞĚĂƐŝŶĐƵƌƌĞĚĂŶĚŽŶůLJŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚ ƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJ͕ƉůƵƐĂϭϬйƚƌĂǀĞůĂŐĞŶĐLJƉƌŽĐĞƐƐŝŶŐĨĞĞ͘KƵƌĐƵƌƌĞŶƚƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJŝƐ ĂƚƚĂĐŚĞĚƚŽƚŚŝƐdžŚŝďŝƚĂƚ^ĐŚĞĚƵůĞϭ͘ŽƉŝĞƐŽĨƌĞĐĞŝƉƚƐǁŝůůďĞƉƌŽǀŝĚĞĚƵƉŽŶƌĞƋƵĞƐƚ͖ǁĞ ƌĞƐĞƌǀĞƚŚĞƌŝŐŚƚƚŽĐŚĂƌŐĞLJŽƵĂŶĂĚŵŝŶŝƐƚƌĂƚŝǀĞĨĞĞĚĞƉĞŶĚŝŶŐŽŶƚŚĞĞdžƚĞŶƚŽĨLJŽƵƌƌĞƋƵĞƐƚƐ͘ ZĞĐĞŝƉƚƐĨŽƌŵŝƐĐĞůůĂŶĞŽƵƐŝƚĞŵƐůĞƐƐƚŚĂŶƚǁĞŶƚLJͲĨŝǀĞĚŽůůĂƌƐĂŶĚŵŝůĞĂŐĞůŽŐƐĂƌĞŶŽƚĂǀĂŝůĂďůĞ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϯ WĂLJŵĞŶƚ͘WĂLJŵĞŶƚĨŽƌƵŶĚŝƐƉƵƚĞĚŝŶǀŽŝĐĞƐŝƐĚƵĞǁŝƚŚŝŶĨŽƌƚLJͲĨŝǀĞ;ϰϱͿĚĂLJƐŽĨƚŚĞŝŶǀŽŝĐĞĚĂƚĞ͘tĞƉƌĞĨĞƌ ƚŽƌĞĐĞŝǀĞƉĂLJŵĞŶƚƐĞůĞĐƚƌŽŶŝĐĂůůLJ͘KƵƌĞůĞĐƚƌŽŶŝĐƉĂLJŵĞŶƚŝŶĨŽƌŵĂƚŝŽŶŝƐĂǀĂŝůĂďůĞďLJĐŽŶƚĂĐƚŝŶŐ ZΛƚLJůĞƌƚĞĐŚ͘ĐŽŵ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϰ džŚŝďŝƚ ^ĐŚĞĚƵůĞϭ ƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJ ϭ͘ŝƌdƌĂǀĞů ͘ZĞƐĞƌǀĂƚŝŽŶƐΘdŝĐŬĞƚƐ dŚĞdƌĂǀĞůDĂŶĂŐĞŵĞŶƚŽŵƉĂŶLJ;dDͿƵƐĞĚďLJdLJůĞƌǁŝůůƉƌŽǀŝĚĞĂŶĞŵƉůŽLJĞĞǁŝƚŚĂĚŝƌĞĐƚĨůŝŐŚƚ ǁŝƚŚŝŶƚǁŽŚŽƵƌƐďĞĨŽƌĞŽƌĂĨƚĞƌƚŚĞƌĞƋƵĞƐƚĞĚĚĞƉĂƌƚƵƌĞƚŝŵĞ͕ĂƐƐƵŵŝŶŐƚŚĂƚĨůŝŐŚƚĚŽĞƐŶŽƚĂĚĚŵŽƌĞ ƚŚĂŶƚŚƌĞĞŚŽƵƌƐƚŽƚŚĞĞŵƉůŽLJĞĞ͛ƐƚŽƚĂůƚƌŝƉĚƵƌĂƚŝŽŶĂŶĚƚŚĞĨĂƌĞŝƐǁŝƚŚŝŶΨϭϬϬ;ĞĂĐŚǁĂLJͿŽĨƚŚĞ ůŽǁĞƐƚůŽŐŝĐĂůĨĂƌĞ͘/ĨĂŶĞƚƐĂǀŝŶŐƐŽĨΨϮϬϬŽƌŵŽƌĞ;ĞĂĐŚǁĂLJͿŝƐƉŽƐƐŝďůĞƚŚƌŽƵŐŚĂĐŽŶŶĞĐƚŝŶŐĨůŝŐŚƚ ƚŚĂƚŝƐǁŝƚŚŝŶƚǁŽŚŽƵƌƐďĞĨŽƌĞŽƌĂĨƚĞƌƚŚĞƌĞƋƵĞƐƚĞĚĚĞƉĂƌƚƵƌĞƚŝŵĞĂŶĚƚŚĂƚĚŽĞƐŶŽƚĂĚĚŵŽƌĞƚŚĂŶ ƚŚƌĞĞŚŽƵƌƐƚŽƚŚĞĞŵƉůŽLJĞĞ͛ƐƚŽƚĂůƚƌŝƉĚƵƌĂƚŝŽŶ͕ƚŚĞĐŽŶŶĞĐƚŝŶŐĨůŝŐŚƚƐŚŽƵůĚďĞĂĐĐĞƉƚĞĚ͘ ŵƉůŽLJĞĞƐĂƌĞĞŶĐŽƵƌĂŐĞĚƚŽŵĂŬĞĂĚǀĂŶĐĞĚƌĞƐĞƌǀĂƚŝŽŶƐƚŽƚĂŬĞĨƵůůĂĚǀĂŶƚĂŐĞŽĨĚŝƐĐŽƵŶƚ ŽƉƉŽƌƚƵŶŝƚŝĞƐ͘ŵƉůŽLJĞĞƐƐŚŽƵůĚƵƐĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽŵĂŬĞƚƌĂǀĞůĂƌƌĂŶŐĞŵĞŶƚƐĂƚůĞĂƐƚƚǁŽ;ϮͿ ǁĞĞŬƐŝŶĂĚǀĂŶĐĞŽĨĐŽŵŵŝƚŵĞŶƚƐ͘ƐĞǀĞŶ;ϳͿĚĂLJĂĚǀĂŶĐĞŬŝŶŐƌĞƋƵŝƌĞŵĞŶƚŝƐŵĂŶĚĂƚŽƌLJ͘tŚĞŶ ŬŝŶŐůĞƐƐƚŚĂŶƐĞǀĞŶ;ϳͿĚĂLJƐŝŶĂĚǀĂŶĐĞ͕ŵĂŶĂŐĞŵĞŶƚĂƉƉƌŽǀĂůǁŝůůďĞƌĞƋƵŝƌĞĚ͘ džĐĞƉƚŝŶƚŚĞĐĂƐĞŽĨŝŶƚĞƌŶĂƚŝŽŶĂůƚƌĂǀĞůǁŚĞƌĞĂƐĞŐŵĞŶƚŽĨĐŽŶƚŝŶƵŽƵƐĂŝƌƚƌĂǀĞůŝƐƐŝdž;ϲͿŽƌŵŽƌĞ ĐŽŶƐĞĐƵƚŝǀĞŚŽƵƌƐŝŶůĞŶŐƚŚ͕ŽŶůLJĞĐŽŶŽŵLJŽƌĐŽĂĐŚĐůĂƐƐƐĞĂƚŝŶŐŝƐƌĞŝŵďƵƌƐĂďůĞ͘ŵƉůŽLJĞĞƐƐŚĂůůŶŽƚ ďĞƌĞŝŵďƵƌƐĞĚĨŽƌ͞ĂƐŝĐĐŽŶŽŵLJ&ĂƌĞƐ͟ďĞĐĂƵƐĞƚŚĞƐĞĨĂƌĞƐĂƌĞŶŽŶͲƌĞĨƵŶĚĂďůĞĂŶĚŚĂǀĞŵĂŶLJ ƌĞƐƚƌŝĐƚŝŽŶƐƚŚĂƚŽƵƚǁĞŝŐŚƚŚĞĐŽƐƚͲƐĂǀŝŶŐƐ͘ ͘ĂŐŐĂŐĞ&ĞĞƐ ZĞŝŵďƵƌƐĞŵĞŶƚŽĨƉĞƌƐŽŶĂůďĂŐŐĂŐĞĐŚĂƌŐĞƐĂƌĞďĂƐĞĚŽŶƚƌŝƉĚƵƌĂƚŝŽŶĂƐĨŽůůŽǁƐ͗ hƉƚŽĨŝǀĞ;ϱͿĚĂLJƐсŽŶĞ;ϭͿĐŚĞĐŬĞĚďĂŐ ^ŝdž;ϲͿŽƌŵŽƌĞĚĂLJƐсƚǁŽ;ϮͿĐŚĞĐŬĞĚďĂŐƐ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϱ ĂŐŐĂŐĞĨĞĞƐĨŽƌƐƉŽƌƚƐĞƋƵŝƉŵĞŶƚĂƌĞŶŽƚƌĞŝŵďƵƌƐĂďůĞ͘ Ϯ͘'ƌŽƵŶĚdƌĂŶƐƉŽƌƚĂƚŝŽŶ ͘WƌŝǀĂƚĞƵƚŽŵŽďŝůĞ DŝůĞĂŐĞůůŽǁĂŶĐĞʹƵƐŝŶĞƐƐƵƐĞŽĨĂŶĞŵƉůŽLJĞĞ͛ƐƉƌŝǀĂƚĞĂƵƚŽŵŽďŝůĞǁŝůůďĞƌĞŝŵďƵƌƐĞĚĂƚƚŚĞ ĐƵƌƌĞŶƚ/Z^ĂůůŽǁĂďůĞƌĂƚĞ͕ƉůƵƐŽƵƚŽĨƉŽĐŬĞƚĐŽƐƚƐĨŽƌƚŽůůƐĂŶĚƉĂƌŬŝŶŐ͘DŝůĞĂŐĞǁŝůůďĞĐĂůĐƵůĂƚĞĚďLJ ƵƐŝŶŐƚŚĞĞŵƉůŽLJĞĞΖƐŽĨĨŝĐĞĂƐƚŚĞƐƚĂƌƚŝŶŐĂŶĚĞŶĚŝŶŐƉŽŝŶƚ͕ŝŶĐŽŵƉůŝĂŶĐĞǁŝƚŚ/Z^ƌĞŐƵůĂƚŝŽŶƐ͘ ŵƉůŽLJĞĞƐǁŚŽŚĂǀĞďĞĞŶĚĞƐŝŐŶĂƚĞĚĂŚŽŵĞŽĨĨŝĐĞƐŚŽƵůĚĐĂůĐƵůĂƚĞŵŝůĞƐĨƌŽŵƚŚĞŝƌŚŽŵĞ͘ ͘ZĞŶƚĂůĂƌ ŵƉůŽLJĞĞƐĂƌĞĂƵƚŚŽƌŝnjĞĚƚŽƌĞŶƚĐĂƌƐŽŶůLJŝŶĐŽŶũƵŶĐƚŝŽŶǁŝƚŚĂŝƌƚƌĂǀĞůǁŚĞŶĐŽƐƚ͕ĐŽŶǀĞŶŝĞŶĐĞ͕ĂŶĚ ƚŚĞƐƉĞĐŝĨŝĐƐŝƚƵĂƚŝŽŶƌĞĂƐŽŶĂďůLJƌĞƋƵŝƌĞƚŚĞŝƌƵƐĞ͘tŚĞŶƌĞŶƚŝŶŐĂĐĂƌĨŽƌdLJůĞƌďƵƐŝŶĞƐƐ͕ĞŵƉůŽLJĞĞƐ ƐŚŽƵůĚƐĞůĞĐƚĂ͞ŵŝĚͲƐŝnjĞ͟Žƌ͞ŝŶƚĞƌŵĞĚŝĂƚĞ͟ĐĂƌ͘͞&Ƶůů͟ƐŝnjĞĐĂƌƐŵĂLJďĞƌĞŶƚĞĚǁŚĞŶƚŚƌĞĞŽƌŵŽƌĞ ĞŵƉůŽLJĞĞƐĂƌĞƚƌĂǀĞůŝŶŐƚŽŐĞƚŚĞƌ͘dLJůĞƌĐĂƌƌŝĞƐůĞĂƐĞĚǀĞŚŝĐůĞĐŽǀĞƌĂŐĞĨŽƌďƵƐŝŶĞƐƐĐĂƌƌĞŶƚĂůƐ͖ĞdžĐĞƉƚ ĨŽƌĞŵƉůŽLJĞĞƐƚƌĂǀĞůŝŶŐƚŽůĂƐŬĂĂŶĚŝŶƚĞƌŶĂƚŝŽŶĂůůLJ;ĞdžĐůƵĚŝŶŐĂŶĂĚĂͿ͕ĂĚĚŝƚŝŽŶĂůŝŶƐƵƌĂŶĐĞŽŶƚŚĞ ƌĞŶƚĂůĂŐƌĞĞŵĞŶƚƐŚŽƵůĚďĞĚĞĐůŝŶĞĚ͘ ͘WƵďůŝĐdƌĂŶƐƉŽƌƚĂƚŝŽŶ dĂdžŝŽƌĂŝƌƉŽƌƚůŝŵŽƵƐŝŶĞƐĞƌǀŝĐĞƐŵĂLJďĞĐŽŶƐŝĚĞƌĞĚǁŚĞŶƚƌĂǀĞůŝŶŐŝŶĂŶĚĂƌŽƵŶĚĐŝƚŝĞƐŽƌƚŽĂŶĚĨƌŽŵ ĂŝƌƉŽƌƚƐǁŚĞŶůĞƐƐĞdžƉĞŶƐŝǀĞŵĞĂŶƐŽĨƚƌĂŶƐƉŽƌƚĂƚŝŽŶĂƌĞƵŶĂǀĂŝůĂďůĞŽƌŝŵƉƌĂĐƚŝĐĂů͘dŚĞĂĐƚƵĂůĨĂƌĞ ƉůƵƐĂƌĞĂƐŽŶĂďůĞƚŝƉ;ϭϱͲϭϴйͿĂƌĞƌĞŝŵďƵƌƐĂďůĞ͘/ŶƚŚĞĐĂƐĞŽĨĂĨƌĞĞŚŽƚĞůƐŚƵƚƚůĞƚŽƚŚĞĂŝƌƉŽƌƚ͕ƚŝƉƐ ĂƌĞŝŶĐůƵĚĞĚŝŶƚŚĞƉĞƌĚŝĞŵƌĂƚĞƐĂŶĚǁŝůůŶŽƚďĞƌĞŝŵďƵƌƐĞĚƐĞƉĂƌĂƚĞůLJ͘ ͘WĂƌŬŝŶŐΘdŽůůƐ tŚĞŶƉĂƌŬŝŶŐĂƚƚŚĞĂŝƌƉŽƌƚ͕ĞŵƉůŽLJĞĞƐŵƵƐƚƵƐĞůŽŶŐĞƌƚĞƌŵƉĂƌŬŝŶŐĂƌĞĂƐƚŚĂƚĂƌĞŵĞĂƐƵƌĞĚŝŶĚĂLJƐ ĂƐŽƉƉŽƐĞĚƚŽŚŽƵƌƐ͘WĂƌŬĂŶĚĨůLJŽƉƚŝŽŶƐůŽĐĂƚĞĚŶĞĂƌƐŽŵĞĂŝƌƉŽƌƚƐŵĂLJĂůƐŽďĞƵƐĞĚ͘&ŽƌĞdžƚĞŶĚĞĚ ƚƌŝƉƐƚŚĂƚǁŽƵůĚƌĞƐƵůƚŝŶĞdžĐĞƐƐŝǀĞƉĂƌŬŝŶŐĐŚĂƌŐĞƐ͕ƉƵďůŝĐƚƌĂŶƐƉŽƌƚĂƚŝŽŶƚŽͬĨƌŽŵƚŚĞĂŝƌƉŽƌƚƐŚŽƵůĚďĞ ĐŽŶƐŝĚĞƌĞĚ͘dŽůůƐǁŝůůďĞƌĞŝŵďƵƌƐĞĚǁŚĞŶƌĞĐĞŝƉƚƐĂƌĞƉƌĞƐĞŶƚĞĚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϲ ϯ͘>ŽĚŐŝŶŐ dLJůĞƌ͛ƐdDǁŝůůƐĞůĞĐƚŚŽƚĞůĐŚĂŝŶƐƚŚĂƚĂƌĞǁĞůůĞƐƚĂďůŝƐŚĞĚ͕ƌĞĂƐŽŶĂďůĞŝŶƉƌŝĐĞ͕ĂŶĚĐŽŶǀĞŶŝĞŶƚůLJ ůŽĐĂƚĞĚŝŶƌĞůĂƚŝŽŶƚŽƚŚĞƚƌĂǀĞůĞƌΖƐǁŽƌŬĂƐƐŝŐŶŵĞŶƚ͘dLJƉŝĐĂůŚŽƚĞůĐŚĂŝŶƐŝŶĐůƵĚĞŽƵƌƚLJĂƌĚ͕&ĂŝƌĨŝĞůĚ /ŶŶ͕,ĂŵƉƚŽŶ/ŶŶ͕ĂŶĚ,ŽůŝĚĂLJ/ŶŶdžƉƌĞƐƐ͘/ĨƚŚĞĞŵƉůŽLJĞĞŚĂƐĂĚŝƐĐŽƵŶƚƌĂƚĞǁŝƚŚĂůŽĐĂůŚŽƚĞů͕ƚŚĞ ŚŽƚĞůƌĞƐĞƌǀĂƚŝŽŶƐŚŽƵůĚŶŽƚĞƚŚĂƚĚŝƐĐŽƵŶƚĂŶĚƚŚĞĞŵƉůŽLJĞĞƐŚŽƵůĚĐŽŶĨŝƌŵƚŚĞůŽǁĞƌƌĂƚĞǁŝƚŚƚŚĞ ŚŽƚĞůƵƉŽŶĂƌƌŝǀĂů͘ŵƉůŽLJĞĞŵĞŵďĞƌƐŚŝƉƐŝŶƚƌĂǀĞůĐůƵďƐƐƵĐŚĂƐƐŚŽƵůĚďĞŶŽƚĞĚŝŶƚŚĞŝƌƚƌĂǀĞů ƉƌŽĨŝůĞƐƐŽƚŚĂƚƚŚĞĞŵƉůŽLJĞĞĐĂŶƚĂŬĞĂĚǀĂŶƚĂŐĞŽĨĂŶLJůŽǁĞƌĐůƵďƌĂƚĞƐ͘ ͞EŽƐŚŽǁƐ͟ŽƌĐĂŶĐĞůůĂƚŝŽŶĨĞĞƐĂƌĞŶŽƚƌĞŝŵďƵƌƐĂďůĞŝĨƚŚĞĞŵƉůŽLJĞĞĚŽĞƐŶŽƚĐŽŵƉůLJǁŝƚŚƚŚĞŚŽƚĞů͛Ɛ ĐĂŶĐĞůůĂƚŝŽŶƉŽůŝĐLJ͘ dŝƉƐĨŽƌŵĂŝĚƐĂŶĚŽƚŚĞƌŚŽƚĞůƐƚĂĨĨĂƌĞŝŶĐůƵĚĞĚŝŶƚŚĞƉĞƌĚŝĞŵƌĂƚĞĂŶĚĂƌĞŶŽƚƌĞŝŵďƵƌƐĞĚƐĞƉĂƌĂƚĞůLJ͘ ŵƉůŽLJĞĞƐĂƌĞŶŽƚĂƵƚŚŽƌŝnjĞĚƚŽƌĞƐĞƌǀĞŶŽŶͲƚƌĂĚŝƚŝŽŶĂůƐŚŽƌƚͲƚĞƌŵůŽĚŐŝŶŐ͕ƐƵĐŚĂƐŝƌďŶď͕sZK͕ĂŶĚ ,ŽŵĞǁĂLJ͘ŵƉůŽLJĞĞƐǁŚŽĞůĞĐƚƚŽŵĂŬĞƐƵĐŚƌĞƐĞƌǀĂƚŝŽŶƐƐŚĂůůŶŽƚďĞƌĞŝŵďƵƌƐĞĚ͘ ϰ͘DĞĂůƐĂŶĚ/ŶĐŝĚĞŶƚĂůdžƉĞŶƐĞƐ ŵƉůŽLJĞĞŵĞĂůƐĂŶĚŝŶĐŝĚĞŶƚĂůĞdžƉĞŶƐĞƐǁŚŝůĞŽŶƚƌĂǀĞůƐƚĂƚƵƐǁŝƚŚŝŶƚŚĞĐŽŶƚŝŶĞŶƚĂůh͘^͘ĂƌĞŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞĨĞĚĞƌĂůƉĞƌĚŝĞŵƌĂƚĞƐƉƵďůŝƐŚĞĚďLJƚŚĞ'ĞŶĞƌĂů^ĞƌǀŝĐĞƐĚŵŝŶŝƐƚƌĂƚŝŽŶ͘/ŶĐŝĚĞŶƚĂů ĞdžƉĞŶƐĞƐŝŶĐůƵĚĞƚŝƉƐƚŽŵĂŝĚƐ͕ŚŽƚĞůƐƚĂĨĨ͕ĂŶĚƐŚƵƚƚůĞĚƌŝǀĞƌƐĂŶĚŽƚŚĞƌŵŝŶŽƌƚƌĂǀĞůĞdžƉĞŶƐĞƐ͘WĞƌ ĚŝĞŵƌĂƚĞƐĂƌĞĂǀĂŝůĂďůĞĂƚǁǁǁ͘ŐƐĂ͘ŐŽǀͬƉĞƌĚŝĞŵ͘ WĞƌĚŝĞŵĨŽƌůĂƐŬĂ͕,ĂǁĂŝŝ͕h͘^͘ƉƌŽƚĞĐƚŽƌĂƚĞƐĂŶĚŝŶƚĞƌŶĂƚŝŽŶĂůĚĞƐƚŝŶĂƚŝŽŶƐĂƌĞƉƌŽǀŝĚĞĚƐĞƉĂƌĂƚĞůLJďLJ ƚŚĞĞƉĂƌƚŵĞŶƚŽĨ^ƚĂƚĞĂŶĚǁŝůůďĞĚĞƚĞƌŵŝŶĞĚĂƐƌĞƋƵŝƌĞĚ͘ ͘KǀĞƌŶŝŐŚƚdƌĂǀĞů &ŽƌĞĂĐŚĨƵůůĚĂLJŽĨƚƌĂǀĞů͕ĂůůƚŚƌĞĞŵĞĂůƐĂƌĞƌĞŝŵďƵƌƐĂďůĞ͘WĞƌĚŝĞŵƐŽŶƚŚĞĨŝƌƐƚĂŶĚůĂƐƚĚĂLJŽĨĂƚƌŝƉ ĂƌĞŐŽǀĞƌŶĞĚĂƐƐĞƚĨŽƌƚŚďĞůŽǁ͘ ĞƉĂƌƚƵƌĞĂLJ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϳ ĞƉĂƌƚďĞĨŽƌĞϭϮ͗ϬϬŶŽŽŶ >ƵŶĐŚĂŶĚĚŝŶŶĞƌ ĞƉĂƌƚĂĨƚĞƌϭϮ͗ϬϬŶŽŽŶ ZĞƚƵƌŶĂLJ ŝŶŶĞƌ ZĞƚƵƌŶďĞĨŽƌĞϭϮ͗ϬϬŶŽŽŶ ƌĞĂŬĨĂƐƚ ZĞƚƵƌŶďĞƚǁĞĞŶϭϮ͗ϬϬŶŽŽŶΘϳ͗ϬϬƉ͘ŵ͘ ƌĞĂŬĨĂƐƚĂŶĚůƵŶĐŚ ZĞƚƵƌŶĂĨƚĞƌϳ͗ϬϬƉ͘ŵ͘Ύ ƌĞĂŬĨĂƐƚ͕ůƵŶĐŚĂŶĚĚŝŶŶĞƌ Ύϳ͗ϬϬƉ͘ŵ͘ŝƐĚĞĨŝŶĞĚĂƐĚŝƌĞĐƚƚƌĂǀĞůƚŝŵĞĂŶĚĚŽĞƐŶŽƚŝŶĐůƵĚĞƚŝŵĞƚĂŬĞŶƚŽƐƚŽƉĨŽƌĚŝŶŶĞƌ͘ dŚĞƌĞŝŵďƵƌƐĞŵĞŶƚƌĂƚĞƐĨŽƌŝŶĚŝǀŝĚƵĂůŵĞĂůƐĂƌĞĐĂůĐƵůĂƚĞĚĂƐĂƉĞƌĐĞŶƚĂŐĞŽĨƚŚĞĨƵůůĚĂLJƉĞƌĚŝĞŵĂƐ ĨŽůůŽǁƐ͗ ƌĞĂŬĨĂƐƚ ϭϱй >ƵŶĐŚ Ϯϱй ŝŶŶĞƌ ϲϬй ͘^ĂŵĞĂLJdƌĂǀĞů ŵƉůŽLJĞĞƐƚƌĂǀĞůŝŶŐĂƚůĞĂƐƚϭϬϬŵŝůĞƐƚŽĂƐŝƚĞĂŶĚƌĞƚƵƌŶŝŶŐŝŶƚŚĞƐĂŵĞĚĂLJĂƌĞĞůŝŐŝďůĞƚŽĐůĂŝŵůƵŶĐŚ ŽŶĂŶĞdžƉĞŶƐĞƌĞƉŽƌƚ͘ŵƉůŽLJĞĞƐŽŶƐĂŵĞĚĂLJƚƌĂǀĞůƐƚĂƚƵƐĂƌĞĞůŝŐŝďůĞƚŽĐůĂŝŵĚŝŶŶĞƌŝŶƚŚĞĞǀĞŶƚ ƚŚĞLJƌĞƚƵƌŶŚŽŵĞĂĨƚĞƌϳ͗ϬϬƉ͘ŵ͘Ύ Ύϳ͗ϬϬƉ͘ŵ͘ŝƐĚĞĨŝŶĞĚĂƐĚŝƌĞĐƚƚƌĂǀĞůƚŝŵĞĂŶĚĚŽĞƐŶŽƚŝŶĐůƵĚĞƚŝŵĞƚĂŬĞŶƚŽƐƚŽƉĨŽƌĚŝŶŶĞƌ͘ ϱ͘/ŶƚĞƌŶĞƚĐĐĞƐƐʹ,ŽƚĞůƐĂŶĚŝƌƉŽƌƚƐ ŵƉůŽLJĞĞƐǁŚŽƚƌĂǀĞůŵĂLJŶĞĞĚƚŽĂĐĐĞƐƐƚŚĞŝƌĞͲŵĂŝůĂƚŶŝŐŚƚ͘DĂŶLJŚŽƚĞůƐƉƌŽǀŝĚĞĨƌĞĞŚŝŐŚƐƉĞĞĚ ŝŶƚĞƌŶĞƚĂĐĐĞƐƐĂŶĚdLJůĞƌĞŵƉůŽLJĞĞƐĂƌĞĞŶĐŽƵƌĂŐĞĚƚŽƵƐĞƐƵĐŚŚŽƚĞůƐǁŚĞŶĞǀĞƌƉŽƐƐŝďůĞ͘/ĨĂŶ ĞŵƉůŽLJĞĞ͛ƐŚŽƚĞůĐŚĂƌŐĞƐĨŽƌŝŶƚĞƌŶĞƚĂĐĐĞƐƐŝƚŝƐƌĞŝŵďƵƌƐĂďůĞƵƉƚŽΨϭϬ͘ϬϬƉĞƌĚĂLJ͘ŚĂƌŐĞƐĨŽƌ ŝŶƚĞƌŶĞƚĂĐĐĞƐƐĂƚĂŝƌƉŽƌƚƐĂƌĞŶŽƚƌĞŝŵďƵƌƐĂďůĞ͘ ϲ͘ /ŶƚĞƌŶĂƚŝŽŶĂůdƌĂǀĞů ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϴ ůůŝŶƚĞƌŶĂƚŝŽŶĂůĨůŝŐŚƚƐǁŝƚŚƚŚĞĞdžĐĞƉƚŝŽŶŽĨĨůŝŐŚƚƐďĞƚǁĞĞŶƚŚĞh͘^͘ĂŶĚĂŶĂĚĂƐŚŽƵůĚďĞƌĞƐĞƌǀĞĚ ƚŚƌŽƵŐŚdDƵƐŝŶŐƚŚĞ͞ůŽǁĞƐƚƉƌĂĐƚŝĐĂůĐŽĂĐŚĨĂƌĞ͟ǁŝƚŚƚŚĞĞdžĐĞƉƚŝŽŶŽĨĨůŝŐŚƚƐƚŚĂƚĂƌĞƐŝdž;ϲͿŽƌŵŽƌĞ ĐŽŶƐĞĐƵƚŝǀĞŚŽƵƌƐŝŶůĞŶŐƚŚ͘/ŶƐƵĐŚĞǀĞŶƚ͕ƚŚĞŶĞdžƚĂǀĂŝůĂďůĞƐĞĂƚŝŶŐĐůĂƐƐĂďŽǀĞĐŽĂĐŚƐŚĂůůďĞ ƌĞŝŵďƵƌƐĞĚ͘ tŚĞŶƌĞƋƵŝƌĞĚƚŽƚƌĂǀĞůŝŶƚĞƌŶĂƚŝŽŶĂůůLJĨŽƌďƵƐŝŶĞƐƐ͕ĞŵƉůŽLJĞĞƐƐŚĂůůďĞƌĞŝŵďƵƌƐĞĚĨŽƌƉŚŽƚŽĨĞĞƐ͕ ĂƉƉůŝĐĂƚŝŽŶĨĞĞƐ͕ĂŶĚĞdžĞĐƵƚŝŽŶĨĞĞƐǁŚĞŶŽďƚĂŝŶŝŶŐĂŶĞǁƉĂƐƐƉŽƌƚŬ͕ďƵƚĨĞĞƐƌĞůĂƚĞĚƚŽƉĂƐƐƉŽƌƚ ƌĞŶĞǁĂůƐĂƌĞŶŽƚƌĞŝŵďƵƌƐĂďůĞ͘sŝƐĂĂƉƉůŝĐĂƚŝŽŶĂŶĚůĞŐĂůĨĞĞƐ͕ĞŶƚƌLJƚĂdžĞƐĂŶĚĚĞƉĂƌƚƵƌĞƚĂdžĞƐĂƌĞ ƌĞŝŵďƵƌƐĂďůĞ͘ dŚĞĐŽƐƚŽĨǀĂĐĐŝŶĂƚŝŽŶƐƚŚĂƚĂƌĞĞŝƚŚĞƌƌĞƋƵŝƌĞĚĨŽƌƚƌĂǀĞůƚŽƐƉĞĐŝĨŝĐĐŽƵŶƚƌŝĞƐŽƌƐƵŐŐĞƐƚĞĚďLJƚŚĞh͘^͘ ĞƉĂƌƚŵĞŶƚŽĨ,ĞĂůƚŚΘ,ƵŵĂŶ^ĞƌǀŝĐĞƐĨŽƌƚƌĂǀĞůƚŽƐƉĞĐŝĨŝĐĐŽƵŶƚƌŝĞƐ͕ŝƐƌĞŝŵďƵƌƐĂďůĞ͘ ^ĞĐƚŝŽŶϰ͕DĞĂůƐΘ/ŶĐŝĚĞŶƚĂůdžƉĞŶƐĞƐ͕ĂŶĚ^ĞĐƚŝŽŶϮ͘ď͕͘ZĞŶƚĂůĂƌ͕ƐŚĂůůĂƉƉůLJƚŽƚŚŝƐƐĞĐƚŝŽŶ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϰϵ džŚŝďŝƚ DĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚŐƌĞĞŵĞŶƚ tĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚƚŚĞĨŽůůŽǁŝŶŐŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐĨŽƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͘ĂƉŝƚĂůŝnjĞĚ ƚĞƌŵƐŶŽƚŽƚŚĞƌǁŝƐĞĚĞĨŝŶĞĚǁŝůůŚĂǀĞƚŚĞŵĞĂŶŝŶŐĂƐƐŝŐŶĞĚƚŽƐƵĐŚƚĞƌŵƐŝŶƚŚĞŐƌĞĞŵĞŶƚ͘ ϭ͘dĞƌŵ͘tĞƉƌŽǀŝĚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐŽŶĂŶĂŶŶƵĂůďĂƐŝƐ͘dŚĞŝŶŝƚŝĂůƚĞƌŵĐŽŵŵĞŶĐĞƐ ŽŶƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͕ĂŶĚƌĞŵĂŝŶƐŝŶĞĨĨĞĐƚĨŽƌŽŶĞ;ϭͿLJĞĂƌ͘dŚĞƚĞƌŵǁŝůůƌĞŶĞǁĂƵƚŽŵĂƚŝĐĂůůLJĨŽƌ ĂĚĚŝƚŝŽŶĂůŽŶĞ;ϭͿLJĞĂƌƚĞƌŵƐƵŶůĞƐƐƚĞƌŵŝŶĂƚĞĚŝŶǁƌŝƚŝŶŐďLJĞ ŝƚŚĞƌƉĂƌƚLJĂƚůĞĂƐƚƚŚŝƌƚLJ;ϯϬͿĚĂLJƐƉƌŝŽƌ ƚŽƚŚĞĞŶĚŽĨƚŚĞƚŚĞŶͲĐƵƌƌĞŶƚƚĞƌŵ͘tĞǁŝůůĂĚũƵƐƚƚŚĞƚĞƌŵƚŽŵĂƚĐŚLJŽƵƌĨŝƌƐƚƵƐĞŽĨƚŚĞdLJůĞƌ ^ŽĨƚǁĂƌĞŝŶůŝǀĞƉƌŽĚƵĐƚŝŽŶŝĨƚŚĂƚĞǀĞŶƚƉƌĞĐĞĚĞƐƚŚĞŽŶĞ;ϭͿLJĞĂƌĂŶŶŝǀĞƌƐĂƌLJŽĨƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘ Ϯ͘DĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚ&ĞĞƐ͘zŽƵƌLJĞĂƌϭŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐĨŽƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂƌĞ ůŝƐƚĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͕ĂŶĚLJŽƵƌƉĂLJŵĞŶƚŽďůŝŐĂƚŝŽŶƐĂƌĞƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀŽŝĐŝŶŐĂŶĚ WĂLJŵĞŶƚWŽůŝĐLJ͘tĞƌĞƐĞƌǀĞƚŚĞƌŝŐŚƚƚŽƐƵƐƉĞŶĚŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐŝĨLJŽƵĨĂŝůƚŽƉĂLJ ƵŶĚŝƐƉƵƚĞĚŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐǁŝƚŚŝŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨŽƵƌǁƌŝƚƚĞŶŶŽƚŝĐĞ͘tĞǁŝůů ƌĞŝŶƐƚĂƚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐŽŶůLJŝĨLJŽƵƉĂLJĂůůƉĂƐƚĚƵĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐ͕ ŝŶĐůƵĚŝŶŐĂůůĨĞĞƐĨŽƌƚŚĞƉĞƌŝŽĚƐĚƵƌŝŶŐǁŚŝĐŚƐĞƌǀŝĐĞƐǁĞƌĞƐƵƐƉĞŶĚĞĚ͘ ϯ͘DĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚ^ĞƌǀŝĐĞƐ͘ƐůŽŶŐĂƐLJŽƵĂƌĞŶŽƚƵƐŝŶŐƚŚĞ,ĞůƉĞƐŬĂƐĂƐƵďƐƚŝƚƵƚĞĨŽƌŽƵƌ ƚƌĂŝŶŝŶŐƐĞƌǀŝĐĞƐŽŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂŶĚLJŽƵƚŝŵĞůLJƉĂLJLJŽƵƌŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐ͕ǁĞǁŝůů͕ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͗ ϯ͘ϭƉĞƌĨŽƌŵŽƵƌŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚŽďůŝŐĂƚŝŽŶƐŝŶĂƉƌŽĨĞƐƐŝŽŶĂů͕ŐŽŽĚ͕ĂŶĚǁŽƌŬŵĂŶůŝŬĞ ŵĂŶŶĞƌ͕ĐŽŶƐŝƐƚĞŶƚǁŝƚŚŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚƐ͕ƚŽƌĞƐŽůǀĞĞĨĞĐƚƐŝŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ;ƐƵďũĞĐƚƚŽĂŶLJ ĂƉƉůŝĐĂďůĞƌĞůĞĂƐĞůŝĨĞĐLJĐůĞƉŽůŝĐLJͿ͖ƉƌŽǀŝĚĞĚ͕ŚŽǁĞǀĞƌ͕ƚŚĂƚŝĨLJŽƵŵŽĚŝĨLJƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ ǁŝƚŚŽƵƚŽƵƌĐŽŶƐĞŶƚ͕ŽƵƌŽďůŝŐĂƚŝŽŶƚŽƉƌŽǀŝĚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐŽŶĂŶĚǁĂƌƌĂŶƚ ƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞǁŝůůďĞǀŽŝĚ͖ ϯ͘ϮƉƌŽǀŝĚĞƐƵƉƉŽƌƚĚƵƌŝŶŐŽƵƌĞƐƚĂďůŝƐŚĞĚƐƵƉƉŽƌƚŚŽƵƌƐ͖ ϯ͘ϯŵĂŝŶƚĂŝŶƉĞƌƐŽŶŶĞůƚŚĂƚĂƌĞƐƵĨĨŝĐŝĞŶƚůLJƚƌĂŝŶĞĚƚŽďĞĨĂŵŝůŝĂƌǁŝƚŚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚdŚŝƌĚ WĂƌƚLJ^ŽĨƚǁĂƌĞ͕ŝĨĂŶLJ͕ŝŶŽƌĚĞƌƚŽƉƌŽǀŝĚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͖ ϯ͘ϰƉƌŽǀŝĚĞLJŽƵǁŝƚŚĂĐŽƉLJŽĨĂůůƌĞůĞĂƐĞƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ;ŝŶĐůƵĚŝŶŐƵƉĚĂƚĞƐĂŶĚĞŶŚĂŶĐĞŵĞŶƚƐͿ ƚŚĂƚǁĞŵĂŬĞŐĞŶĞƌĂůůLJĂǀĂŝůĂďůĞǁŝƚŚŽƵƚĂĚĚŝƚŝŽŶĂůĐŚĂƌŐĞƚŽĐƵƐƚŽŵĞƌƐǁŚŽŚĂǀĞĂŵĂŝŶƚĞŶĂŶĐĞ ĂŶĚƐƵƉƉŽƌƚĂŐƌĞĞŵĞŶƚŝŶĞĨĨĞĐƚ͖ĂŶĚ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϬ ϯ͘ϱƉƌŽǀŝĚĞŶŽŶͲĞĨĞĐƚƌĞƐŽůƵƚŝŽŶƐƵƉƉŽƌƚŽĨƉƌŝŽƌƌĞůĞĂƐĞƐŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚĂŶLJ ĂƉƉůŝĐĂďůĞƌĞůĞĂƐĞůŝĨĞĐLJĐůĞƉŽůŝĐLJ͘ ϰ͘ůŝĞŶƚZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ͘tĞǁŝůůƵƐĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƉĞƌĨŽƌŵĂŶLJŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚ ƐĞƌǀŝĐĞƐƌĞŵŽƚĞůLJ͘ƵƌƌĞŶƚůLJ͕ǁĞƵƐĞĂƚŚŝƌĚͲƉĂƌƚLJƐĞĐƵƌĞƵŶĂƚƚĞŶĚĞĚĐŽŶŶĞĐƚŝǀŝƚLJƚŽŽůĐĂůůĞĚŽŵŐĂƌ͕ ĂƐǁĞůůĂƐ'ŽƚŽƐƐŝƐƚďLJŝƚƌŝdž͘dŚĞƌĞĨŽƌĞ͕LJŽƵĂŐƌĞĞƚŽŵĂŝŶƚĂŝŶĂŚŝŐŚͲƐƉĞĞĚŝŶƚĞƌŶĞƚĐŽŶŶĞĐƚŝŽŶ ĐĂƉĂďůĞŽĨĐŽŶŶĞĐƚŝŶŐƵƐƚŽLJŽƵƌWƐĂŶĚƐĞƌǀĞƌ;ƐͿ͘zŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĂůŽŐŝŶĂĐĐŽƵŶƚĂŶĚ ůŽĐĂůĂĚŵŝŶŝƐƚƌĂƚŝǀĞƉƌŝǀŝůĞŐĞƐĂƐǁĞŵĂLJƌĞĂƐŽŶĂďůLJƌĞƋƵŝƌĞƚŽƉĞƌĨŽƌŵƌĞŵŽƚĞƐĞƌǀŝĐĞƐ͘tĞǁŝůů͕ĂƚŽƵƌ ŽƉƚŝŽŶ͕ƵƐĞƚŚĞƐĞĐƵƌĞĐŽŶŶĞĐƚŝŽŶƚŽĂƐƐŝƐƚǁŝƚŚƉƌŽƉĞƌĚŝĂŐŶŽƐŝƐĂŶĚƌĞƐŽůƵƚŝŽŶ͕ƐƵďũĞĐƚƚŽĂŶLJ ƌĞĂƐŽŶĂďůLJĂƉƉůŝĐĂďůĞƐĞĐƵƌŝƚLJƉƌŽƚŽĐŽůƐ͘/ĨǁĞĐĂŶŶŽƚƌĞƐŽůǀĞĂƐƵƉƉŽƌƚŝƐƐƵĞƌĞŵŽƚĞůLJ͕ǁĞŵĂLJďĞ ƌĞƋƵŝƌĞĚƚŽƉƌŽǀŝĚĞŽŶƐŝƚĞƐĞƌǀŝĐĞƐ͘/ŶƐƵĐŚĞǀĞŶƚ͕ǁĞǁŝůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌŽƵƌƚƌĂǀĞůĞdžƉĞŶƐĞƐ͕ƵŶůĞƐƐ ŝƚŝƐĚĞƚĞƌŵŝŶĞĚƚŚĂƚƚŚĞƌĞĂƐŽŶŽŶƐŝƚĞƐƵƉƉŽƌƚǁĂƐƌĞƋƵŝƌĞĚǁĂƐĂƌĞĂƐŽŶŽƵƚƐŝĚĞŽƵƌĐŽŶƚƌŽů͘ŝƚŚĞƌ ǁĂLJ͕LJŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĨƵůůĂŶĚĨƌĞĞĂĐĐĞƐƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ǁŽƌŬŝŶŐƐƉĂĐĞ͕ĂĚĞƋƵĂƚĞ ĨĂĐŝůŝƚŝĞƐǁŝƚŚŝŶĂƌĞĂƐŽŶĂďůĞĚŝƐƚĂŶĐĞĨƌŽŵƚŚĞĞƋƵŝƉŵĞŶƚ͕ĂŶĚƵƐĞŽĨŵĂĐŚŝŶĞƐ͕ĂƚƚĂĐŚŵĞŶƚƐ͕ĨĞĂƚƵƌĞƐ͕ ŽƌŽƚŚĞƌĞƋƵŝƉŵĞŶƚƌĞĂƐŽŶĂďůLJŶĞĐĞƐƐĂƌLJĨŽƌƵƐƚŽƉƌŽǀŝĚĞƚŚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ĂůůĂƚ ŶŽĐŚĂƌŐĞƚŽƵƐ͘tĞƐƚƌŽŶŐůLJƌĞĐŽŵŵĞŶĚƚŚĂƚLJŽƵĂůƐŽŵĂŝŶƚĂŝŶĂsWEĨŽƌďĂĐŬƵƉĐŽŶŶĞĐƚŝǀŝƚLJ ƉƵƌƉŽƐĞƐ͘ ϱ͘,ĂƌĚǁĂƌĞĂŶĚKƚŚĞƌ^LJƐƚĞŵƐ͘/ĨLJŽƵĂƌĞĂƐĞůĨͲŚŽƐƚĞĚĐƵƐƚŽŵĞƌĂŶĚ͕ŝŶƚŚĞƉƌŽĐĞƐƐŽĨĚŝĂŐŶŽƐŝŶŐĂ ƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝƐƐƵĞ͕ŝƚŝƐĚŝƐĐŽǀĞƌĞĚƚŚĂƚŽŶĞŽĨLJŽƵƌƉĞƌŝƉŚĞƌĂůƐLJƐƚĞŵƐŽƌŽƚŚĞƌƐŽĨƚǁĂƌĞŝƐƚŚĞ ĐĂƵƐĞŽĨƚŚĞŝƐƐƵĞ͕ǁĞǁŝůůŶŽƚŝĨLJLJŽƵƐŽƚŚĂƚLJŽƵŵĂLJĐŽŶƚĂĐƚƚŚĞƐƵƉƉŽƌƚĂŐĞŶĐLJĨŽƌƚŚĂƚƉĞƌŝƉŚĞƌĂů ƐLJƐƚĞŵ͘tĞĐĂŶŶŽƚƐƵƉƉŽƌƚŽƌŵĂŝŶƚĂŝŶdŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐĞdžĐĞƉƚĂƐĞdžƉƌĞƐƐůLJƐĞƚĨŽƌƚŚŝŶƚŚĞ ŐƌĞĞŵĞŶƚ͘ /ŶŽƌĚĞƌĨŽƌƵƐƚŽƉƌŽǀŝĚĞƚŚĞŚŝŐŚĞƐƚůĞǀĞůŽĨƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚ͕LJŽƵďĞĂƌƚŚĞĨŽůůŽǁŝŶŐƌĞƐƉŽŶƐŝďŝůŝƚLJ ƌĞůĂƚĞĚƚŽŚĂƌĚǁĂƌĞĂŶĚƐŽĨƚǁĂƌĞ͗ ;ĂͿůůŝŶĨƌĂƐƚƌƵĐƚƵƌĞĞdžĞĐƵƚŝŶŐdLJůĞƌ^ŽĨƚǁĂƌĞƐŚĂůůďĞŵĂŶĂŐĞĚďLJLJŽƵ͖ ;ďͿzŽƵǁŝůůŵĂŝŶƚĂŝŶƐƵƉƉŽƌƚĐŽŶƚƌĂĐƚƐĨŽƌĂůůŶŽŶͲdLJůĞƌƐŽĨƚǁĂƌĞĂƐƐŽĐŝĂƚĞĚǁŝƚŚdLJůĞƌ^ŽĨƚǁĂƌĞ ;ŝŶĐůƵĚŝŶŐŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵƐĂŶĚĚĂƚĂďĂƐĞŵĂŶĂŐĞŵĞŶƚƐLJƐƚĞŵƐ͕ďƵƚĞdžĐůƵĚŝŶŐdŚŝƌĚͲWĂƌƚLJ ^ŽĨƚǁĂƌĞ͕ŝĨĂŶLJͿ͖ĂŶĚ ;ĐͿzŽƵǁŝůůƉĞƌĨŽƌŵĚĂŝůLJĚĂƚĂďĂƐĞďĂĐŬƵƉƐĂŶĚǀĞƌŝĨLJƚŚĂƚƚŚŽƐĞďĂĐŬƵƉƐĂƌĞƐƵĐĐĞƐƐĨƵů͘ ϲ͘KƚŚĞƌdžĐůƵĚĞĚ^ĞƌǀŝĐĞƐ͘DĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐĚŽŶŽƚŝŶĐůƵĚĞĨĞĞƐĨŽƌƚŚĞĨŽůůŽǁŝŶŐƐĞƌǀŝĐĞƐ͗ ;ĂͿŝŶŝƚŝĂůŝŶƐƚĂůůĂƚŝŽŶŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͖;ďͿŽŶƐŝƚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚ ;ƵŶůĞƐƐdLJůĞƌĐĂŶŶŽƚƌĞŵŽƚĞůLJĐŽƌƌĞĐƚĂĞĨĞĐƚŝŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂƐƐĞƚĨŽƌƚŚĂďŽǀĞͿ͖;ĐͿĂƉƉůŝĐĂƚŝŽŶ ĚĞƐŝŐŶ͖;ĚͿŽƚŚĞƌĐŽŶƐƵůƚŝŶŐƐĞƌǀŝĐĞƐ͖;ĞͿŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚŽĨĂŶŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵŽƌŚĂƌĚǁĂƌĞ͕ ƵŶůĞƐƐLJŽƵĂƌĞĂŚŽƐƚĞĚĐƵƐƚŽŵĞƌ͖;ĨͿƐƵƉƉŽƌƚŽƵƚƐŝĚĞŽƵƌŶŽƌŵĂůďƵƐŝŶĞƐƐŚŽƵƌƐĂƐůŝƐƚĞĚŝŶŽƵƌƚŚĞŶͲ ĐƵƌƌĞŶƚ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͖Žƌ;ŐͿŝŶƐƚĂůůĂƚŝŽŶ͕ƚƌĂŝŶŝŶŐƐĞƌǀŝĐĞƐ͕ŽƌƚŚŝƌĚƉĂƌƚLJƉƌŽĚƵĐƚĐŽƐƚƐƌĞůĂƚĞĚƚŽ ĂŶĞǁƌĞůĞĂƐĞ͘ZĞƋƵĞƐƚĞĚŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐƐƵĐŚĂƐƚŚŽƐĞŽƵƚůŝŶĞĚŝŶƚŚŝƐƐĞĐƚŝŽŶǁŝůů ďĞďŝůůĞĚƚŽLJŽƵŽŶĂƚŝŵĞĂŶĚŵĂƚĞƌŝĂůƐďĂƐŝƐĂƚŽƵƌƚŚĞŶĐƵƌƌĞŶƚƌĂƚĞƐ͘zŽƵŵƵƐƚƌĞƋƵĞƐƚƚŚŽƐĞƐĞƌǀŝĐĞƐ ǁŝƚŚĂƚůĞĂƐƚŽŶĞ;ϭͿǁĞĞŬƐ͛ĂĚǀĂŶĐĞŶŽƚŝĐĞ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϭ ϳ͘ƵƌƌĞŶƚ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͘KƵƌĐƵƌƌĞŶƚ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐĨŽƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐĂƚƚĂĐŚĞĚƚŽƚŚŝƐ džŚŝďŝƚĂƚ^ĐŚĞĚƵůĞϭ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϮ džŚŝďŝƚ ^ĐŚĞĚƵůĞϭ ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ ^ƵƉƉŽƌƚŚĂŶŶĞůƐ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ƉƌŽǀŝĚĞƐƚŚĞĨŽůůŽǁŝŶŐĐŚĂŶŶĞůƐŽĨƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚ͗ ;ϭͿdLJůĞƌŽŵŵƵŶŝƚLJʹĂŶŽŶͲůŝŶĞƌĞƐŽƵƌĐĞ͕dLJůĞƌŽŵŵƵŶŝƚLJƉƌŽǀŝĚĞƐĂǀĞŶƵĞĨŽƌĂůůdLJůĞƌĐůŝĞŶƚƐǁŝƚŚ ĐƵƌƌĞŶƚŵĂŝŶƚĞŶĂŶĐĞĂŐƌĞĞŵĞŶƚƐƚŽĐŽůůĂďŽƌĂƚĞǁŝƚŚŽŶĞĂŶŽƚŚĞƌ͕ƐŚĂƌĞďĞƐƚƉƌĂĐƚŝĐĞƐĂŶĚ ƌĞƐŽƵƌĐĞƐ͕ĂŶĚĂĐĐĞƐƐĚŽĐƵŵĞŶƚĂƚŝŽŶ͘ ;ϮͿKŶͲůŝŶĞƐƵďŵŝƐƐŝŽŶ;ƉŽƌƚĂůͿʹĨŽƌůĞƐƐƵƌŐĞŶƚĂŶĚĨƵŶĐƚŝŽŶĂůŝƚLJͲďĂƐĞĚƋƵĞƐƚŝŽŶƐ͕ƵƐĞƌƐŵĂLJĐƌĞĂƚĞ ƵŶůŝŵŝƚĞĚƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐƚŚƌŽƵŐŚƚŚĞĐƵƐƚŽŵĞƌƌĞůĂƚŝŽŶƐŚŝƉŵĂŶĂŐĞŵĞŶƚƉŽƌƚĂůĂǀĂŝůĂďůĞĂƚƚŚĞ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐǁĞďƐŝƚĞ͘ ;ϯͿŵĂŝůʹĨŽƌůĞƐƐƵƌŐĞŶƚƐŝƚƵĂƚŝŽŶƐ͕ƵƐĞƌƐŵĂLJƐƵďŵŝƚƵŶůŝŵŝƚĞĚĞŵĂŝůƐĚŝƌĞĐƚůLJƚŽƚŚĞƐŽĨƚǁĂƌĞ ƐƵƉƉŽƌƚŐƌŽƵƉ͘ ;ϰͿdĞůĞƉŚŽŶĞʹĨŽƌƵƌŐĞŶƚŽƌĐŽŵƉůĞdžƋƵĞƐƚŝŽŶƐ͕ƵƐĞƌƐƌĞĐĞŝǀĞƚŽůůͲĨƌĞĞ͕ƵŶůŝŵŝƚĞĚƚĞůĞƉŚŽŶĞƐŽĨƚǁĂƌĞ ƐƵƉƉŽƌƚ͘ ^ƵƉƉŽƌƚZĞƐŽƵƌĐĞƐ ŶƵŵďĞƌŽĨĂĚĚŝƚŝŽŶĂůƌĞƐŽƵƌĐĞƐĂƌĞĂǀĂŝůĂďůĞƚŽƉƌŽǀŝĚĞĂĐŽŵƉƌĞŚĞŶƐŝǀĞĂŶĚĐŽŵƉůĞƚĞƐƵƉƉŽƌƚ ĞdžƉĞƌŝĞŶĐĞ͗ ;ϭͿdLJůĞƌtĞďƐŝƚĞʹǁǁǁ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵʹĨŽƌĂĐĐĞƐƐŝŶŐĐůŝĞŶƚƚŽŽůƐĂŶĚŽƚŚĞƌŝŶĨŽƌŵĂƚŝŽŶŝŶĐůƵĚŝŶŐ ƐƵƉƉŽƌƚĐŽŶƚĂĐƚŝŶĨŽƌŵĂƚŝŽŶ͘ ;ϮͿdLJůĞƌŽŵŵƵŶŝƚLJʹĂǀĂŝůĂďůĞƚŚƌŽƵŐŚůŽŐŝŶ͕dLJůĞƌŽŵŵƵŶŝƚLJƉƌŽǀŝĚĞƐĂǀĞŶƵĞĨŽƌĐůŝĞŶƚƐƚŽƐƵƉƉŽƌƚ ŽŶĞĂŶŽƚŚĞƌĂŶĚƐŚĂƌĞďĞƐƚƉƌĂĐƚŝĐĞƐĂŶĚƌĞƐŽƵƌĐĞƐ͘ ;ϯͿ<ŶŽǁůĞĚŐĞďĂƐĞʹĨƵůůLJƐĞĂƌĐŚĂďůĞĚĞƉŽƐŝƚŽƌLJŽĨƚŚŽƵƐĂŶĚƐŽĨĚŽĐƵŵĞŶƚƐƌĞůĂƚĞĚƚŽƉƌŽĐĞĚƵƌĞƐ͕ ďĞƐƚƉƌĂĐƚŝĐĞƐ͕ƌĞůĞĂƐĞŝŶĨŽƌŵĂƚŝŽŶ͕ĂŶĚũŽďĂŝĚĞƐ͘ ;ϰͿWƌŽŐƌĂŵhƉĚĂƚĞƐʹǁŚĞƌĞĚĞǀĞůŽƉŵĞŶƚĂĐƚŝǀŝƚLJŝƐŵĂĚĞĂǀĂŝůĂďůĞĨŽƌĐůŝĞŶƚĐŽŶƐƵŵƉƚŝŽŶ ^ƵƉƉŽƌƚǀĂŝůĂďŝůŝƚLJ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƐƵƉƉŽƌƚŝƐĂǀĂŝůĂďůĞĚƵƌŝŶŐƚŚĞůŽĐĂůďƵƐŝŶĞƐƐŚŽƵƌƐŽĨϴDƚŽϱWD;DŽŶĚĂLJʹ&ƌŝĚĂLJͿ ĂĐƌŽƐƐĨŽƵƌh^ƚŝŵĞnjŽŶĞƐ;WĂĐŝĨŝĐ͕DŽƵŶƚĂŝŶ͕ĞŶƚƌĂůĂŶĚĂƐƚĞƌŶͿ͘ůŝĞŶƚƐŵĂLJƌĞĐĞŝǀĞĐŽǀĞƌĂŐĞĂĐƌŽƐƐ ƚŚĞƐĞƚŝŵĞnjŽŶĞƐ͘dLJůĞƌ͛ƐŚŽůŝĚĂLJƐĐŚĞĚƵůĞŝƐŽƵƚůŝŶĞĚďĞůŽǁ͘dŚĞƌĞǁŝůůďĞŶŽƐƵƉƉŽƌƚĐŽǀĞƌĂŐĞŽŶƚŚĞƐĞ ĚĂLJƐ͘ EĞǁzĞĂƌ͛ƐĂLJ dŚĂŶŬƐŐŝǀŝŶŐĂLJ DĞŵŽƌŝĂůĂLJĂLJĂĨƚĞƌdŚĂŶŬƐŐŝǀŝŶŐ /ŶĚĞƉĞŶĚĞŶĐĞĂLJ ŚƌŝƐƚŵĂƐĂLJ >ĂďŽƌĂLJ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϯ /ƐƐƵĞ,ĂŶĚůŝŶŐ /ŶĐŝĚĞŶƚdƌĂĐŬŝŶŐ ǀĞƌLJƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŝƐůŽŐŐĞĚŝŶƚŽdLJůĞƌ͛ƐƵƐƚŽŵĞƌZĞůĂƚŝŽŶƐŚŝƉDĂŶĂŐĞŵĞŶƚ^LJƐƚĞŵĂŶĚŐŝǀĞŶĂƵŶŝƋƵĞ ŝŶĐŝĚĞŶƚŶƵŵďĞƌ͘dŚŝƐƐLJƐƚĞŵƚƌĂĐŬƐƚŚĞŚŝƐƚŽƌLJŽĨĞĂĐŚŝŶĐŝĚĞŶƚ͘dŚĞŝŶĐŝĚĞŶƚƚƌĂĐŬŝŶŐŶƵŵďĞƌŝƐƵƐĞĚƚŽ ƚƌĂĐŬĂŶĚƌĞĨĞƌĞŶĐĞŽƉĞŶŝƐƐƵĞƐǁŚĞŶĐůŝĞŶƚƐĐŽŶƚĂĐƚƐƵƉƉŽƌƚ͘ůŝĞŶƚƐŵĂLJƚƌĂĐŬŝŶĐŝĚĞŶƚƐ͕ƵƐŝŶŐƚŚĞŝŶĐŝĚĞŶƚ ŶƵŵďĞƌ͕ƚŚƌŽƵŐŚƚŚĞƉŽƌƚĂůĂƚdLJůĞƌ͛ƐǁĞďƐŝƚĞŽƌďLJĐĂůůŝŶŐƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚĚŝƌĞĐƚůLJ͘ /ŶĐŝĚĞŶƚWƌŝŽƌŝƚLJ ĂĐŚŝŶĐŝĚĞŶƚŝƐĂƐƐŝŐŶĞĚĂƉƌŝŽƌŝƚLJŶƵŵďĞƌ͕ǁŚŝĐŚĐŽƌƌĞƐƉŽŶĚƐƚŽƚŚĞĐůŝĞŶƚ͛ƐŶĞĞĚƐĂŶĚĚĞĂĚůŝŶĞƐ͘dŚĞ ĐůŝĞŶƚŝƐƌĞƐƉŽŶƐŝďůĞĨŽƌƌĞĂƐŽŶĂďůLJƐĞƚƚŝŶŐƚŚĞƉƌŝŽƌŝƚLJŽĨƚŚĞŝŶĐŝĚĞŶƚƉĞƌƚŚĞĐŚĂƌƚďĞůŽǁ͘dŚŝƐĐŚĂƌƚŝƐŶŽƚ ŝŶƚĞŶĚĞĚƚŽĂĚĚƌĞƐƐĞǀĞƌLJƚLJƉĞŽĨƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚ͕ĂŶĚĐĞƌƚĂŝŶ͞ĐŚĂƌĂĐƚĞƌŝƐƚŝĐƐ͟ŵĂLJŽƌŵĂLJŶŽƚĂƉƉůLJ ĚĞƉĞŶĚŝŶŐŽŶǁŚĞƚŚĞƌƚŚĞdLJůĞƌƐŽĨƚǁĂƌĞŚĂƐďĞĞŶĚĞƉůŽLJĞĚŽŶĐƵƐƚŽŵĞƌŝŶĨƌĂƐƚƌƵĐƚƵƌĞŽƌƚŚĞdLJůĞƌĐůŽƵĚ͘ dŚĞŐŽĂůŝƐƚŽŚĞůƉŐƵŝĚĞƚŚĞĐůŝĞŶƚƚŽǁĂƌĚƐĐůĞĂƌůLJƵŶĚĞƌƐƚĂŶĚŝŶŐĂŶĚĐŽŵŵƵŶŝĐĂƚŝŶŐƚŚĞŝŵƉŽƌƚĂŶĐĞŽĨƚŚĞ ŝƐƐƵĞĂŶĚƚŽĚĞƐĐƌŝďĞŐĞŶĞƌĂůůLJĞdžƉĞĐƚĞĚƌĞƐƉŽŶƐĞƐĂŶĚƌĞƐŽůƵƚŝŽŶƐ͘ WƌŝŽƌŝƚLJ >ĞǀĞůŚĂƌĂĐƚĞƌŝƐƚŝĐƐŽĨ^ƵƉƉŽƌƚ/ŶĐŝĚĞŶƚZĞƐŽůƵƚŝŽŶdĂƌŐĞƚƐ ϭ ƌŝƚŝĐĂů ^ƵƉƉŽƌƚŝŶĐŝĚĞŶƚƚŚĂƚĐĂƵƐĞƐ;ĂͿ ĐŽŵƉůĞƚĞĂƉƉůŝĐĂƚŝŽŶĨĂŝůƵƌĞŽƌ ĂƉƉůŝĐĂƚŝŽŶƵŶĂǀĂŝůĂďŝůŝƚLJ͖;ďͿ ĂƉƉůŝĐĂƚŝŽŶĨĂŝůƵƌĞŽƌƵŶĂǀĂŝůĂďŝůŝƚLJŝŶ ŽŶĞŽƌŵŽƌĞŽĨƚŚĞĐůŝĞŶƚ͛ƐƌĞŵŽƚĞ ůŽĐĂƚŝŽŶ͖Žƌ;ĐͿƐLJƐƚĞŵŝĐůŽƐƐŽĨ ŵƵůƚŝƉůĞĞƐƐĞŶƚŝĂůƐLJƐƚĞŵĨƵŶĐƚŝŽŶƐ͘ dLJůĞƌƐŚĂůůƉƌŽǀŝĚĞĂŶŝŶŝƚŝĂůƌĞƐƉŽŶƐĞƚŽWƌŝŽƌŝƚLJ>ĞǀĞů ϭŝŶĐŝĚĞŶƚƐǁŝƚŚŝŶŽŶĞ;ϭͿďƵƐŝŶĞƐƐŚŽƵƌŽĨƌĞĐĞŝƉƚŽĨ ƚŚĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚ͘dLJůĞƌƐŚĂůůƵƐĞĐŽŵŵĞƌĐŝĂůůLJ ƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞƐŽůǀĞƐƵĐŚƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐ ŽƌƉƌŽǀŝĚĞĂĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞǁŝƚŚŝŶŽŶĞ;ϭͿ ďƵƐŝŶĞƐƐĚĂLJ͘&ŽƌŶŽŶͲŚŽƐƚĞĚĐƵƐƚŽŵĞƌƐ͕dLJůĞƌ͛Ɛ ƌĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌůŽƐƚŽƌĐŽƌƌƵƉƚĞĚĚĂƚĂŝƐůŝŵŝƚĞĚƚŽ ĂƐƐŝƐƚŝŶŐƚŚĞĐůŝĞŶƚŝŶƌĞƐƚŽƌŝŶŐŝƚƐůĂƐƚĂǀĂŝůĂďůĞ ĚĂƚĂďĂƐĞ͘ Ϯ ,ŝŐŚ ^ƵƉƉŽƌƚŝŶĐŝĚĞŶƚƚŚĂƚĐĂƵƐĞƐ;ĂͿ ƌĞƉĞĂƚĞĚ͕ĐŽŶƐŝƐƚĞŶƚĨĂŝůƵƌĞŽĨ ĞƐƐĞŶƚŝĂůĨƵŶĐƚŝŽŶĂůŝƚLJĂĨĨĞĐƚŝŶŐŵŽƌĞ ƚŚĂŶŽŶĞƵƐĞƌŽƌ;ďͿůŽƐƐŽƌĐŽƌƌƵƉƚŝŽŶ ŽĨĚĂƚĂ͘ dLJůĞƌƐŚĂůůƉƌŽǀŝĚĞĂŶŝŶŝƚŝĂůƌĞƐƉŽŶƐĞƚŽWƌŝŽƌŝƚLJ>ĞǀĞů ϮŝŶĐŝĚĞŶƚƐǁŝƚŚŝŶĨŽƵƌ;ϰͿďƵƐŝŶĞƐƐŚŽƵƌƐŽĨƌĞĐĞŝƉƚ ŽĨƚŚĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚ͘dLJůĞƌƐŚĂůůƵƐĞĐŽŵŵĞƌĐŝĂůůLJ ƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞƐŽůǀĞƐƵĐŚƐƵƉƉŽƌƚ ŝŶĐŝĚĞŶƚƐŽƌƉƌŽǀŝĚĞĂĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞ ǁŝƚŚŝŶƚĞŶ;ϭϬͿďƵƐŝŶĞƐƐĚĂLJƐ͘&ŽƌŶŽŶͲŚŽƐƚĞĚ ĐƵƐƚŽŵĞƌƐ͕dLJůĞƌ͛ƐƌĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌůŽƐƐŽƌĐŽƌƌƵƉƚĞĚ ĚĂƚĂŝƐůŝŵŝƚĞĚƚŽĂƐƐŝƐƚŝŶŐƚŚĞĐůŝĞŶƚŝŶƌĞƐƚŽƌŝŶŐŝƚƐ ůĂƐƚĂǀĂŝůĂďůĞĚĂƚĂďĂƐĞ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϰ WƌŝŽƌŝƚLJ >ĞǀĞůŚĂƌĂĐƚĞƌŝƐƚŝĐƐŽĨ^ƵƉƉŽƌƚ/ŶĐŝĚĞŶƚZĞƐŽůƵƚŝŽŶdĂƌŐĞƚƐ ϯ DĞĚŝƵŵ WƌŝŽƌŝƚLJ>ĞǀĞůϭŝŶĐŝĚĞŶƚǁŝƚŚĂŶ ĞdžŝƐƚŝŶŐĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞ͕Žƌ ĂWƌŝŽƌŝƚLJ>ĞǀĞůϮŝŶĐŝĚĞŶƚƚŚĂƚĂĨĨĞĐƚƐ ŽŶůLJŽŶĞƵƐĞƌŽƌĨŽƌǁŚŝĐŚƚŚĞƌĞŝƐĂŶ ĞdžŝƐƚŝŶŐĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞ͘ dLJůĞƌƐŚĂůůƉƌŽǀŝĚĞĂŶŝŶŝƚŝĂůƌĞƐƉŽŶƐĞƚŽWƌŝŽƌŝƚLJ>ĞǀĞů ϯŝŶĐŝĚĞŶƚƐǁŝƚŚŝŶŽŶĞ;ϭͿďƵƐŝŶĞƐƐĚĂLJŽĨƌĞĐĞŝƉƚŽĨ ƚŚĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚ͘dLJůĞƌƐŚĂůůƵƐĞĐŽŵŵĞƌĐŝĂůůLJ ƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞƐŽůǀĞƐƵĐŚƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐ ǁŝƚŚŽƵƚƚŚĞŶĞĞĚĨŽƌĂĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞǁŝƚŚ ƚŚĞŶĞdžƚƉƵďůŝƐŚĞĚŵĂŝŶƚĞŶĂŶĐĞƵƉĚĂƚĞŽƌƐĞƌǀŝĐĞ ƉĂĐŬ͘&ŽƌŶŽŶͲŚŽƐƚĞĚĐƵƐƚŽŵĞƌƐ͕dLJůĞƌ͛Ɛ ƌĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌůŽƐƚŽƌĐŽƌƌƵƉƚĞĚĚĂƚĂŝƐůŝŵŝƚĞĚƚŽ ĂƐƐŝƐƚŝŶŐƚŚĞĐůŝĞŶƚŝŶƌĞƐƚŽƌŝŶŐŝƚƐůĂƐƚĂǀĂŝůĂďůĞ ĚĂƚĂďĂƐĞ͘ ϰ EŽŶͲ ĐƌŝƚŝĐĂů ^ƵƉƉŽƌƚŝŶĐŝĚĞŶƚƚŚĂƚĐĂƵƐĞƐĨĂŝůƵƌĞŽĨ ŶŽŶͲĞƐƐĞŶƚŝĂůĨƵŶĐƚŝŽŶĂůŝƚLJŽƌĂ ĐŽƐŵĞƚŝĐŽƌŽƚŚĞƌŝƐƐƵĞƚŚĂƚĚŽĞƐŶŽƚ ƋƵĂůŝĨLJĂƐĂŶLJŽƚŚĞƌWƌŝŽƌŝƚLJ>ĞǀĞů͘ dLJůĞƌƐŚĂůůƉƌŽǀŝĚĞĂŶŝŶŝƚŝĂůƌĞƐƉŽŶƐĞƚŽWƌŝŽƌŝƚLJ>ĞǀĞů ϰŝŶĐŝĚĞŶƚƐǁŝƚŚŝŶƚǁŽ;ϮͿďƵƐŝŶĞƐƐĚĂLJƐ͘dLJůĞƌƐŚĂůů ƵƐĞĐŽŵŵĞƌĐŝĂůůLJƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞƐŽůǀĞƐƵĐŚ ƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐ͕ĂƐǁĞůůĂƐĐŽƐŵĞƚŝĐŝƐƐƵĞƐ͕ǁŝƚŚĂ ĨƵƚƵƌĞǀĞƌƐŝŽŶƌĞůĞĂƐĞ͘ /ŶĐŝĚĞŶƚƐĐĂůĂƚŝŽŶ dLJůĞƌdĞĐŚŶŽůŽŐLJ͛ƐƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚĐŽŶƐŝƐƚƐŽĨĨŽƵƌůĞǀĞůƐŽĨƉĞƌƐŽŶŶĞů͗ ;ϭͿ>ĞǀĞůϭ͗ĨƌŽŶƚͲůŝŶĞƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐ ;ϮͿ>ĞǀĞůϮ͗ŵŽƌĞƐĞŶŝŽƌŝŶƚŚĞŝƌƐƵƉƉŽƌƚƌŽůĞ͕ƚŚĞLJĂƐƐŝƐƚĨƌŽŶƚͲůŝŶĞƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐĂŶĚƚĂŬĞŽŶ ĞƐĐĂůĂƚĞĚŝƐƐƵĞƐ ;ϯͿ>ĞǀĞůϯ͗ĂƐƐŝƐƚŝŶŝŶĐŝĚĞŶƚĞƐĐĂůĂƚŝŽŶƐĂŶĚƐƉĞĐŝĂůŝnjĞĚĐůŝĞŶƚŝƐƐƵĞƐ ;ϰͿ>ĞǀĞůϰ͗ƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞŵĂŶĂŐĞŵĞŶƚŽĨƐƵƉƉŽƌƚƚĞĂŵƐĨŽƌĞŝƚŚĞƌĂƐŝŶŐůĞƉƌŽĚƵĐƚŽƌĂƉƌŽĚƵĐƚ ŐƌŽƵƉ /ĨĂĐůŝĞŶƚĨĞĞůƐƚŚĞLJĂƌĞŶŽƚƌĞĐĞŝǀŝŶŐƚŚĞƐĞƌǀŝĐĞŶĞĞĚĞĚ͕ƚŚĞLJŵĂLJĐŽŶƚĂĐƚƚŚĞĂƉƉƌŽƉƌŝĂƚĞ^ŽĨƚǁĂƌĞ ^ƵƉƉŽƌƚDĂŶĂŐĞƌ͘ĨƚĞƌƌĞĐĞŝǀŝŶŐƚŚĞŝŶĐŝĚĞŶƚƚƌĂĐŬŝŶŐŶƵŵďĞƌ͕ƚŚĞŵĂŶĂŐĞƌǁŝůůĨŽůůŽǁƵƉŽŶƚŚĞŽƉĞŶ ŝƐƐƵĞĂŶĚĚĞƚĞƌŵŝŶĞƚŚĞŶĞĐĞƐƐĂƌLJĂĐƚŝŽŶƚŽŵĞĞƚƚŚĞĐůŝĞŶƚ͛ƐŶĞĞĚƐ͘ KŶŽĐĐĂƐŝŽŶ͕ƚŚĞƉƌŝŽƌŝƚLJŽƌŝŵŵĞĚŝĂĐLJŽĨĂƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŵĂLJĐŚĂŶŐĞĂĨƚĞƌŝŶŝƚŝĂƚŝŽŶ͘dLJůĞƌ ĞŶĐŽƵƌĂŐĞƐĐůŝĞŶƚƐƚŽĐŽŵŵƵŶŝĐĂƚĞƚŚĞůĞǀĞůŽĨƵƌŐĞŶĐLJŽƌƉƌŝŽƌŝƚLJŽĨƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝƐƐƵĞƐƐŽƚŚĂƚǁĞĐĂŶ ƌĞƐƉŽŶĚĂƉƉƌŽƉƌŝĂƚĞůLJ͘ƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚĐĂŶďĞĞƐĐĂůĂƚĞĚďLJĂŶLJŽĨƚŚĞĨŽůůŽǁŝŶŐŵĞƚŚŽĚƐ͗ ;ϭͿdĞůĞƉŚŽŶĞʹĨŽƌŝŵŵĞĚŝĂƚĞƌĞƐƉŽŶƐĞ͕ĐĂůůƚŽůůͲĨƌĞĞƚŽĞŝƚŚĞƌĞƐĐĂůĂƚĞĂŶŝŶĐŝĚĞŶƚ͛ƐƉƌŝŽƌŝƚLJŽƌƚŽ ĞƐĐĂůĂƚĞĂŶŝƐƐƵĞƚŚƌŽƵŐŚŵĂŶĂŐĞŵĞŶƚĐŚĂŶŶĞůƐĂƐĚĞƐĐƌŝďĞĚĂďŽǀĞ͘ ;ϮͿŵĂŝůʹĐůŝĞŶƚƐĐĂŶƐĞŶĚĂŶĞŵĂŝůƚŽƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝŶŽƌĚĞƌƚŽĞƐĐĂůĂƚĞƚŚĞƉƌŝŽƌŝƚLJŽĨĂŶŝƐƐƵĞ ;ϯͿKŶͲůŝŶĞ^ƵƉƉŽƌƚ/ŶĐŝĚĞŶƚWŽƌƚĂůʹĐůŝĞŶƚƐĐĂŶĂůƐŽĞƐĐĂůĂƚĞƚŚĞƉƌŝŽƌŝƚLJŽĨĂŶŝƐƐƵĞďLJůŽŐŐŝŶŐŝŶƚŽƚŚĞ ĐůŝĞŶƚŝŶĐŝĚĞŶƚƉŽƌƚĂůĂŶĚƌĞĨĞƌĞŶĐŝŶŐƚŚĞĂƉƉƌŽƉƌŝĂƚĞŝŶĐŝĚĞŶƚƚƌĂĐŬŝŶŐŶƵŵďĞƌ͘ ZĞŵŽƚĞ^ƵƉƉŽƌƚdŽŽů ^ŽŵĞƐƵƉƉŽƌƚĐĂůůƐƌĞƋƵŝƌĞĨƵƌƚŚĞƌĂŶĂůLJƐŝƐŽĨƚŚĞĐůŝĞŶƚ͛ƐĚĂƚĂďĂƐĞ͕ƉƌŽĐĞƐƐŽƌƐĞƚƵƉƚŽĚŝĂŐŶŽƐĞĂƉƌŽďůĞŵ ŽƌƚŽĂƐƐŝƐƚǁŝƚŚĂƋƵĞƐƚŝŽŶ͘dLJůĞƌǁŝůů͕ĂƚŝƚƐĚŝƐĐƌĞƚŝŽŶ͕ƵƐĞĂŶŝŶĚƵƐƚƌLJͲƐƚĂŶĚĂƌĚƌĞŵŽƚĞƐƵƉƉŽƌƚƚŽŽů͘ ^ƵƉƉŽƌƚŝƐĂďůĞƚŽƋƵŝĐŬůLJĐŽŶŶĞĐƚƚŽƚŚĞĐůŝĞŶƚ͛ƐĚĞƐŬƚŽƉĂŶĚǀŝĞǁƚŚĞƐŝƚĞ͛ƐƐĞƚƵƉ͕ĚŝĂŐŶŽƐĞƉƌŽďůĞŵƐ͕Žƌ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϱ ĂƐƐŝƐƚǁŝƚŚƐĐƌĞĞŶŶĂǀŝŐĂƚŝŽŶ͘DŽƌĞŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚƚŚĞƌĞŵŽƚĞƐƵƉƉŽƌƚƚŽŽůdLJůĞƌƵƐĞƐŝƐĂǀĂŝůĂďůĞƵƉŽŶ ƌĞƋƵĞƐƚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϲ džŚŝďŝƚ ŽĐKƌŝŐŝŶŶĚhƐĞƌ>ŝĐĞŶƐĞŐƌĞĞŵĞŶƚ ZD/EZK&W'/EdEd/KE>>z>&d>E< ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϳ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϴ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϱϵ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϬ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϭ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϮ džŚŝďŝƚ DLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJĂŶĚ/sZ ϭ͘DLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ>ŝĐĞŶƐŝŶŐ͘ĐĐĞƐƐƚŽDLJ'ŽǀWĂLJĂŶĚͬŽƌsŝƌƚƵĂůWĂLJŝƐŚĞƌĞďLJŐƌĂŶƚĞĚŝĨƵƐƚŽŵĞƌ ĞůĞĐƚƐƚŽƵƐĞDLJ'ŽǀWĂLJŽƌsŝƌƚƵĂůWĂLJ͕ƉƌŽĚƵĐƚƐŽĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ;WŽǁĞƌĞĚďLJWĞƌƐŽůǀĞŶƚͿ͕ĚĞƐŝŐŶĞĚĨŽƌ ŝƚŝnjĞŶhƐĞƌƐƚŽƵƐĞĨŽƌƉƌŽĐĞƐƐŝŶŐŽŶůŝŶĞƉĂLJŵĞŶƚƐ͘ ;ĂͿ^ƉĞĐŝĂůDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJĞĨŝŶŝƚŝŽŶƐ͘ ͞DĞƌĐŚĂŶƚŐƌĞĞŵĞŶƚ͟ŵĞĂŶƐƚŚĞĂŐƌĞĞŵĞŶƚďĞƚǁĞĞŶƵƐƚŽŵĞƌĂŶĚWĞƌƐŽůǀĞŶƚƚŚĂƚƉƌŽǀŝĚĞƐĨŽƌƚŚĞ DĞƌĐŚĂŶƚ&ĞĞƐ͘ ͞DĞƌĐŚĂŶƚ&ĞĞƐ͟ŵĞĂŶƐĚŝƌĞĐƚĐŽƐƚƐůĞǀŝĞĚďLJsŝƐĂͬDĂƐƚĞƌĐĂƌĚͬŝƐĐŽǀĞƌŽƌŽƚŚĞƌƉĂLJŵĞŶƚĐĂƌĚĐŽŵƉĂŶŝĞƐĨŽƌ /ŶƚĞƌĐŚĂŶŐĞ&ĞĞƐ͕ƵĞƐ͕ƐƐĞƐƐŵĞŶƚƐĂŶĚKĐĐƵƌƌĞŶĐĞ&ĞĞƐ͕ŽǀĞƌǁŚŝĐŚdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŚĂƐŶŽĂƵƚŚŽƌŝƚLJ͘ ͞DLJ'ŽǀWĂLJ͟ŵĞĂŶƐƚŚĞWƌŽĚƵĐƚŽĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƚŚĂƚĂůůŽǁƐŵĞŵďĞƌƐŽĨƚŚĞƉƵďůŝĐƚŽƉĂLJĨŽƌƵƐƚŽŵĞƌ͛Ɛ ƐĞƌǀŝĐĞƐǁŝƚŚĂĐƌĞĚŝƚŽƌŽƚŚĞƌƉĂLJŵĞŶƚĐĂƌĚŽŶƚŚĞƵƐƚŽŵĞƌ͛ƐĐŝƚŝnjĞŶͲĨĂĐŝŶŐǁĞďƉŽƌƚĂů͘ ͞WĞƌƐŽůǀĞŶƚ͟ŵĞĂŶƐWĞƌƐŽůǀĞŶƚ͕ĨŽƌŵĞƌůLJĂŶŬĂƌĚ^ĞƌǀŝĐĞƐtŽƌůĚǁŝĚĞ͕ĂWĂLJŵĞŶƚĂƌĚ/ŶĚƵƐƚƌLJ;W/Ϳ ĐŽŵƉůŝĂŶƚƉƌŽĐĞƐƐŝŶŐĂŐĞŶƚƚŚƌŽƵŐŚǁŚŝĐŚƚŚĞŶĞƌ'Žǀ^ŽĨƚǁĂƌĞƉĂƐƐĞƐĐƌĞĚŝƚĐĂƌĚƚƌĂŶƐĂĐƚŝŽŶƐ͘ ͞hƐĞ&ĞĞƐ͟ŵĞĂŶƐƚŚĞdĞĐŚŶŽůŽŐLJ&ĞĞƐ͕ƵƚŚŽƌŝnjĂƚŝŽŶ&ĞĞƐĂŶĚWƌŽŐƌĂŵͬŽŶǀĞŶŝĞŶĐĞ&ĞĞƐĂƐůŝƐƚĞĚŝŶhƐĞ&ĞĞƐ dĂďůĞŝŶ^ĞĐƚŝŽŶϮ͕ƚŝƚůĞĚDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ͘ ͞sŝƌƚƵĂůWĂLJ͟ŵĞĂŶƐƚŚĞWƌŽĚƵĐƚŽĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƚŚĂƚĂůůŽǁƐƚŚĞƵƐƚŽŵĞƌƚŽĂĐĐĞƉƚĂŶĚƉƌŽĐĞƐƐĐŝƚŝnjĞŶ ƵƐĞƌ͛ƐĐƌĞĚŝƚŽƌŽƚŚĞƌƉĂLJŵĞŶƚĐĂƌĚƵƐŝŶŐƚŚĞŶĞƌ'Žǀ^ŽĨƚǁĂƌĞ͘ ;ďͿŽŶĚŝƚŝŽŶƐŽĨhƐĞ͘/ĨĐƵƐƚŽŵĞƌĞůĞĐƚƐƚŽƵƐĞDLJ'ŽǀWĂLJĂŶĚͬŽƌsŝƌƚƵĂůWĂLJƚŚĞĨŽůůŽǁŝŶŐƚĞƌŵƐĂƉƉůLJ͗ ;ϭͿƵƐƚŽŵĞƌŵƵƐƚĂƉƉůLJĨŽƌĂŶĚĂŐƌĞĞƚŽĂDĞƌĐŚĂŶƚŐƌĞĞŵĞŶƚǁŝƚŚWĞƌƐŽůǀĞŶƚ͘ ;ϮͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚŝƚŝnjĞŶhƐĞƌƐǁŝůůďĞƐƵďũĞĐƚƚŽhƐĞ&ĞĞƐĂƐůŝƐƚĞĚŝŶhƐĞ&ĞĞƐƚĂďůĞŝŶ^ĞĐƚŝŽŶϮ͘ ;ϯͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚhƐĞ&ĞĞƐĂƌĞƐĞƉĂƌĂƚĞĨƌŽŵĂŶĚŝŶĚĞƉĞŶĚĞŶƚŽĨDĞƌĐŚĂŶƚ&ĞĞƐ͘ ;ϰͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚƚŚŝƐŐƌĞĞŵĞŶƚĚŽĞƐŶŽƚƌĞƉƌĞƐĞŶƚĂŶLJŵŽĚŝĨŝĐĂƚŝŽŶƚŽƵƐƚŽŵĞƌ͛ƐDĞƌĐŚĂŶƚ ŐƌĞĞŵĞŶƚǁŝƚŚWĞƌƐŽůǀĞŶƚ͘ ;ϱͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚhƐĞ&ĞĞƐĂƌĞĨŽƌƵƐĞŽŶƚŚĞDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJŽŶůŝŶĞƐLJƐƚĞŵĂŶĚǁŝůůŶŽƚďĞ ĚĞƉŽƐŝƚĞĚŽƌŽǁĞĚƚŽƵƐƚŽŵĞƌŝŶĂŶLJǁĂLJ͘ ;ϲͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚDLJ'ŽǀWĂLJ͛ƐĂŶĚsŝƌƚƵĂůWĂLJ͛ƐĂďŝůŝƚLJƚŽĂƐƐĞƐƐhƐĞ&ĞĞƐŝƐĚŝĐƚĂƚĞĚďLJƚŚĞĂƌĚ ƐƐŽĐŝĂƚŝŽŶƐǁŚŽƐĞƌƵůĞƐŵĂLJĐŚĂŶŐĞĂƚĂŶLJƚŝŵĞĂŶĚĨŽƌĂŶLJƌĞĂƐŽŶ͘/ĨDLJ'ŽǀWĂLJĂŶĚͬŽƌsŝƌƚƵĂůWĂLJ͕ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϯ ĨŽƌĂŶLJƌĞĂƐŽŶ͕ĂƌĞƵŶĂďůĞƚŽƉƌŽĐĞƐƐƉĂLJŵĞŶƚƐƵƐŝŶŐhƐĞ&ĞĞƐ͕ƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚ DLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽŶĞŐŽƚŝĂƚĞĂŶĞǁƉƌŝĐŝŶŐŵŽĚĞůǁŝƚŚƵƐƚŽŵĞƌĨŽƌƚŚĞ ĐŽŶƚŝŶƵĞĚƵƐĞŽĨDLJ'ŽǀWĂLJĂŶĚͬŽƌsŝƌƚƵĂůWĂLJ͘ Ϯ͘DLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ&ĞĞƐ͘ƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚƚŚĞhƐĞ&ĞĞƐƐĞƚĨŽƌƚŚŽŶƚŚĞĨŽůůŽǁŝŶŐƉĂŐĞǁŝůůĂƉƉůLJŝĨ ƵƐƚŽŵĞƌĞůĞĐƚƐƚŽƵƐĞDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ͘ h^&^d>&K>>Kt^KEEydW' ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϰ hƐĞ&ĞĞƐ ŶĞƌ'Žǀ͛ƐDLJ'ŽǀWĂLJ;KŶůŝŶĞͬĐĂƌĚͲŶŽƚͲƉƌĞƐĞŶƚƉĂLJŵĞŶƚƐͿΎΎ DLJ'ŽǀWĂLJ;KŶůŝŶĞWĂLJŵĞŶƚƐͿDLJ'ŽǀWĂLJ;KŶůŝŶĞWĂLJŵĞŶƚƐͿ WĞƌĐĞŶƚĂŐĞĂƐĞĚ&ĞĞнdƌĂŶƐĂĐƚŝŽŶ&ĞĞ KƉƚŝŽŶϭ͗ 'ŽǀĞƌŶŵĞŶƚŶƚŝƚLJWĂŝĚ Ϯ͘ϳϵй ΨϬ͘ϮϬ KƉƚŝŽŶϮ͗ WĂƚƌŽŶWĂŝĚ ϯ͘Ϯϵй Eͬ ΎΎ,ƉƌŽĐĞƐƐŝŶŐŝƐĂǀĂŝůĂďůĞĨŽƌĂĨĞĞŽĨΨϮϬƉĞƌŵŽŶƚŚĂŶĚΨϬ͘ϯϬƉĞƌƚƌĂŶƐĂĐƚŝŽŶ͘ ŶĞƌ'Žǀ͛ƐsŝƌƚƵĂůWĂLJ;ƌĞƚĂŝůĐĂƌĚƉƌĞƐĞŶƚͿ sŝƌƚƵĂůWĂLJ;ZĞƚĂŝůWĂLJŵĞŶƚƐͿsŝƌƚƵĂůWĂLJ;ZĞƚĂŝůWĂLJŵĞŶƚƐͿ WĞƌĐĞŶƚĂŐĞĂƐĞĚ&ĞĞнdƌĂŶƐĂĐƚŝŽŶ&ĞĞ KƉƚŝŽŶϭ͗ 'ŽǀĞƌŶŵĞŶƚŶƚŝƚLJWĂŝĚ Ϯ͘ϱϵй ΨϬ͘ϭϱ KƉƚŝŽŶϮ͗ WĂƚƌŽŶWĂŝĚ Ϯ͘ϵϵй Eͬ WĂƚƌŽŶWĂŝĚĨĞĞƐǁŝůůďĞĐŽŵŵƵŶŝĐĂƚĞĚĂƐΗ^ĞƌǀŝĐĞ&ĞĞƐΗƚŽƚŚĞĐĂƌĚŚŽůĚĞƌ͕ĂƚƚŚĞƚŝŵĞŽĨƚƌĂŶƐĂĐƚŝŽŶ͘/ŶƚŚĞ ĞǀĞŶƚƚŚĂƚƚŚĞĂǀĞƌĂŐĞŵŽŶƚŚůLJƚƌĂŶƐĂĐƚŝŽŶĂŵŽƵŶƚŝƐďĞůŽǁΨϯϬ͕ŽŶƚƌĂĐƚŽƌƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽĂƉƉůLJĂŶ ĂĚĚŝƚŝŽŶĂůΨϬ͘ϮϬƐĞƌǀŝĐĞĨĞĞĂďŽǀĞƚŚĞƋƵŽƚĞĚƌĂƚĞƐĂďŽǀĞ͘ ϯ͘/ŶƚĞƌĂĐƚŝǀĞsŽŝĐĞZĞƐƉŽŶƐĞ;͞/sZ͟Ϳ͘/Ĩ/sZŝƐƐĞůĞĐƚĞĚďLJƵƐƚŽŵĞƌĂŶĚŝŶĐůƵĚĞĚŝŶƚŚĞƉƌŝĐŝŶŐ͕ƚŚĞĨŽůůŽǁŝŶŐ ĂĚĚŝƚŝŽŶĂůƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐƐŚĂůůĂƉƉůLJŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͗ ;ĂͿEĞƚǁŽƌŬ^ĞĐƵƌŝƚLJ͘ƵƐƚŽŵĞƌĂĐŬŶŽǁůĞĚŐĞƐƚŚĂƚĂƚŚŝƌĚͲƉĂƌƚLJŝƐƵƐĞĚďLJdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƚŽƉƌŽĐĞƐƐ/sZ ĚĂƚĂ͘ƵƐƚŽŵĞƌ͛ƐĐŽŶƚĞŶƚǁŝůůƉĂƐƐƚŚƌŽƵŐŚĂŶĚďĞƐƚŽƌĞĚŽŶƚŚĞƚŚŝƌĚͲƉĂƌƚLJƐĞƌǀĞƌƐĂŶĚǁŝůůŶŽƚďĞƐĞŐƌĞŐĂƚĞĚ ŽƌŝŶĂƐĞƉĂƌĂƚĞƉŚLJƐŝĐĂůůŽĐĂƚŝŽŶĨƌŽŵƐĞƌǀĞƌƐŽŶǁŚŝĐŚŽƚŚĞƌĐƵƐƚŽŵĞƌƐ͛ĐŽŶƚĞŶƚŝƐŽƌǁŝůůďĞƚƌĂŶƐŵŝƚƚĞĚŽƌ ƐƚŽƌĞĚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϱ ;ďͿŽŶƚĞŶƚ͘ƵƐƚŽŵĞƌŝƐƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞĐƌĞĂƚŝŽŶ͕ĞĚŝƚŽƌŝĂůĐŽŶƚĞŶƚ͕ĐŽŶƚƌŽů͕ĂŶĚĂůůŽƚŚĞƌĂƐƉĞĐƚƐŽĨĐŽŶƚĞŶƚ ƚŽďĞƵƐĞĚƐŽůĞůLJŝŶĐŽŶũƵŶĐƚŝŽŶǁŝƚŚƚŚĞŶĞƌ'Žǀ^ŽĨƚǁĂƌĞ͘ ;ĐͿ>ĂǁĨƵůWƵƌƉŽƐĞƐ͘ƵƐƚŽŵĞƌƐŚĂůůŶŽƚƵƐĞƚŚĞ/sZƐLJƐƚĞŵĨŽƌĂŶLJƵŶůĂǁĨƵůƉƵƌƉŽƐĞ͘ ;ĚͿƌŝƚŝĐĂůƉƉůŝĐĂƚŝŽŶ͘ƵƐƚŽŵĞƌǁŝůůŶŽƚƵƐĞƚŚĞ/sZƐLJƐƚĞŵĨŽƌĂŶLJůŝĨĞͲƐƵƉƉŽƌƚĂƉƉůŝĐĂƚŝŽŶŽƌŽƚŚĞƌĐƌŝƚŝĐĂů ĂƉƉůŝĐĂƚŝŽŶǁŚĞƌĞĨĂŝůƵƌĞŽƌƉŽƚĞŶƚŝĂůĨĂŝůƵƌĞŽĨƚŚĞ/sZƐLJƐƚĞŵĐĂŶĐĂƵƐĞŝŶũƵƌLJ͕ŚĂƌŵ͕ĚĞĂƚŚ͕ŽƌŽƚŚĞƌŐƌĂǀĞ ƉƌŽďůĞŵƐ͕ŝŶĐůƵĚŝŶŐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ůŽƐƐŽĨĂŝƌĐƌĂĨƚĐŽŶƚƌŽů͕ŚŽƐƉŝƚĂůůŝĨĞͲƐƵƉƉŽƌƚƐLJƐƚĞŵ͕ĂŶĚĚĞůĂLJƐŝŶ ŐĞƚƚŝŶŐŵĞĚŝĐĂƚĞĐĂƌĞŽƌŽƚŚĞƌĞŵĞƌŐĞŶĐLJƐĞƌǀŝĐĞƐ͘ ;ĞͿEŽ,ĂƌŵĨƵůŽĚĞ͘ƵƐƚŽŵĞƌƌĞƉƌĞƐĞŶƚƐĂŶĚǁĂƌƌĂŶƚƐƚŚĂƚŶŽ ĐŽŶƚĞŶƚĚĞƐŝŐŶĞĚƚŽĚĞůĞƚĞ͕ĚŝƐĂďůĞ͕ ĚĞĂĐƚŝǀĂƚĞ͕ŝŶƚĞƌĨĞƌĞǁŝƚŚŽƌŽƚŚĞƌǁŝƐĞŚĂƌŵĂŶLJĂƐƉĞĐƚŽĨƚŚĞ/sZƐLJƐƚĞŵŶŽǁŽƌŝŶƚŚĞĨƵƚƵƌĞ͕ƐŚĂůůďĞ ŬŶŽǁŝŶŐůLJƚƌĂŶƐŵŝƚƚĞĚďLJƵƐƚŽŵĞƌŽƌhƐĞƌƐ͘ ;ĨͿ/sZtZZEdz͘džĐĞƉƚĂƐĞdžƉƌĞƐƐůLJƐĞƚĨŽƌƚŚŝŶƚŚŝƐŐƌĞĞŵĞŶƚ͕dz>Zd,EK>K'/^D<^EK ZWZ^Edd/KEEydE^EKtZZEd/^K&Ez</E͕/d,ZyWZ^^KZ/DW>/͕/E>h/E' tZZEd/^K&d/d>͕EKEͲ/E&Z/E'DEd͕DZ,Ed/>/dzKZ&/dE^^&KZWZd/h>ZWhZWK^&KZ /sZ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϲ džŚŝďŝƚ ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬ dK/E^Zd ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϳ ^K&dtZ^^Zs/'ZDEdϮ dŚŝƐ^ŽĨƚǁĂƌĞĂƐĂ^ĞƌǀŝĐĞŐƌĞĞŵĞŶƚŝƐŵĂĚĞďĞƚǁĞĞŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ĂŶĚůŝĞŶƚ͘ t,Z^͕ůŝĞŶƚƐĞůĞĐƚĞĚdLJůĞƌƚŽƉƌŽǀŝĚĞĐĞƌƚĂŝŶƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJ͕ŝŶĐůƵĚŝŶŐƉƌŽǀŝĚŝŶŐůŝĞŶƚǁŝƚŚĂĐĐĞƐƐƚŽdLJůĞƌ͛ƐƉƌŽƉƌŝĞƚĂƌLJƐŽĨƚǁĂƌĞƉƌŽĚƵĐƚƐ͕ĂŶĚdLJůĞƌĚĞƐŝƌĞƐ ƚŽƉƌŽǀŝĚĞƐƵĐŚƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐƵŶĚĞƌƚŚĞƚĞƌŵƐŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͖ EKtd,Z&KZ͕ŝŶĐŽŶƐŝĚĞƌĂƚŝŽŶŽĨƚŚĞĨŽƌĞŐŽŝŶŐĂŶĚŽĨƚŚĞŵƵƚƵĂůĐŽǀĞŶĂŶƚƐĂŶĚƉƌŽŵŝƐĞƐƐĞƚĨŽƌƚŚŝŶ ƚŚŝƐŐƌĞĞŵĞŶƚ͕dLJůĞƌĂŶĚůŝĞŶƚĂŐƌĞĞĂƐĨŽůůŽǁƐ͗ ^d/KEʹ&/E/d/KE^ x͞ŐƌĞĞŵĞŶƚ͟ŵĞĂŶƐƚŚŝƐ^ŽĨƚǁĂƌĞĂƐĂ^ĞƌǀŝĐĞƐŐƌĞĞŵĞŶƚ͘ x͞ƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJ͟ŵĞĂŶƐŽƵƌďƵƐŝŶĞƐƐƚƌĂǀĞůƉŽůŝĐLJ͘ĐŽƉLJŽĨŽƵƌĐƵƌƌĞŶƚƵƐŝŶĞƐƐ dƌĂǀĞůWŽůŝĐLJŝƐĂƚƚĂĐŚĞĚĂƐ^ĐŚĞĚƵůĞϭƚŽdžŚŝďŝƚ͘ x͞ůŝĞŶƚ͟ŵĞĂŶƐ/E^Zd>/EdED͘ x͞ĂƚĂ͟ŵĞĂŶƐLJŽƵƌĚĂƚĂŶĞĐĞƐƐĂƌLJƚŽƵƚŝůŝnjĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͘ x͞ĂƚĂ^ƚŽƌĂŐĞĂƉĂĐŝƚLJ͟ŵĞĂŶƐƚŚĞĐŽŶƚƌĂĐƚĞĚĂŵŽƵŶƚŽĨƐƚŽƌĂŐĞĐĂƉĂĐŝƚLJĨŽƌLJŽƵƌĂƚĂ ŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ x͞ĞĨĞĐƚ͟ŵĞĂŶƐĂĨĂŝůƵƌĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞƚŽƐƵďƐƚĂŶƚŝĂůůLJĐŽŶĨŽƌŵƚŽƚŚĞĨƵŶĐƚŝŽŶĂů ĚĞƐĐƌŝƉƚŝŽŶƐƐĞƚĨŽƌƚŚŝŶŽƵƌǁƌŝƚƚĞŶƉƌŽƉŽƐĂůƚŽLJŽƵ͕ŽƌƚŚĞŝƌĨƵŶĐƚŝŽŶĂůĞƋƵŝǀĂůĞŶƚ͘&ƵƚƵƌĞ ĨƵŶĐƚŝŽŶĂůŝƚLJŵĂLJďĞƵƉĚĂƚĞĚ͕ŵŽĚŝĨŝĞĚ͕ŽƌŽƚŚĞƌǁŝƐĞĞŶŚĂŶĐĞĚƚŚƌŽƵŐŚŽƵƌŵĂŝŶƚĞŶĂŶĐĞ ĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ĂŶĚƚŚĞŐŽǀĞƌŶŝŶŐĨƵŶĐƚŝŽŶĂůĚĞƐĐƌŝƉƚŝŽŶƐĨŽƌƐƵĐŚĨƵƚƵƌĞĨƵŶĐƚŝŽŶĂůŝƚLJ ǁŝůůďĞƐĞƚĨŽƌƚŚŝŶŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚŽĐƵŵĞŶƚĂƚŝŽŶ͘ x͞ĞĨŝŶĞĚhƐĞƌƐ͟ŵĞĂŶƐƚŚĞŶƵŵďĞƌŽĨƵƐĞƌƐƚŚĂƚĂƌĞĂƵƚŚŽƌŝnjĞĚƚŽƵƐĞƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ͘ dŚĞĞĨŝŶĞĚhƐĞƌƐĨŽƌƚŚĞŐƌĞĞŵĞŶƚĂƌĞĂƐŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ x͞ĞǀĞůŽƉĞƌ͟ŵĞĂŶƐĂƚŚŝƌĚƉĂƌƚLJǁŚŽŽǁŶƐƚŚĞŝŶƚĞůůĞĐƚƵĂůƉƌŽƉĞƌƚLJƌŝŐŚƚƐƚŽdŚŝƌĚWĂƌƚLJ ^ŽĨƚǁĂƌĞ͘ x͞ŽĐƵŵĞŶƚĂƚŝŽŶ͟ŵĞĂŶƐĂŶLJŽŶůŝŶĞŽƌǁƌŝƚƚĞŶĚŽĐƵŵĞŶƚĂƚŝŽŶƌĞůĂƚĞĚƚŽƚŚĞƵƐĞŽƌ ĨƵŶĐƚŝŽŶĂůŝƚLJŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞƚŚĂƚǁĞƉƌŽǀŝĚĞŽƌŽƚŚĞƌǁŝƐĞŵĂŬĞĂǀĂŝůĂďůĞƚŽLJŽƵ͕ ŝŶĐůƵĚŝŶŐŝŶƐƚƌƵĐƚŝŽŶƐ͕ƵƐĞƌŐƵŝĚĞƐ͕ŵĂŶƵĂůƐĂŶĚŽƚŚĞƌƚƌĂŝŶŝŶŐŽƌƐĞůĨͲŚĞůƉĚŽĐƵŵĞŶƚĂƚŝŽŶ͘ x͞ĨĨĞĐƚŝǀĞĂƚĞ͟ŵĞĂŶƐƚŚĞĚĂƚĞďLJǁŚŝĐŚďŽƚŚLJŽƵƌĂŶĚŽƵƌĂƵƚŚŽƌŝnjĞĚƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐ ŚĂǀĞƐŝŐŶĞĚƚŚĞŐƌĞĞŵĞŶƚ͘ Ϯ,/',>/',dWZKs/^/KE^/E/dWZKs/^/KE^d,dDzKZDzEKdWW>zdKd,WZd/h>Z >/EdͬKEdZd͘hZ/E'KEdZdE'Kd/d/KE^͕d,K^WZKs/^/KE^t/>>:h^d^ E^^Zz͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϴ x͞&ŽƌĐĞDĂũĞƵƌĞ͟ŵĞĂŶƐĂŶĞǀĞŶƚďĞLJŽŶĚƚŚĞƌĞĂƐŽŶĂďůĞĐŽŶƚƌŽůŽĨLJŽƵŽƌƵƐ͕ŝŶĐůƵĚŝŶŐ͕ ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ŐŽǀĞƌŶŵĞŶƚĂůĂĐƚŝŽŶ͕ǁĂƌ͕ƌŝŽƚŽƌĐŝǀŝůĐŽŵŵŽƚŝŽŶ͕ĨŝƌĞ͕ŶĂƚƵƌĂůĚŝƐĂƐƚĞƌ͕ ŽƌĂŶLJŽƚŚĞƌĐĂƵƐĞƚŚĂƚĐŽƵůĚŶŽƚǁŝƚŚƌĞĂƐŽŶĂďůĞĚŝůŝŐĞŶĐĞďĞĨŽƌĞƐĞĞŶŽƌƉƌĞǀĞŶƚĞĚďLJ LJŽƵŽƌƵƐ͘ x͞/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͟ŵĞĂŶƐƚŚĞĂŐƌĞĞĚƵƉŽŶĐŽƐƚƉƌŽƉŽƐĂůĨŽƌƚŚĞƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐ ĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͟ŵĞĂŶƐƚŚĞŝŶǀŽŝĐŝŶŐĂŶĚƉĂLJŵĞŶƚƉŽůŝĐLJ͘ĐŽƉLJŽĨŽƵƌ ĐƵƌƌĞŶƚ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJŝƐĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞^ĂĂ^&ĞĞƐ͟ŵĞĂŶƐƚŚĞĨĞĞƐĨŽƌƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ x͞^ĂĂ^^ĞƌǀŝĐĞƐ͟ŵĞĂŶƐƐŽĨƚǁĂƌĞĂƐĂƐĞƌǀŝĐĞĐŽŶƐŝƐƚŝŶŐŽĨƐLJƐƚĞŵĂĚŵŝŶŝƐƚƌĂƚŝŽŶ͕ƐLJƐƚĞŵ ŵĂŶĂŐĞŵĞŶƚ͕ĂŶĚƐLJƐƚĞŵŵŽŶŝƚŽƌŝŶŐĂĐƚŝǀŝƚŝĞƐƚŚĂƚdLJůĞƌƉĞƌĨŽƌŵƐĨŽƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ ĂŶĚŝŶĐůƵĚĞƐƚŚĞƌŝŐŚƚƚŽĂĐĐĞƐƐĂŶĚƵƐĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ƌĞĐĞŝǀĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚ ƐƵƉƉŽƌƚŽŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ŝŶĐůƵĚŝŶŐŽǁŶƚŝŵĞƌĞƐŽůƵƚŝŽŶƵŶĚĞƌƚŚĞƚĞƌŵƐŽĨƚŚĞ^>͕ ĂŶĚĂƚĂƐƚŽƌĂŐĞĂŶĚĂƌĐŚŝǀŝŶŐ͘^ĂĂ^^ĞƌǀŝĐĞƐĚŽŶŽƚŝŶĐůƵĚĞƐƵƉƉŽƌƚŽĨĂŶŽƉĞƌĂƚŝŶŐ ƐLJƐƚĞŵŽƌŚĂƌĚǁĂƌĞ͕ƐƵƉƉŽƌƚŽƵƚƐŝĚĞŽĨŽƵƌŶŽƌŵĂůďƵƐŝŶĞƐƐŚŽƵƌƐ͕ŽƌƚƌĂŝŶŝŶŐ͕ĐŽŶƐƵůƚŝŶŐŽƌ ŽƚŚĞƌƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐ͘ x͞^>͟ŵĞĂŶƐƚŚĞƐĞƌǀŝĐĞůĞǀĞůĂŐƌĞĞŵĞŶƚ͘ĐŽƉLJŽĨŽƵƌĐƵƌƌĞŶƚ^>ŝƐĂƚƚĂĐŚĞĚŚĞƌĞƚŽĂƐ džŚŝďŝƚ͘ x͞^ƚĂƚĞŵĞŶƚŽĨtŽƌŬ͟ŵĞĂŶƐƚŚĞŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚŝŵƉůĞŵĞŶƚĂƚŝŽŶƉůĂŶĚĞƐĐƌŝďŝŶŐŚŽǁŽƵƌ ƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐǁŝůůďĞƉƌŽǀŝĚĞĚƚŽŝŵƉůĞŵĞŶƚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂŶĚŽƵƚůŝŶŝŶŐLJŽƵƌ ĂŶĚŽƵƌƌŽůĞƐĂŶĚƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐŝŶĐŽŶŶĞĐƚŝŽŶǁŝƚŚƚŚĂƚŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dŚĞ^ƚĂƚĞŵĞŶƚ ŽĨtŽƌŬŝƐĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͟ŵĞĂŶƐƚŚĞƐƵƉƉŽƌƚĐĂůůƉƌŽĐĞƐƐĂƉƉůŝĐĂďůĞƚŽĂůůŽĨŽƵƌĐƵƐƚŽŵĞƌƐ ǁŚŽŚĂǀĞůŝĐĞŶƐĞĚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͘ĐŽƉLJŽĨŽƵƌĐƵƌƌĞŶƚ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐŝƐ ĂƚƚĂĐŚĞĚĂƐ^ĐŚĞĚƵůĞϭƚŽdžŚŝďŝƚ͘ x͞dŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͟ŵĞĂŶƐƚŚĞƚŚŝƌĚƉĂƌƚLJŚĂƌĚǁĂƌĞ͕ŝĨĂŶLJ͕ŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ x͞dŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͟ŵĞĂŶƐƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞĂŶĚdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͘ x͞dŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͟ŵĞĂŶƐƚŚĞƚŚŝƌĚƉĂƌƚLJƐĞƌǀŝĐĞƐ͕ŝĨĂŶLJ͕ŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJ͘ x͞dŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͟ŵĞĂŶƐƚŚĞƚŚŝƌĚƉĂƌƚLJƐŽĨƚǁĂƌĞ͕ŝĨĂŶLJ͕ŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ ^ƵŵŵĂƌLJ͘ x͞dŚŝƌĚWĂƌƚLJdĞƌŵƐ͟ŵĞĂŶƐ͕ŝĨĂŶLJ͕ƚŚĞĞŶĚƵƐĞƌůŝĐĞŶƐĞĂŐƌĞĞŵĞŶƚ;ƐͿŽƌƐŝŵŝůĂƌƚĞƌŵƐĨŽƌ ƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͕ĂƐĂƉƉůŝĐĂďůĞĂŶĚĂƚƚĂĐŚĞĚĂƐdžŚŝďŝƚ͘ x͞dLJůĞƌ͟ŵĞĂŶƐdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͕͘ĂĞůĂǁĂƌĞĐŽƌƉŽƌĂƚŝŽŶ͘ x͞dLJůĞƌ^ŽĨƚǁĂƌĞ͟ŵĞĂŶƐŽƵƌƉƌŽƉƌŝĞƚĂƌLJƐŽĨƚǁĂƌĞ͕ŝŶĐůƵĚŝŶŐĂŶLJŝŶƚĞŐƌĂƚŝŽŶƐ͕ĐƵƐƚŽŵ ŵŽĚŝĨŝĐĂƚŝŽŶƐ͕ĂŶĚͬŽƌŽƚŚĞƌƌĞůĂƚĞĚŝŶƚĞƌĨĂĐĞƐŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂŶĚ ůŝĐĞŶƐĞĚďLJƵƐƚŽLJŽƵƚŚƌŽƵŐŚƚŚŝƐŐƌĞĞŵĞŶƚ͘ x͞ǁĞ͕͟͞ƵƐ͕͟͞ŽƵƌ͟ĂŶĚƐŝŵŝůĂƌƚĞƌŵƐŵĞĂŶdLJůĞƌ͘ x͞LJŽƵ͟ĂŶĚƐŝŵŝůĂƌƚĞƌŵƐŵĞĂŶůŝĞŶƚ͘ ^d/KEʹ^^^Zs/^ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϲϵ ϭ͘ZŝŐŚƚƐ'ƌĂŶƚĞĚ͘tĞŐƌĂŶƚƚŽLJŽƵƚŚĞŶŽŶͲĞdžĐůƵƐŝǀĞ͕ŶŽŶͲĂƐƐŝŐŶĂďůĞůŝŵŝƚĞĚƌŝŐŚƚƚŽƵƐĞƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ ƐŽůĞůLJĨŽƌLJŽƵƌŝŶƚĞƌŶĂůďƵƐŝŶĞƐƐƉƵƌƉŽƐĞƐĨŽƌƚŚĞŶƵŵďĞƌŽĨĞĨŝŶĞĚhƐĞƌƐŽŶůLJ͘dŚĞdLJůĞƌ^ŽĨƚǁĂƌĞǁŝůů ďĞŵĂĚĞĂǀĂŝůĂďůĞƚŽLJŽƵĂĐĐŽƌĚŝŶŐƚŽƚŚĞƚĞƌŵƐŽĨƚŚĞ^>͘zŽƵĂĐŬŶŽǁůĞĚŐĞƚŚĂƚǁĞŚĂǀĞŶŽĚĞůŝǀĞƌLJ ŽďůŝŐĂƚŝŽŶƐĂŶĚǁĞǁŝůůŶŽƚƐŚŝƉĐŽƉŝĞƐŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂƐƉĂƌƚŽĨƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ͘zŽƵŵĂLJƵƐĞ ƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐƚŽĂĐĐĞƐƐƵƉĚĂƚĞƐĂŶĚĞŶŚĂŶĐĞŵĞŶƚƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂƐĨƵƌƚŚĞƌĚĞƐĐƌŝďĞĚŝŶ ^ĞĐƚŝŽŶ;ϵͿ͘dŚĞĨŽƌĞŐŽŝŶŐŶŽƚǁŝƚŚƐƚĂŶĚŝŶŐ͕ƚŽƚŚĞĞdžƚĞŶƚǁĞŚĂǀĞƐŽůĚLJŽƵƉĞƌƉĞƚƵĂůůŝĐĞŶƐĞƐĨŽƌdLJůĞƌ ^ŽĨƚǁĂƌĞ͕ŝĨĂŶĚůŝƐƚĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͕ĨŽƌǁŚŝĐŚLJŽƵĂƌĞƌĞĐĞŝǀŝŶŐ^ĂĂ^^ĞƌǀŝĐĞƐ͕LJŽƵƌƌŝŐŚƚƐ ƚŽƵƐĞƐƵĐŚdLJůĞƌ^ŽĨƚǁĂƌĞĂƌĞƉĞƌƉĞƚƵĂů͕ƐƵďũĞĐƚƚŽƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐŽĨƚŚŝƐŐƌĞĞŵĞŶƚ ŝŶĐůƵĚŝŶŐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕^ĞĐƚŝŽŶ;ϰͿ͘tĞǁŝůůŵĂŬĞĂŶLJƐƵĐŚƐŽĨƚǁĂƌĞĂǀĂŝůĂďůĞƚŽLJŽƵĨŽƌ ĚŽǁŶůŽĂĚ͘ Ϯ͘^ĂĂ^&ĞĞƐ͘zŽƵĂŐƌĞĞƚŽƉĂLJƵƐƚŚĞ^ĂĂ^&ĞĞƐ͘dŚŽƐĞĂŵŽƵŶƚƐĂƌĞƉĂLJĂďůĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌ /ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͘dŚĞ^ĂĂ^&ĞĞƐĂƌĞďĂƐĞĚŽŶƚŚĞŶƵŵďĞƌŽĨĞĨŝŶĞĚhƐĞƌƐĂŶĚĂŵŽƵŶƚŽĨ ĂƚĂ^ƚŽƌĂŐĞĂƉĂĐŝƚLJ͘zŽƵŵĂLJĂĚĚĂĚĚŝƚŝŽŶĂůƵƐĞƌƐŽƌĂĚĚŝƚŝŽŶĂůĚĂƚĂƐƚŽƌĂŐĞĐĂƉĂĐŝƚLJŽŶƚŚĞƚĞƌŵƐ ƐĞƚĨŽƌƚŚŝŶ^ĞĐƚŝŽŶ,;ϭͿ͘/ŶƚŚĞĞǀĞŶƚLJŽƵƌĞŐƵůĂƌůLJĂŶĚͬŽƌŵĞĂŶŝŶŐĨƵůůLJĞdžĐĞĞĚƚŚĞĞĨŝŶĞĚhƐĞƌƐŽƌ ĂƚĂ^ƚŽƌĂŐĞĂƉĂĐŝƚLJ͕ǁĞƌĞƐĞƌǀĞƚŚĞƌŝŐŚƚƚŽĐŚĂƌŐĞLJŽƵĂĚĚŝƚŝŽŶĂůĨĞĞƐĐŽŵŵĞŶƐƵƌĂƚĞǁŝƚŚƚŚĞ ŽǀĞƌĂŐĞ;ƐͿ͘ ϯ͘KǁŶĞƌƐŚŝƉ͘ ϯ͘ϭtĞƌĞƚĂŝŶĂůůŽǁŶĞƌƐŚŝƉĂŶĚŝŶƚĞůůĞĐƚƵĂůƉƌŽƉĞƌƚLJƌŝŐŚƚƐƚŽƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ͕ƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂŶĚ ĂŶLJƚŚŝŶŐĚĞǀĞůŽƉĞĚďLJƵƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘zŽƵĚŽŶŽƚĂĐƋƵŝƌĞƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚĂŶLJ ůŝĐĞŶƐĞƚŽƵƐĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝŶĞdžĐĞƐƐŽĨƚŚĞƐĐŽƉĞĂŶĚͬŽƌĚƵƌĂƚŝŽŶŽĨƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ͘ ϯ͘ϮdŚĞŽĐƵŵĞŶƚĂƚŝŽŶŝƐůŝĐĞŶƐĞĚƚŽLJŽƵĂŶĚŵĂLJďĞƵƐĞĚĂŶĚĐŽƉŝĞĚďLJLJŽƵƌĞŵƉůŽLJĞĞƐĨŽƌŝŶƚĞƌŶĂů͕ ŶŽŶͲĐŽŵŵĞƌĐŝĂůƌĞĨĞƌĞŶĐĞƉƵƌƉŽƐĞƐŽŶůLJ͘ ϯ͘ϯzŽƵƌĞƚĂŝŶĂůůŽǁŶĞƌƐŚŝƉĂŶĚŝŶƚĞůůĞĐƚƵĂůƉƌŽƉĞƌƚLJƌŝŐŚƚƐƚŽƚŚĞĂƚĂ͘zŽƵĞdžƉƌĞƐƐůLJƌĞĐŽŐŶŝnjĞƚŚĂƚ ĞdžĐĞƉƚƚŽƚŚĞĞdžƚĞŶƚŶĞĐĞƐƐĂƌLJƚŽĐĂƌƌLJŽƵƚŽƵƌŽďůŝŐĂƚŝŽŶƐĐŽŶƚĂŝŶĞĚŝŶƚŚŝƐŐƌĞĞŵĞŶƚ͕ǁĞĚŽŶŽƚ ĐƌĞĂƚĞŽƌĞŶĚŽƌƐĞĂŶLJĂƚĂƵƐĞĚŝŶĐŽŶŶĞĐƚŝŽŶǁŝƚŚƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ͘ ϰ͘ZĞƐƚƌŝĐƚŝŽŶƐ͘zŽƵŵĂLJŶŽƚ͗;ĂͿŵĂŬĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŽƌŽĐƵŵĞŶƚĂƚŝŽŶƌĞƐƵůƚŝŶŐĨƌŽŵƚŚĞ^ĂĂ^ ^ĞƌǀŝĐĞƐĂǀĂŝůĂďůĞŝŶĂŶLJŵĂŶŶĞƌƚŽĂŶLJƚŚŝƌĚƉĂƌƚLJĨŽƌƵƐĞŝŶƚŚĞƚŚŝƌĚƉĂƌƚLJ͛ƐďƵƐŝŶĞƐƐŽƉĞƌĂƚŝŽŶƐ͖;ďͿ ŵŽĚŝĨLJ͕ŵĂŬĞĚĞƌŝǀĂƚŝǀĞǁŽƌŬƐŽĨ͕ĚŝƐĂƐƐĞŵďůĞ͕ƌĞǀĞƌƐĞĐŽŵƉŝůĞ͕ŽƌƌĞǀĞƌƐĞĞŶŐŝŶĞĞƌĂŶLJƉĂƌƚŽĨƚŚĞ ^ĂĂ^^ĞƌǀŝĐĞƐ͖;ĐͿĂĐĐĞƐƐŽƌƵƐĞƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐŝŶŽƌĚĞƌƚŽďƵŝůĚŽƌƐƵƉƉŽƌƚ͕ĂŶĚͬŽƌĂƐƐŝƐƚĂƚŚŝƌĚƉĂƌƚLJ ŝŶďƵŝůĚŝŶŐŽƌƐƵƉƉŽƌƚŝŶŐ͕ƉƌŽĚƵĐƚƐŽƌƐĞƌǀŝĐĞƐĐŽŵƉĞƚŝƚŝǀĞƚŽƵƐ͖Žƌ;ĚͿůŝĐĞŶƐĞ͕ƐĞůů͕ƌĞŶƚ͕ůĞĂƐĞ͕ƚƌĂŶƐĨĞƌ͕ ĂƐƐŝŐŶ͕ĚŝƐƚƌŝďƵƚĞ͕ĚŝƐƉůĂLJ͕ŚŽƐƚ͕ŽƵƚƐŽƵƌĐĞ͕ĚŝƐĐůŽƐĞ͕ƉĞƌŵŝƚƚŝŵĞƐŚĂƌŝŶŐŽƌƐĞƌǀŝĐĞďƵƌĞĂƵƵƐĞ͕Žƌ ŽƚŚĞƌǁŝƐĞĐŽŵŵĞƌĐŝĂůůLJĞdžƉůŽŝƚŽƌŵĂŬĞƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ͕dLJůĞƌ^ŽĨƚǁĂƌĞ͕ŽƌŽĐƵŵĞŶƚĂƚŝŽŶĂǀĂŝůĂďůĞ ƚŽĂŶLJƚŚŝƌĚƉĂƌƚLJŽƚŚĞƌƚŚĂŶĂƐĞdžƉƌĞƐƐůLJƉĞƌŵŝƚƚĞĚďLJƚŚŝƐŐƌĞĞŵĞŶƚ͘ ϱ͘^ŽĨƚǁĂƌĞtĂƌƌĂŶƚLJ͘tĞǁĂƌƌĂŶƚƚŚĂƚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞǁŝůůƉĞƌĨŽƌŵǁŝƚŚŽƵƚĞĨĞĐƚƐĚƵƌŝŶŐƚŚĞƚĞƌŵŽĨ ƚŚŝƐŐƌĞĞŵĞŶƚ͘/ĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĚŽĞƐŶŽƚƉĞƌĨŽƌŵĂƐǁĂƌƌĂŶƚĞĚ͕ǁĞǁŝůůƵƐĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐ͕ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚƐ͕ƚŽĐƵƌĞƚŚĞĞĨĞĐƚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚ ƉƌŽĐĞƐƐƐĞƚĨŽƌƚŚŝŶ^ĞĐƚŝŽŶ;ϵͿ͕ďĞůŽǁ͕ƚŚĞ^>ĂŶĚŽƵƌƚŚĞŶĐƵƌƌĞŶƚ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͘ ϲ͘^ĂĂ^^ĞƌǀŝĐĞƐ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϬ ϲ͘ϭKƵƌ^ĂĂ^^ĞƌǀŝĐĞƐĂƌĞĂƵĚŝƚĞĚĂƚůĞĂƐƚLJĞĂƌůLJŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞ/W͛Ɛ^ƚĂƚĞŵĞŶƚŽŶ^ƚĂŶĚĂƌĚƐ ĨŽƌƚƚĞƐƚĂƚŝŽŶŶŐĂŐĞŵĞŶƚƐ;͞^^͟ͿEŽ͘ϭϴ͘tĞŚĂǀĞĂƚƚĂŝŶĞĚ͕ĂŶĚǁŝůůŵĂŝŶƚĂŝŶ͕^KϭĂŶĚ^KϮ ĐŽŵƉůŝĂŶĐĞ͕ŽƌŝƚƐĞƋƵŝǀĂůĞŶƚ͕ĨŽƌƐŽůŽŶŐĂƐLJŽƵĂƌĞƚŝŵĞůLJƉĂLJŝŶŐĨŽƌ^ĂĂ^^ĞƌǀŝĐĞƐ͘hƉŽŶĞdžĞĐƵƚŝŽŶ ŽĨĂŵƵƚƵĂůůLJĂŐƌĞĞĂďůĞEŽŶͲŝƐĐůŽƐƵƌĞŐƌĞĞŵĞŶƚ;͞E͟Ϳ͕ǁĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚĂƐƵŵŵĂƌLJŽĨ ŽƵƌĐŽŵƉůŝĂŶĐĞƌĞƉŽƌƚ;ƐͿŽƌŝƚƐĞƋƵŝǀĂůĞŶƚ͘ǀĞƌLJLJĞĂƌƚŚĞƌĞĂĨƚĞƌ͕ĨŽƌƐŽůŽŶŐĂƐƚŚĞEŝƐŝŶĞĨĨĞĐƚ ĂŶĚŝŶǁŚŝĐŚLJŽƵŵĂŬĞĂǁƌŝƚƚĞŶƌĞƋƵĞƐƚ͕ǁĞǁŝůůƉƌŽǀŝĚĞƚŚĂƚƐĂŵĞŝŶĨŽƌŵĂƚŝŽŶ͘ ϲ͘ϮzŽƵǁŝůůďĞŚŽƐƚĞĚŽŶƐŚĂƌĞĚŚĂƌĚǁĂƌĞŝŶĂdLJůĞƌĚĂƚĂĐĞŶƚĞƌŽƌŝŶĂƚŚŝƌĚͲƉĂƌƚLJĚĂƚĂĐĞŶƚĞƌ͘/Ŷ ĞŝƚŚĞƌĞǀĞŶƚ͕ĚĂƚĂďĂƐĞƐĐŽŶƚĂŝŶŝŶŐLJŽƵƌĂƚĂǁŝůůďĞĚĞĚŝĐĂƚĞĚƚŽLJŽƵĂŶĚŝŶĂĐĐĞƐƐŝďůĞƚŽŽƵƌŽƚŚĞƌ ĐƵƐƚŽŵĞƌƐ͘ ϲ͘ϯKƵƌdLJůĞƌĚĂƚĂĐĞŶƚĞƌƐŚĂǀĞĨƵůůLJͲƌĞĚƵŶĚĂŶƚƚĞůĞĐŽŵŵƵŶŝĐĂƚŝŽŶƐĂĐĐĞƐƐ͕ĞůĞĐƚƌŝĐĂůƉŽǁĞƌ͕ĂŶĚƚŚĞ ƌĞƋƵŝƌĞĚŚĂƌĚǁĂƌĞƚŽƉƌŽǀŝĚĞĂĐĐĞƐƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝŶƚŚĞĞǀĞŶƚŽĨĂĚŝƐĂƐƚĞƌŽƌĐŽŵƉŽŶĞŶƚ ĨĂŝůƵƌĞ͘/ŶƚŚĞĞǀĞŶƚĂŶLJŽĨLJŽƵƌĂƚĂŚĂƐďĞĞŶůŽƐƚŽƌĚĂŵĂŐĞĚĚƵĞƚŽĂŶĂĐƚŽƌŽŵŝƐƐŝŽŶŽĨdLJůĞƌŽƌ ŝƚƐƐƵďĐŽŶƚƌĂĐƚŽƌƐŽƌĚƵĞƚŽĂĚĞĨĞĐƚŝŶdLJůĞƌ͛ƐƐŽĨƚǁĂƌĞ͕ǁĞǁŝůůƵƐĞďĞƐƚĐŽŵŵĞƌĐŝĂůĞĨĨŽƌƚƐƚŽ ƌĞƐƚŽƌĞĂůůƚŚĞĂƚĂŽŶƐĞƌǀĞƌƐŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞĂƌĐŚŝƚĞĐƚƵƌĂůĚĞƐŝŐŶ͛ƐĐĂƉĂďŝůŝƚŝĞƐĂŶĚǁŝƚŚƚŚĞ ŐŽĂůŽĨŵŝŶŝŵŝnjŝŶŐĂŶLJĂƚĂůŽƐƐĂƐŐƌĞĂƚůLJĂƐƉŽƐƐŝďůĞ͘/ŶŶŽĐĂƐĞƐŚĂůůƚŚĞƌĞĐŽǀĞƌLJƉŽŝŶƚŽďũĞĐƚŝǀĞ ;͞ZWK͟ͿĞdžĐĞĞĚĂŵĂdžŝŵƵŵŽĨƚǁĞŶƚLJͲĨŽƵƌ;ϮϰͿŚŽƵƌƐĨƌŽŵĚĞĐůĂƌĂƚŝŽŶŽĨĚŝƐĂƐƚĞƌ͘&ŽƌƉƵƌƉŽƐĞƐŽĨ ƚŚŝƐƐƵďƐĞĐƚŝŽŶ͕ZWKƌĞƉƌĞƐĞŶƚƐƚŚĞŵĂdžŝŵƵŵƚŽůĞƌĂďůĞƉĞƌŝŽĚĚƵƌŝŶŐǁŚŝĐŚLJŽƵƌĂƚĂŵĂLJďĞůŽƐƚ͕ ŵĞĂƐƵƌĞĚŝŶƌĞůĂƚŝŽŶƚŽĂĚŝƐĂƐƚĞƌǁĞĚĞĐůĂƌĞ͕ƐĂŝĚĚĞĐůĂƌĂƚŝŽŶǁŝůůŶŽƚďĞƵŶƌĞĂƐŽŶĂďůLJǁŝƚŚŚĞůĚ͘ ϲ͘ϰ/ŶƚŚĞĞǀĞŶƚǁĞĚĞĐůĂƌĞĂĚŝƐĂƐƚĞƌ͕ŽƵƌZĞĐŽǀĞƌLJdŝŵĞKďũĞĐƚŝǀĞ;͞ZdK͟ͿŝƐƚǁĞŶƚLJͲĨŽƵƌ;ϮϰͿŚŽƵƌƐ͘ &ŽƌƉƵƌƉŽƐĞƐŽĨƚŚŝƐƐƵďƐĞĐƚŝŽŶ͕ZdKƌĞƉƌĞƐĞŶƚƐƚŚĞĂŵŽƵŶƚŽĨƚŝŵĞ͕ĂĨƚĞƌǁĞĚĞĐůĂƌĞĂĚŝƐĂƐƚĞƌ͕ ǁŝƚŚŝŶǁŚŝĐŚLJŽƵƌĂĐĐĞƐƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŵƵƐƚďĞƌĞƐƚŽƌĞĚ͘ ϲ͘ϱtĞĐŽŶĚƵĐƚĂŶŶƵĂůƉĞŶĞƚƌĂƚŝŽŶƚĞƐƚŝŶŐŽĨĞŝƚŚĞƌƚŚĞƉƌŽĚƵĐƚŝŽŶŶĞƚǁŽƌŬĂŶĚͬŽƌǁĞďĂƉƉůŝĐĂƚŝŽŶƚŽ ďĞƉĞƌĨŽƌŵĞĚ͘tĞǁŝůůŵĂŝŶƚĂŝŶŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚŝŶƚƌƵƐŝŽŶĚĞƚĞĐƚŝŽŶĂŶĚƉƌĞǀĞŶƚŝŽŶƐLJƐƚĞŵƐƚŽ ŵŽŶŝƚŽƌŵĂůŝĐŝŽƵƐĂĐƚŝǀŝƚLJŝŶƚŚĞŶĞƚǁŽƌŬĂŶĚƚŽůŽŐĂŶĚďůŽĐŬĂŶLJƐƵĐŚĂĐƚŝǀŝƚLJ͘tĞǁŝůůƉƌŽǀŝĚĞLJŽƵ ǁŝƚŚĂǁƌŝƚƚĞŶŽƌĞůĞĐƚƌŽŶŝĐƌĞĐŽƌĚŽĨƚŚĞĂĐƚŝŽŶƐƚĂŬĞŶďLJƵƐŝŶƚŚĞĞǀĞŶƚƚŚĂƚĂŶLJƵŶĂƵƚŚŽƌŝnjĞĚ ĂĐĐĞƐƐƚŽLJŽƵƌĚĂƚĂďĂƐĞ;ƐͿŝƐĚĞƚĞĐƚĞĚĂƐĂƌĞƐƵůƚŽĨŽƵƌƐĞĐƵƌŝƚLJƉƌŽƚŽĐŽůƐ͘tĞǁŝůůƵŶĚĞƌƚĂŬĞĂŶ ĂĚĚŝƚŝŽŶĂůƐĞĐƵƌŝƚLJĂƵĚŝƚ͕ŽŶƚĞƌŵƐĂŶĚƚŝŵŝŶŐƚŽďĞŵƵƚƵĂůůLJĂŐƌĞĞĚƚŽďLJƚŚĞƉĂƌƚŝĞƐ͕ĂƚLJŽƵƌ ǁƌŝƚƚĞŶƌĞƋƵĞƐƚ͘zŽƵŵĂLJŶŽƚĂƚƚĞŵƉƚƚŽďLJƉĂƐƐŽƌƐƵďǀĞƌƚƐĞĐƵƌŝƚLJƌĞƐƚƌŝĐƚŝŽŶƐŝŶƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ ŽƌĞŶǀŝƌŽŶŵĞŶƚƐƌĞůĂƚĞĚƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͘hŶĂƵƚŚŽƌŝnjĞĚĂƚƚĞŵƉƚƐƚŽĂĐĐĞƐƐĨŝůĞƐ͕ƉĂƐƐǁŽƌĚƐŽƌ ŽƚŚĞƌĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶ͕ĂŶĚƵŶĂƵƚŚŽƌŝnjĞĚǀƵůŶĞƌĂďŝůŝƚLJĂŶĚƉĞŶĞƚƌĂƚŝŽŶƚĞƐƚƐĐĂŶŶŝŶŐŽĨŽƵƌ ŶĞƚǁŽƌŬĂŶĚƐLJƐƚĞŵƐ;ŚŽƐƚĞĚŽƌŽƚŚĞƌǁŝƐĞͿŝƐƉƌŽŚŝďŝƚĞĚǁŝƚŚŽƵƚƚŚĞƉƌŝŽƌǁƌŝƚƚĞŶĂƉƉƌŽǀĂůŽĨŽƵƌ/d ^ĞĐƵƌŝƚLJKĨĨŝĐĞƌ͘ ϲ͘ϲtĞƚĞƐƚŽƵƌĚŝƐĂƐƚĞƌƌĞĐŽǀĞƌLJƉůĂŶŽŶĂŶĂŶŶƵĂůďĂƐŝƐ͘KƵƌƐƚĂŶĚĂƌĚƚĞƐƚŝƐŶŽƚĐůŝĞŶƚͲƐƉĞĐŝĨŝĐ͘ ^ŚŽƵůĚLJŽƵƌĞƋƵĞƐƚĂĐůŝĞŶƚͲƐƉĞĐŝĨŝĐĚŝƐĂƐƚĞƌƌĞĐŽǀĞƌLJƚĞƐƚ͕ǁĞǁŝůůǁŽƌŬǁŝƚŚLJŽƵƚŽƐĐŚĞĚƵůĞĂŶĚ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϭ ĞdžĞĐƵƚĞƐƵĐŚĂƚĞƐƚŽŶĂŵƵƚƵĂůůLJĂŐƌĞĞĂďůĞƐĐŚĞĚƵůĞ͘ƚLJŽƵƌǁƌŝƚƚĞŶƌĞƋƵĞƐƚ͕ǁĞǁŝůůƉƌŽǀŝĚĞƚĞƐƚ ƌĞƐƵůƚƐƚŽLJŽƵǁŝƚŚŝŶĂĐŽŵŵĞƌĐŝĂůůLJƌĞĂƐŽŶĂďůĞƚŝŵĞĨƌĂŵĞĂĨƚĞƌƌĞĐĞŝƉƚŽĨƚŚĞƌĞƋƵĞƐƚ͘ ϲ͘ϳtĞǁŝůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌŝŵƉŽƌƚŝŶŐďĂĐŬͲƵƉĂŶĚǀĞƌŝĨLJŝŶŐƚŚĂƚLJŽƵĐĂŶůŽŐͲŝŶ͘zŽƵǁŝůůďĞ ƌĞƐƉŽŶƐŝďůĞĨŽƌƌƵŶŶŝŶŐƌĞƉŽƌƚƐĂŶĚƚĞƐƚŝŶŐĐƌŝƚŝĐĂůƉƌŽĐĞƐƐĞƐƚŽǀĞƌŝĨLJƚŚĞƌĞƚƵƌŶĞĚĂƚĂ͘ ϲ͘ϴtĞƉƌŽǀŝĚĞƐĞĐƵƌĞĂƚĂƚƌĂŶƐŵŝƐƐŝŽŶƉĂƚŚƐďĞƚǁĞĞŶĞĂĐŚŽĨLJŽƵƌǁŽƌŬƐƚĂƚŝŽŶƐĂŶĚŽƵƌƐĞƌǀĞƌƐ͘ ϲ͘ϵdLJůĞƌĚĂƚĂĐĞŶƚĞƌƐĂƌĞĂĐĐĞƐƐŝďůĞŽŶůLJďLJĂƵƚŚŽƌŝnjĞĚƉĞƌƐŽŶŶĞůǁŝƚŚĂƵŶŝƋƵĞŬĞLJĞŶƚƌLJ͘ůůŽƚŚĞƌ ǀŝƐŝƚŽƌƐƚŽdLJůĞƌĚĂƚĂĐĞŶƚĞƌƐŵƵƐƚďĞƐŝŐŶĞĚŝŶĂŶĚĂĐĐŽŵƉĂŶŝĞĚďLJĂƵƚŚŽƌŝnjĞĚƉĞƌƐŽŶŶĞů͘ŶƚƌLJ ĂƚƚĞŵƉƚƐƚŽƚŚĞĚĂƚĂĐĞŶƚĞƌĂƌĞƌĞŐƵůĂƌůLJĂƵĚŝƚĞĚďLJŝŶƚĞƌŶĂůƐƚĂĨĨĂŶĚĞdžƚĞƌŶĂůĂƵĚŝƚŽƌƐƚŽĞŶƐƵƌĞŶŽ ƵŶĂƵƚŚŽƌŝnjĞĚĂĐĐĞƐƐ͘ ϲ͘ϭϬtŚĞƌĞĂƉƉůŝĐĂďůĞǁŝƚŚƌĞƐƉĞĐƚƚŽŽƵƌĂƉƉůŝĐĂƚŝŽŶƐƚŚĂƚƚĂŬĞŽƌƉƌŽĐĞƐƐĐĂƌĚƉĂLJŵĞŶƚĚĂƚĂ͕ǁĞĂƌĞ ƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞƐĞĐƵƌŝƚLJŽĨĐĂƌĚŚŽůĚĞƌĚĂƚĂƚŚĂƚǁĞƉŽƐƐĞƐƐ͕ŝŶĐůƵĚŝŶŐĨƵŶĐƚŝŽŶƐƌĞůĂƚŝŶŐƚŽ ƐƚŽƌŝŶŐ͕ƉƌŽĐĞƐƐŝŶŐ͕ĂŶĚƚƌĂŶƐŵŝƚƚŝŶŐŽĨƚŚĞĐĂƌĚŚŽůĚĞƌĚĂƚĂĂŶĚĂĨĨŝƌŵƚŚĂƚ͕ĂƐŽĨƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͕ ǁĞĐŽŵƉůLJǁŝƚŚĂƉƉůŝĐĂďůĞƌĞƋƵŝƌĞŵĞŶƚƐƚŽďĞĐŽŶƐŝĚĞƌĞĚW/^^ĐŽŵƉůŝĂŶƚĂŶĚŚĂǀĞƉĞƌĨŽƌŵĞĚ ƚŚĞŶĞĐĞƐƐĂƌLJƐƚĞƉƐƚŽǀĂůŝĚĂƚĞĐŽŵƉůŝĂŶĐĞǁŝƚŚƚŚĞW/^^͘tĞĂŐƌĞĞƚŽƐƵƉƉůLJƚŚĞĐƵƌƌĞŶƚƐƚĂƚƵƐ ŽĨŽƵƌW/^^ĐŽŵƉůŝĂŶĐĞƉƌŽŐƌĂŵŝŶƚŚĞĨŽƌŵŽĨĂŶŽĨĨŝĐŝĂůƚƚĞƐƚĂƚŝŽŶŽĨŽŵƉůŝĂŶĐĞ͕ǁŚŝĐŚĐĂŶ ďĞĨŽƵŶĚĂƚŚƚƚƉƐ͗ͬͬǁǁǁ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵͬĂďŽƵƚͲƵƐͬĐŽŵƉůŝĂŶĐĞ͕ĂŶĚŝŶƚŚĞĞǀĞŶƚŽĨĂŶLJĐŚĂŶŐĞŝŶŽƵƌ ƐƚĂƚƵƐ͕ǁŝůůĐŽŵƉůLJǁŝƚŚĂƉƉůŝĐĂďůĞŶŽƚŝĐĞƌĞƋƵŝƌĞŵĞŶƚƐ͘ ^d/KEʹWZK&^^/KE>^Zs/^ ϵ͘WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ͘tĞǁŝůůƉƌŽǀŝĚĞLJŽƵƚŚĞǀĂƌŝŽƵƐŝŵƉůĞŵĞŶƚĂƚŝŽŶͲƌĞůĂƚĞĚƐĞƌǀŝĐĞƐŝƚĞŵŝnjĞĚŝŶƚŚĞ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂŶĚĚĞƐĐƌŝďĞĚŝŶƚŚĞ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬͬŽƵƌŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚŝŵƉůĞŵĞŶƚĂƚŝŽŶ ƉůĂŶ͘tĞǁŝůůĨŝŶĂůŝnjĞƚŚĂƚĚŽĐƵŵĞŶƚĂƚŝŽŶǁŝƚŚLJŽƵƵƉŽŶĞdžĞĐƵƚŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘ ϭϬ͘WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ&ĞĞƐ͘zŽƵĂŐƌĞĞƚŽƉĂLJƵƐƚŚĞƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐĨĞĞƐŝŶƚŚĞĂŵŽƵŶƚƐƐĞƚĨŽƌƚŚŝŶ ƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘dŚŽƐĞĂŵŽƵŶƚƐĂƌĞƉĂLJĂďůĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚ WŽůŝĐLJ͘zŽƵĂĐŬŶŽǁůĞĚŐĞƚŚĂƚƚŚĞĨĞĞƐƐƚĂƚĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂƌĞŐŽŽĚͲĨĂŝƚŚĞƐƚŝŵĂƚĞƐŽĨ ƚŚĞĂŵŽƵŶƚŽĨƚŝŵĞĂŶĚŵĂƚĞƌŝĂůƐƌĞƋƵŝƌĞĚĨŽƌLJŽƵƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘tĞǁŝůůďŝůůLJŽƵƚŚĞĂĐƚƵĂůĨĞĞƐ ŝŶĐƵƌƌĞĚďĂƐĞĚŽŶƚŚĞŝŶͲƐĐŽƉĞƐĞƌǀŝĐĞƐƉƌŽǀŝĚĞĚƚŽLJŽƵ͘ŶLJĚŝƐĐƌĞƉĂŶĐŝĞƐŝŶƚŚĞƚŽƚĂůǀĂůƵĞƐƐĞƚĨŽƌƚŚ ŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJǁŝůůďĞƌĞƐŽůǀĞĚďLJŵƵůƚŝƉůLJŝŶŐƚŚĞĂƉƉůŝĐĂďůĞŚŽƵƌůLJƌĂƚĞďLJƚŚĞƋƵŽƚĞĚ ŚŽƵƌƐ͘ ϭϭ͘ĚĚŝƚŝŽŶĂů^ĞƌǀŝĐĞƐ͘dŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĐŽŶƚĂŝŶƐ͕ĂŶĚƚŚĞ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬĚĞƐĐƌŝďĞƐ͕ƚŚĞ ƐĐŽƉĞŽĨƐĞƌǀŝĐĞƐĂŶĚƌĞůĂƚĞĚĐŽƐƚƐ;ŝŶĐůƵĚŝŶŐƉƌŽŐƌĂŵŵŝŶŐĂŶĚͬŽƌŝŶƚĞƌĨĂĐĞĞƐƚŝŵĂƚĞƐͿƌĞƋƵŝƌĞĚĨŽƌƚŚĞ ƉƌŽũĞĐƚďĂƐĞĚŽŶŽƵƌƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐLJŽƵƐƵƉƉůŝĞĚ͘/ĨĂĚĚŝƚŝŽŶĂůǁŽƌŬŝƐƌĞƋƵŝƌĞĚ͕Žƌ ŝĨLJŽƵƵƐĞŽƌƌĞƋƵĞƐƚĂĚĚŝƚŝŽŶĂůƐĞƌǀŝĐĞƐ͕ǁĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚĂŶĂĚĚĞŶĚƵŵŽƌĐŚĂŶŐĞŽƌĚĞƌ͕ĂƐ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϮ ĂƉƉůŝĐĂďůĞ͕ŽƵƚůŝŶŝŶŐƚŚĞĐŽƐƚƐĨŽƌƚŚĞĂĚĚŝƚŝŽŶĂůǁŽƌŬ͘dŚĞƉƌŝĐĞƋƵŽƚĞƐŝŶƚŚĞĂĚĚĞŶĚƵŵŽƌĐŚĂŶŐĞ ŽƌĚĞƌǁŝůůďĞǀĂůŝĚĨŽƌƚŚŝƌƚLJ;ϯϬͿĚĂLJƐĨƌŽŵƚŚĞĚĂƚĞŽĨƚŚĞƋƵŽƚĞ͘ ϭϮ͘ĂŶĐĞůůĂƚŝŽŶ͘/ĨƚƌĂǀĞůŝƐƌĞƋƵŝƌĞĚ͕ǁĞǁŝůůŵĂŬĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƐĐŚĞĚƵůĞƚƌĂǀĞůĨŽƌŽƵƌ ƉĞƌƐŽŶŶĞů͕ŝŶĐůƵĚŝŶŐĂƌƌĂŶŐŝŶŐƚƌĂǀĞůƌĞƐĞƌǀĂƚŝŽŶƐ͕ĂƚůĞĂƐƚƚǁŽ;ϮͿǁĞĞŬƐŝŶĂĚǀĂŶĐĞŽĨĐŽŵŵŝƚŵĞŶƚƐ͘ dŚĞƌĞĨŽƌĞ͕ŝĨLJŽƵĐĂŶĐĞůƐĞƌǀŝĐĞƐůĞƐƐƚŚĂŶƚǁŽ;ϮͿǁĞĞŬƐŝŶĂĚǀĂŶĐĞ;ŽƚŚĞƌƚŚĂŶĨŽƌ&ŽƌĐĞDĂũĞƵƌĞŽƌ ďƌĞĂĐŚďLJƵƐͿ͕LJŽƵǁŝůůďĞůŝĂďůĞĨŽƌĂůů;ĂͿŶŽŶͲƌĞĨƵŶĚĂďůĞĞdžƉĞŶƐĞƐŝŶĐƵƌƌĞĚďLJƵƐŽŶLJŽƵƌďĞŚĂůĨ͕ĂŶĚ ;ďͿĚĂŝůLJĨĞĞƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚĐĂŶĐĞůůĞĚƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐŝĨǁĞĂƌĞƵŶĂďůĞƚŽƌĞĂƐƐŝŐŶŽƵƌƉĞƌƐŽŶŶĞů͘ tĞǁŝůůŵĂŬĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞĂƐƐŝŐŶƉĞƌƐŽŶŶĞůŝŶƚŚĞĞǀĞŶƚLJŽƵĐĂŶĐĞůǁŝƚŚŝŶƚǁŽ;ϮͿǁĞĞŬƐ ŽĨƐĐŚĞĚƵůĞĚĐŽŵŵŝƚŵĞŶƚƐ͘ ϭϯ͘^ĞƌǀŝĐĞƐtĂƌƌĂŶƚLJ͘tĞǁŝůůƉĞƌĨŽƌŵƚŚĞƐĞƌǀŝĐĞƐŝŶĂƉƌŽĨĞƐƐŝŽŶĂů͕ǁŽƌŬŵĂŶůŝŬĞŵĂŶŶĞƌ͕ĐŽŶƐŝƐƚĞŶƚǁŝƚŚ ŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚƐ͘/ŶƚŚĞĞǀĞŶƚǁĞƉƌŽǀŝĚĞƐĞƌǀŝĐĞƐƚŚĂƚĚŽŶŽƚĐŽŶĨŽƌŵƚŽƚŚŝƐǁĂƌƌĂŶƚLJ͕ǁĞǁŝůůƌĞͲ ƉĞƌĨŽƌŵƐƵĐŚƐĞƌǀŝĐĞƐĂƚŶŽĂĚĚŝƚŝŽŶĂůĐŽƐƚƚŽLJŽƵ͘ ϭϰ͘^ŝƚĞĐĐĞƐƐĂŶĚZĞƋƵŝƌĞŵĞŶƚƐ͘ƚŶŽĐŽƐƚƚŽƵƐ͕LJŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĨƵůůĂŶĚĨƌĞĞĂĐĐĞƐƐƚŽLJŽƵƌ ƉĞƌƐŽŶŶĞů͕ĨĂĐŝůŝƚŝĞƐ͕ĂŶĚĞƋƵŝƉŵĞŶƚĂƐŵĂLJďĞƌĞĂƐŽŶĂďůLJŶĞĐĞƐƐĂƌLJĨŽƌƵƐƚŽƉƌŽǀŝĚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶ ƐĞƌǀŝĐĞƐ͕ƐƵďũĞĐƚƚŽĂŶLJƌĞĂƐŽŶĂďůĞƐĞĐƵƌŝƚLJƉƌŽƚŽĐŽůƐŽƌŽƚŚĞƌǁƌŝƚƚĞŶƉŽůŝĐŝĞƐƉƌŽǀŝĚĞĚƚŽƵƐĂƐŽĨƚŚĞ ĨĨĞĐƚŝǀĞĂƚĞ͕ĂŶĚƚŚĞƌĞĂĨƚĞƌĂƐŵƵƚƵĂůůLJĂŐƌĞĞĚƚŽďLJLJŽƵĂŶĚƵƐ͘ ϭϱ͘ĂĐŬŐƌŽƵŶĚŚĞĐŬƐ͘&ŽƌĂƚůĞĂƐƚƚŚĞƉĂƐƚƚǁĞůǀĞ;ϭϮͿLJĞĂƌƐ͕ĂůůŽĨŽƵƌĞŵƉůŽLJĞĞƐŚĂǀĞƵŶĚĞƌŐŽŶĞ ĐƌŝŵŝŶĂůďĂĐŬŐƌŽƵŶĚĐŚĞĐŬƐƉƌŝŽƌƚŽŚŝƌĞ͘ůůĞŵƉůŽLJĞĞƐƐŝŐŶŽƵƌĐŽŶĨŝĚĞŶƚŝĂůŝƚLJĂŐƌĞĞŵĞŶƚĂŶĚƐĞĐƵƌŝƚLJ ƉŽůŝĐŝĞƐ͘ ϭϲ͘ůŝĞŶƚƐƐŝƐƚĂŶĐĞ͘zŽƵĂĐŬŶŽǁůĞĚŐĞƚŚĂƚƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐĂĐŽŽƉĞƌĂƚŝǀĞ ƉƌŽĐĞƐƐƌĞƋƵŝƌŝŶŐƚŚĞƚŝŵĞĂŶĚƌĞƐŽƵƌĐĞƐŽĨLJŽƵƌƉĞƌƐŽŶŶĞů͘zŽƵĂŐƌĞĞƚŽƵƐĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽ ĐŽŽƉĞƌĂƚĞǁŝƚŚĂŶĚĂƐƐŝƐƚƵƐĂƐŵĂLJďĞƌĞĂƐŽŶĂďůLJƌĞƋƵŝƌĞĚƚŽŵĞĞƚƚŚĞĂŐƌĞĞĚƵƉŽŶƉƌŽũĞĐƚĚĞĂĚůŝŶĞƐ ĂŶĚŽƚŚĞƌŵŝůĞƐƚŽŶĞƐĨŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dŚŝƐĐŽŽƉĞƌĂƚŝŽŶŝŶĐůƵĚĞƐĂƚůĞĂƐƚǁŽƌŬŝŶŐǁŝƚŚƵƐƚŽ ƐĐŚĞĚƵůĞƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶͲƌĞůĂƚĞĚƐĞƌǀŝĐĞƐŽƵƚůŝŶĞĚŝŶƚŚŝƐŐƌĞĞŵĞŶƚ͘tĞǁŝůůŶŽƚďĞůŝĂďůĞĨŽƌ ĨĂŝůƵƌĞƚŽŵĞĞƚĂŶLJĚĞĂĚůŝŶĞƐĂŶĚŵŝůĞƐƚŽŶĞƐǁŚĞŶƐƵĐŚĨĂŝůƵƌĞŝƐĚƵĞƚŽ&ŽƌĐĞDĂũĞƵƌĞŽƌƚŽƚŚĞĨĂŝůƵƌĞ ďLJLJŽƵƌƉĞƌƐŽŶŶĞůƚŽƉƌŽǀŝĚĞƐƵĐŚĐŽŽƉĞƌĂƚŝŽŶĂŶĚĂƐƐŝƐƚĂŶĐĞ;ĞŝƚŚĞƌƚŚƌŽƵŐŚĂĐƚŝŽŶŽƌŽŵŝƐƐŝŽŶͿ͘ ϭϳ͘DĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚ͘&ŽƌƐŽůŽŶŐĂƐLJŽƵƚŝŵĞůLJƉĂLJLJŽƵƌ^ĂĂ^&ĞĞƐĂĐĐŽƌĚŝŶŐƚŽƚŚĞ/ŶǀŽŝĐŝŶŐĂŶĚ WĂLJŵĞŶƚWŽůŝĐLJ͕ƚŚĞŶŝŶĂĚĚŝƚŝŽŶƚŽƚŚĞƚĞƌŵƐƐĞƚĨŽƌƚŚŝŶƚŚĞ^>ĂŶĚƚŚĞ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͕ǁĞǁŝůů͗ ϭϳ͘ϭƉĞƌĨŽƌŵŽƵƌŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚŽďůŝŐĂƚŝŽŶƐŝŶĂƉƌŽĨĞƐƐŝŽŶĂů͕ŐŽŽĚ͕ĂŶĚǁŽƌŬŵĂŶůŝŬĞ ŵĂŶŶĞƌ͕ĐŽŶƐŝƐƚĞŶƚǁŝƚŚŝŶĚƵƐƚƌLJƐƚĂŶĚĂƌĚƐ͕ƚŽƌĞƐŽůǀĞĞĨĞĐƚƐŝŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ;ƐƵďũĞĐƚƚŽĂŶLJ ĂƉƉůŝĐĂďůĞƌĞůĞĂƐĞůŝĨĞĐLJĐůĞƉŽůŝĐLJͿ͖ ϭϳ͘ϮƉƌŽǀŝĚĞƐƵƉƉŽƌƚĚƵƌŝŶŐŽƵƌĞƐƚĂďůŝƐŚĞĚƐƵƉƉŽƌƚŚŽƵƌƐ͖ ϭϳ͘ϯŵĂŝŶƚĂŝŶƉĞƌƐŽŶŶĞůƚŚĂƚĂƌĞƐƵĨĨŝĐŝĞŶƚůLJƚƌĂŝŶĞĚƚŽďĞĨĂŵŝůŝĂƌǁŝƚŚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚ dŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͕ŝĨĂŶLJ͕ŝŶŽƌĚĞƌƚŽƉƌŽǀŝĚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͖ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϯ ϭϳ͘ϰŵĂŬĞĂǀĂŝůĂďůĞƚŽLJŽƵĂůůƌĞůĞĂƐĞƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ;ŝŶĐůƵĚŝŶŐƵƉĚĂƚĞƐĂŶĚ ĞŶŚĂŶĐĞŵĞŶƚƐͿƚŚĂƚǁĞŵĂŬĞŐĞŶĞƌĂůůLJĂǀĂŝůĂďůĞǁŝƚŚŽƵƚĂĚĚŝƚŝŽŶĂůĐŚĂƌŐĞƚŽĐƵƐƚŽŵĞƌƐǁŚŽŚĂǀĞ ĂŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĂŐƌĞĞŵĞŶƚŝŶĞĨĨĞĐƚ͖ĂŶĚ ϭϳ͘ϱƉƌŽǀŝĚĞŶŽŶͲĞĨĞĐƚƌĞƐŽůƵƚŝŽŶƐƵƉƉŽƌƚŽĨƉƌŝŽƌƌĞůĞĂƐĞƐŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝŶĂĐĐŽƌĚĂŶĐĞ ǁŝƚŚĂŶLJĂƉƉůŝĐĂďůĞƌĞůĞĂƐĞůŝĨĞĐLJĐůĞƉŽůŝĐLJ͘ tĞǁŝůůƵƐĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƉĞƌĨŽƌŵƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐƌĞŵŽƚĞůLJ͘ƵƌƌĞŶƚůLJ͕ǁĞƵƐĞĂƚŚŝƌĚͲƉĂƌƚLJ ƐĞĐƵƌĞƵŶĂƚƚĞŶĚĞĚĐŽŶŶĞĐƚŝǀŝƚLJƚŽŽůĐĂůůĞĚŽŵŐĂƌ͕ĂƐǁĞůůĂƐ'ŽƚŽƐƐŝƐƚďLJŝƚƌŝdž͘dŚĞƌĞĨŽƌĞ͕LJŽƵĂŐƌĞĞƚŽ ŵĂŝŶƚĂŝŶĂŚŝŐŚͲƐƉĞĞĚŝŶƚĞƌŶĞƚĐŽŶŶĞĐƚŝŽŶĐĂƉĂďůĞŽĨĐŽŶŶĞĐƚŝŶŐƵƐƚŽLJŽƵƌWƐĂŶĚƐĞƌǀĞƌ;ƐͿ͘zŽƵĂŐƌĞĞƚŽ ƉƌŽǀŝĚĞƵƐǁŝƚŚĂůŽŐŝŶĂĐĐŽƵŶƚĂŶĚůŽĐĂůĂĚŵŝŶŝƐƚƌĂƚŝǀĞƉƌŝǀŝůĞŐĞƐĂƐǁĞŵĂLJƌĞĂƐŽŶĂďůLJƌĞƋƵŝƌĞƚŽƉĞƌĨŽƌŵ ƌĞŵŽƚĞƐĞƌǀŝĐĞƐ͘tĞǁŝůů͕ĂƚŽƵƌŽƉƚŝŽŶ͕ƵƐĞƚŚĞƐĞĐƵƌĞĐŽŶŶĞĐƚŝŽŶƚŽĂƐƐŝƐƚǁŝƚŚƉƌŽƉĞƌĚŝĂŐŶŽƐŝƐĂŶĚ ƌĞƐŽůƵƚŝŽŶ͕ƐƵďũĞĐƚƚŽĂŶLJƌĞĂƐŽŶĂďůLJĂƉƉůŝĐĂďůĞƐĞĐƵƌŝƚLJƉƌŽƚŽĐŽůƐ͘/ĨǁĞĐĂŶŶŽƚƌĞƐŽůǀĞĂƐƵƉƉŽƌƚŝƐƐƵĞ ƌĞŵŽƚĞůLJ͕ǁĞŵĂLJďĞƌĞƋƵŝƌĞĚƚŽƉƌŽǀŝĚĞŽŶƐŝƚĞƐĞƌǀŝĐĞƐ͘/ŶƐƵĐŚĞǀĞŶƚ͕ǁĞǁŝůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌŽƵƌƚƌĂǀĞů ĞdžƉĞŶƐĞƐ͕ƵŶůĞƐƐŝƚŝƐĚĞƚĞƌŵŝŶĞĚƚŚĂƚƚŚĞƌĞĂƐŽŶŽŶƐŝƚĞƐƵƉƉŽƌƚǁĂƐƌĞƋƵŝƌĞĚǁĂƐĂƌĞĂƐŽŶŽƵƚƐŝĚĞŽƵƌ ĐŽŶƚƌŽů͘ŝƚŚĞƌǁĂLJ͕LJŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĨƵůůĂŶĚĨƌĞĞĂĐĐĞƐƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ǁŽƌŬŝŶŐƐƉĂĐĞ͕ ĂĚĞƋƵĂƚĞĨĂĐŝůŝƚŝĞƐǁŝƚŚŝŶĂƌĞĂƐŽŶĂďůĞĚŝƐƚĂŶĐĞĨƌŽŵƚŚĞĞƋƵŝƉŵĞŶƚ͕ĂŶĚƵƐĞŽĨŵĂĐŚŝŶĞƐ͕ĂƚƚĂĐŚŵĞŶƚƐ͕ ĨĞĂƚƵƌĞƐ͕ŽƌŽƚŚĞƌĞƋƵŝƉŵĞŶƚƌĞĂƐŽŶĂďůLJŶĞĐĞƐƐĂƌLJĨŽƌƵƐƚŽƉƌŽǀŝĚĞƚŚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ ĂůůĂƚŶŽĐŚĂƌŐĞƚŽƵƐ͘tĞƐƚƌŽŶŐůLJƌĞĐŽŵŵĞŶĚƚŚĂƚLJŽƵĂůƐŽŵĂŝŶƚĂŝŶLJŽƵƌsWEĨŽƌďĂĐŬƵƉĐŽŶŶĞĐƚŝǀŝƚLJ ƉƵƌƉŽƐĞƐ͘ &ŽƌƚŚĞĂǀŽŝĚĂŶĐĞŽĨĚŽƵďƚ͕^ĂĂ^&ĞĞƐĚŽŶŽƚŝŶĐůƵĚĞƚŚĞĨŽůůŽǁŝŶŐƐĞƌǀŝĐĞƐ͗;ĂͿŽŶƐŝƚĞƐƵƉƉŽƌƚ;ƵŶůĞƐƐdLJůĞƌ ĐĂŶŶŽƚƌĞŵŽƚĞůLJĐŽƌƌĞĐƚĂĞĨĞĐƚŝŶƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͕ĂƐƐĞƚĨŽƌƚŚĂďŽǀĞͿ͖;ďͿĂƉƉůŝĐĂƚŝŽŶĚĞƐŝŐŶ͖;ĐͿŽƚŚĞƌ ĐŽŶƐƵůƚŝŶŐƐĞƌǀŝĐĞƐ͖Žƌ;ĚͿƐƵƉƉŽƌƚŽƵƚƐŝĚĞŽƵƌŶŽƌŵĂůďƵƐŝŶĞƐƐŚŽƵƌƐĂƐůŝƐƚĞĚŝŶŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚ^ƵƉƉŽƌƚ ĂůůWƌŽĐĞƐƐ͘ZĞƋƵĞƐƚĞĚƐĞƌǀŝĐĞƐƐƵĐŚĂƐƚŚŽƐĞŽƵƚůŝŶĞĚŝŶƚŚŝƐƐĞĐƚŝŽŶǁŝůůďĞďŝůůĞĚƚŽLJŽƵŽŶĂƚŝŵĞĂŶĚ ŵĂƚĞƌŝĂůƐďĂƐŝƐĂƚŽƵƌƚŚĞŶĐƵƌƌĞŶƚƌĂƚĞƐ͘zŽƵŵƵƐƚƌĞƋƵĞƐƚƚŚŽƐĞƐĞƌǀŝĐĞƐǁŝƚŚĂƚůĞĂƐƚŽŶĞ;ϭͿǁĞĞŬƐ͛ ĂĚǀĂŶĐĞŶŽƚŝĐĞ͘ ^d/KEʹd,/ZWZdzWZKhd^ ϲ͘dŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͘tĞǁŝůůƐĞůů͕ĚĞůŝǀĞƌ͕ĂŶĚŝŶƐƚĂůůŽŶƐŝƚĞƚŚĞdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͕ŝĨLJŽƵŚĂǀĞ ƉƵƌĐŚĂƐĞĚĂŶLJ͕ĨŽƌƚŚĞƉƌŝĐĞƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘dŚŽƐĞĂŵŽƵŶƚƐĂƌĞƉĂLJĂďůĞŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͘ ϳ͘dŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͘ƐƉĂƌƚŽĨƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ͕LJŽƵǁŝůůƌĞĐĞŝǀĞĂĐĐĞƐƐƚŽƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ ĂŶĚƌĞůĂƚĞĚĚŽĐƵŵĞŶƚĂƚŝŽŶĨŽƌŝŶƚĞƌŶĂůďƵƐŝŶĞƐƐƉƵƌƉŽƐĞƐŽŶůLJ͘zŽƵƌƌŝŐŚƚƐƚŽƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ ǁŝůůďĞŐŽǀĞƌŶĞĚďLJƚŚĞdŚŝƌĚWĂƌƚLJdĞƌŵƐ͘ ϴ͘dŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐtĂƌƌĂŶƚŝĞƐ͘ ϴ͘ϭtĞĂƌĞĂƵƚŚŽƌŝnjĞĚďLJĞĂĐŚĞǀĞůŽƉĞƌƚŽŐƌĂŶƚĂĐĐĞƐƐƚŽƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͘ ϴ͘ϮdŚĞdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞǁŝůůďĞŶĞǁĂŶĚƵŶƵƐĞĚ͕ĂŶĚƵƉŽŶƉĂLJŵĞŶƚŝŶĨƵůů͕LJŽƵǁŝůůƌĞĐĞŝǀĞĨƌĞĞ ĂŶĚĐůĞĂƌƚŝƚůĞƚŽƚŚĞdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϰ ϴ͘ϯzŽƵĂĐŬŶŽǁůĞĚŐĞƚŚĂƚǁĞĂƌĞŶŽƚƚŚĞŵĂŶƵĨĂĐƚƵƌĞƌŽĨƚŚĞdŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘tĞĚŽŶŽƚǁĂƌƌĂŶƚ ŽƌŐƵĂƌĂŶƚĞĞƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞdŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘,ŽǁĞǀĞƌ͕ǁĞŐƌĂŶƚĂŶĚƉĂƐƐƚŚƌŽƵŐŚƚŽ LJŽƵĂŶLJǁĂƌƌĂŶƚLJƚŚĂƚǁĞŵĂLJƌĞĐĞŝǀĞĨƌŽŵƚŚĞĞǀĞůŽƉĞƌŽƌƐƵƉƉůŝĞƌŽĨƚŚĞdŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘ ϵ͘dŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͘/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚdŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͕ƚŚŽƐĞƐĞƌǀŝĐĞƐǁŝůůďĞƉƌŽǀŝĚĞĚ ŝŶĚĞƉĞŶĚĞŶƚŽĨdLJůĞƌďLJƐƵĐŚƚŚŝƌĚͲƉĂƌƚLJĂƚƚŚĞƌĂƚĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂŶĚŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͘ ^d/KEͲ/EsK//E'EWzDEd͖/EsK//^Whd^ ϯ͘/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚ͘tĞǁŝůůŝŶǀŽŝĐĞLJŽƵƚŚĞ^ĂĂ^&ĞĞƐĂŶĚĨĞĞƐĨŽƌŽƚŚĞƌƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐŝŶƚŚĞ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJƉĞƌŽƵƌ/ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ͕ƐƵďũĞĐƚƚŽ^ĞĐƚŝŽŶ;ϮͿ͘ ϰ͘/ŶǀŽŝĐĞŝƐƉƵƚĞƐ͘/ĨLJŽƵďĞůŝĞǀĞĂŶLJĚĞůŝǀĞƌĞĚƐŽĨƚǁĂƌĞŽƌƐĞƌǀŝĐĞĚŽĞƐŶŽƚĐŽŶĨŽƌŵƚŽƚŚĞǁĂƌƌĂŶƚŝĞƐŝŶ ƚŚŝƐŐƌĞĞŵĞŶƚ͕LJŽƵǁŝůůƉƌŽǀŝĚĞƵƐǁŝƚŚǁƌŝƚƚĞŶŶŽƚŝĐĞǁŝƚŚŝŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨLJŽƵƌƌĞĐĞŝƉƚŽĨƚŚĞ ĂƉƉůŝĐĂďůĞŝŶǀŽŝĐĞ͘dŚĞǁƌŝƚƚĞŶŶŽƚŝĐĞŵƵƐƚĐŽŶƚĂŝŶƌĞĂƐŽŶĂďůĞĚĞƚĂŝůŽĨƚŚĞŝƐƐƵĞƐLJŽƵĐŽŶƚĞŶĚĂƌĞŝŶ ĚŝƐƉƵƚĞƐŽƚŚĂƚǁĞĐĂŶĐŽŶĨŝƌŵƚŚĞŝƐƐƵĞĂŶĚƌĞƐƉŽŶĚƚŽLJŽƵƌŶŽƚŝĐĞǁŝƚŚĞŝƚŚĞƌĂũƵƐƚŝĨŝĐĂƚŝŽŶŽĨƚŚĞ ŝŶǀŽŝĐĞ͕ĂŶĂĚũƵƐƚŵĞŶƚƚŽƚŚĞŝŶǀŽŝĐĞ͕ŽƌĂƉƌŽƉŽƐĂůĂĚĚƌĞƐƐŝŶŐƚŚĞŝƐƐƵĞƐƉƌĞƐĞŶƚĞĚŝŶLJŽƵƌŶŽƚŝĐĞ͘tĞ ǁŝůůǁŽƌŬǁŝƚŚLJŽƵĂƐŵĂLJďĞŶĞĐĞƐƐĂƌLJƚŽĚĞǀĞůŽƉĂŶĂĐƚŝŽŶƉůĂŶƚŚĂƚŽƵƚůŝŶĞƐƌĞĂƐŽŶĂďůĞƐƚĞƉƐƚŽďĞ ƚĂŬĞŶďLJĞĂĐŚŽĨƵƐƚŽƌĞƐŽůǀĞĂŶLJŝƐƐƵĞƐƉƌĞƐĞŶƚĞĚŝŶLJŽƵƌŶŽƚŝĐĞ͘zŽƵŵĂLJǁŝƚŚŚŽůĚƉĂLJŵĞŶƚŽĨƚŚĞ ĂŵŽƵŶƚ;ƐͿĂĐƚƵĂůůLJŝŶĚŝƐƉƵƚĞ͕ĂŶĚŽŶůLJƚŚŽƐĞĂŵŽƵŶƚƐ͕ƵŶƚŝůǁĞĐŽŵƉůĞƚĞƚŚĞĂĐƚŝŽŶŝƚĞŵƐŽƵƚůŝŶĞĚŝŶ ƚŚĞƉůĂŶ͘/ĨǁĞĂƌĞƵŶĂďůĞƚŽĐŽŵƉůĞƚĞƚŚĞĂĐƚŝŽŶŝƚĞŵƐŽƵƚůŝŶĞĚŝŶƚŚĞĂĐƚŝŽŶƉůĂŶďĞĐĂƵƐĞŽĨLJŽƵƌ ĨĂŝůƵƌĞƚŽĐŽŵƉůĞƚĞƚŚĞŝƚĞŵƐĂŐƌĞĞĚƚŽďĞĚŽŶĞďLJLJŽƵ͕ƚŚĞŶLJŽƵǁŝůůƌĞŵŝƚĨƵůůƉĂLJŵĞŶƚŽĨƚŚĞŝŶǀŽŝĐĞ͘ tĞƌĞƐĞƌǀĞƚŚĞƌŝŐŚƚƚŽƐƵƐƉĞŶĚĚĞůŝǀĞƌLJŽĨĂůů^ĂĂ^^ĞƌǀŝĐĞƐ͕ŝŶĐůƵĚŝŶŐŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚ ƐĞƌǀŝĐĞƐ͕ŝĨLJŽƵĨĂŝůƚŽƉĂLJĂŶŝŶǀŽŝĐĞŶŽƚĚŝƐƉƵƚĞĚĂƐĚĞƐĐƌŝďĞĚĂďŽǀĞǁŝƚŚŝŶĨŝĨƚĞĞŶ;ϭϱͿĚĂLJƐŽĨŶŽƚŝĐĞŽĨ ŽƵƌŝŶƚĞŶƚƚŽĚŽƐŽ͘ ^d/KE&ʹdZDEdZD/Ed/KE ϭ͘ dĞƌŵ͘dŚĞŝŶŝƚŝĂůƚĞƌŵŽĨƚŚŝƐŐƌĞĞŵĞŶƚŝƐƚŚƌĞĞ;ϯͿLJĞĂƌƐĨƌŽŵƚŚĞĨŝƌƐƚĚĂLJŽĨƚŚĞĨŝƌƐƚŵŽŶƚŚĨŽůůŽǁŝŶŐ ƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͕ƵŶůĞƐƐĞĂƌůŝĞƌƚĞƌŵŝŶĂƚĞĚĂƐƐĞƚĨŽƌƚŚďĞůŽǁ͘hƉŽŶĞdžƉŝƌĂƚŝŽŶŽĨƚŚĞŝŶŝƚŝĂůƚĞƌŵ͕ƚŚŝƐ ŐƌĞĞŵĞŶƚǁŝůůƌĞŶĞǁĂƵƚŽŵĂƚŝĐĂůůLJĨŽƌĂĚĚŝƚŝŽŶĂůŽŶĞ;ϭͿLJĞĂƌƌĞŶĞǁĂůƚĞƌŵƐĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚ^ĂĂ^ &ĞĞƐƵŶůĞƐƐƚĞƌŵŝŶĂƚĞĚŝŶǁƌŝƚŝŶŐďLJĞŝƚŚĞƌƉĂƌƚLJĂƚůĞĂƐƚƐŝdžƚLJ;ϲϬͿĚĂLJƐƉƌŝŽƌƚŽƚŚĞĞŶĚŽĨƚŚĞƚŚĞŶͲ ĐƵƌƌĞŶƚƌĞŶĞǁĂůƚĞƌŵ͘zŽƵƌƌŝŐŚƚƚŽĂĐĐĞƐƐŽƌƵƐĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐǁŝůů ƚĞƌŵŝŶĂƚĞĂƚƚŚĞĞŶĚŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘ ϭ͘dĞƌŵŝŶĂƚŝŽŶ͘dŚŝƐŐƌĞĞŵĞŶƚŵĂLJďĞƚĞƌŵŝŶĂƚĞĚĂƐƐĞƚĨŽƌƚŚďĞůŽǁ͘/ŶƚŚĞĞǀĞŶƚŽĨƚĞƌŵŝŶĂƚŝŽŶ͕LJŽƵ ǁŝůůƉĂLJƵƐĨŽƌĂůůƵŶĚŝƐƉƵƚĞĚĨĞĞƐĂŶĚĞdžƉĞŶƐĞƐƌĞůĂƚĞĚƚŽƚŚĞƐŽĨƚǁĂƌĞ͕ƉƌŽĚƵĐƚƐ͕ĂŶĚͬŽƌƐĞƌǀŝĐĞƐLJŽƵ ŚĂǀĞƌĞĐĞŝǀĞĚ͕ŽƌǁĞŚĂǀĞŝŶĐƵƌƌĞĚŽƌĚĞůŝǀĞƌĞĚ͕ƉƌŝŽƌƚŽƚŚĞĞĨĨĞĐƚŝǀĞĚĂƚĞŽĨƚĞƌŵŝŶĂƚŝŽŶ͘ŝƐƉƵƚĞĚ ĨĞĞƐĂŶĚĞdžƉĞŶƐĞƐŝŶĂůůƚĞƌŵŝŶĂƚŝŽŶƐŽƚŚĞƌƚŚĂŶLJŽƵƌƚĞƌŵŝŶĂƚŝŽŶĨŽƌĐĂƵƐĞŵƵƐƚŚĂǀĞďĞĞŶƐƵďŵŝƚƚĞĚ ĂƐŝŶǀŽŝĐĞĚŝƐƉƵƚĞƐŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚ^ĞĐƚŝŽŶ;ϮͿ͘ ϰ͘ϭ&ĂŝůƵƌĞƚŽWĂLJ^ĂĂ^&ĞĞƐ͘zŽƵĂĐŬŶŽǁůĞĚŐĞƚŚĂƚĐŽŶƚŝŶƵĞĚĂĐĐĞƐƐƚŽƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐŝƐĐŽŶƚŝŶŐĞŶƚ ƵƉŽŶLJŽƵƌƚŝŵĞůLJƉĂLJŵĞŶƚŽĨ^ĂĂ^&ĞĞƐ͘/ĨLJŽƵĨĂŝůƚŽƚŝŵĞůLJƉĂLJƚŚĞ^ĂĂ^&ĞĞƐ͕ǁĞŵĂLJĚŝƐĐŽŶƚŝŶƵĞ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϱ ƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐĂŶĚĚĞŶLJLJŽƵƌĂĐĐĞƐƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͘tĞŵĂLJĂůƐŽƚĞƌŵŝŶĂƚĞƚŚŝƐ ŐƌĞĞŵĞŶƚŝĨLJŽƵĚŽŶ͛ƚĐƵƌĞƐƵĐŚĨĂŝůƵƌĞƚŽƉĂLJǁŝƚŚŝŶĨŽƌƚLJͲĨŝǀĞ;ϰϱͿĚĂLJƐŽĨƌĞĐĞŝǀŝŶŐǁƌŝƚƚĞŶŶŽƚŝĐĞ ŽĨŽƵƌŝŶƚĞŶƚƚŽƚĞƌŵŝŶĂƚĞ͘ ϰ͘Ϯ&ŽƌĂƵƐĞ͘/ĨLJŽƵďĞůŝĞǀĞǁĞŚĂǀĞŵĂƚĞƌŝĂůůLJďƌĞĂĐŚĞĚƚŚŝƐŐƌĞĞŵĞŶƚ͕LJŽƵǁŝůůŝŶǀŽŬĞƚŚĞŝƐƉƵƚĞ ZĞƐŽůƵƚŝŽŶĐůĂƵƐĞƐĞƚĨŽƌƚŚŝŶ^ĞĐƚŝŽŶ,;ϯͿ͘zŽƵŵĂLJƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚĨŽƌĐĂƵƐĞŝŶƚŚĞ ĞǀĞŶƚǁĞĚŽŶŽƚĐƵƌĞ͕ŽƌĐƌĞĂƚĞĂŵƵƚƵĂůůLJĂŐƌĞĞĂďůĞĂĐƚŝŽŶƉůĂŶƚŽĂĚĚƌĞƐƐ͕ĂŵĂƚĞƌŝĂůďƌĞĂĐŚŽĨ ƚŚŝƐŐƌĞĞŵĞŶƚǁŝƚŚŝŶƚŚĞƚŚŝƌƚLJ;ϯϬͿĚĂLJǁŝŶĚŽǁƐĞƚĨŽƌƚŚŝŶ^ĞĐƚŝŽŶ,;ϯͿ͘ ϰ͘ϯ&ŽƌĐĞDĂũĞƵƌĞ͘ŝƚŚĞƌƉĂƌƚLJŚĂƐƚŚĞƌŝŐŚƚƚŽƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚŝĨĂ&ŽƌĐĞDĂũĞƵƌĞĞǀĞŶƚ ƐƵƐƉĞŶĚƐƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐĨŽƌĂƉĞƌŝŽĚŽĨĨŽƌƚLJͲĨŝǀĞ;ϰϱͿĚĂLJƐŽƌŵŽƌĞ͘ ϰ͘ϰ>ĂĐŬŽĨƉƉƌŽƉƌŝĂƚŝŽŶƐ͘/ĨLJŽƵƐŚŽƵůĚŶŽƚĂƉƉƌŽƉƌŝĂƚĞŽƌŽƚŚĞƌǁŝƐĞŵĂŬĞĂǀĂŝůĂďůĞĨƵŶĚƐƐƵĨĨŝĐŝĞŶƚ ƚŽƵƚŝůŝnjĞƚŚĞ^ĂĂ^^ĞƌǀŝĐĞƐ͕LJŽƵŵĂLJƵŶŝůĂƚĞƌĂůůLJƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚƵƉŽŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐ ǁƌŝƚƚĞŶŶŽƚŝĐĞƚŽƵƐ͘zŽƵǁŝůůŶŽƚďĞĞŶƚŝƚůĞĚƚŽĂƌĞĨƵŶĚŽƌŽĨĨƐĞƚŽĨƉƌĞǀŝŽƵƐůLJƉĂŝĚ͕ďƵƚƵŶƵƐĞĚ ^ĂĂ^&ĞĞƐ͘zŽƵĂŐƌĞĞŶŽƚƚŽƵƐĞƚĞƌŵŝŶĂƚŝŽŶĨŽƌůĂĐŬŽĨĂƉƉƌŽƉƌŝĂƚŝŽŶƐĂƐĂƐƵďƐƚŝƚƵƚĞĨŽƌ ƚĞƌŵŝŶĂƚŝŽŶĨŽƌĐŽŶǀĞŶŝĞŶĐĞ͘ ϰ͘ϱ&ĞĞƐĨŽƌdĞƌŵŝŶĂƚŝŽŶǁŝƚŚŽƵƚĂƵƐĞĚƵƌŝŶŐ/ŶŝƚŝĂůdĞƌŵ͘ϯ/ĨLJŽƵƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚĚƵƌŝŶŐƚŚĞ ŝŶŝƚŝĂůƚĞƌŵĨŽƌĂŶLJƌĞĂƐŽŶŽƚŚĞƌƚŚĂŶĐĂƵƐĞ͕&ŽƌĐĞDĂũĞƵƌĞ͕ŽƌůĂĐŬŽĨĂƉƉƌŽƉƌŝĂƚŝŽŶƐ͕ŽƌŝĨǁĞ ƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚĚƵƌŝŶŐƚŚĞŝŶŝƚŝĂůƚĞƌŵĨŽƌLJŽƵƌĨĂŝůƵƌĞƚŽƉĂLJ^ĂĂ^&ĞĞƐ͕LJŽƵƐŚĂůůƉĂLJƵƐ ƚŚĞĨŽůůŽǁŝŶŐĞĂƌůLJƚĞƌŵŝŶĂƚŝŽŶĨĞĞƐ͗ Ă͘ŝĨLJŽƵƚĞƌŵŝŶĂƚĞĚƵƌŝŶŐƚŚĞĨŝƌƐƚLJĞĂƌŽĨƚŚĞŝŶŝƚŝĂůƚĞƌŵ͕ϭϬϬйŽĨƚŚĞ^ĂĂ^&ĞĞƐƚŚƌŽƵŐŚƚŚĞ ĚĂƚĞŽĨƚĞƌŵŝŶĂƚŝŽŶƉůƵƐϮϱйŽĨƚŚĞ^ĂĂ^&ĞĞƐƚŚĞŶĚƵĞĨŽƌƚŚĞƌĞŵĂŝŶĚĞƌŽĨƚŚĞŝŶŝƚŝĂůƚĞƌŵ͖ ď͘ŝĨLJŽƵƚĞƌŵŝŶĂƚĞĚƵƌŝŶŐƚŚĞƐĞĐŽŶĚLJĞĂƌŽĨƚŚĞŝŶŝƚŝĂůƚĞƌŵ͕ϭϬϬйŽĨƚŚĞ^ĂĂ^&ĞĞƐƚŚƌŽƵŐŚ ƚŚĞĚĂƚĞŽĨƚĞƌŵŝŶĂƚŝŽŶƉůƵƐϭϱйŽĨƚŚĞ^ĂĂ^&ĞĞƐƚŚĞŶĚƵĞĨŽƌƚŚĞƌĞŵĂŝŶĚĞƌŽĨƚŚĞŝŶŝƚŝĂů ƚĞƌŵ͖ĂŶĚ Đ͘ŝĨLJŽƵƚĞƌŵŝŶĂƚĞĂĨƚĞƌƚŚĞƐĞĐŽŶĚLJĞĂƌŽĨƚŚĞŝŶŝƚŝĂůƚĞƌŵ͕ϭϬϬйŽĨƚŚĞ^ĂĂ^&ĞĞƐƚŚƌŽƵŐŚƚŚĞ ĚĂƚĞŽĨƚĞƌŵŝŶĂƚŝŽŶƉůƵƐϭϬйŽĨƚŚĞ^ĂĂ^&ĞĞƐƚŚĞŶĚƵĞĨŽƌƚŚĞƌĞŵĂŝŶĚĞƌŽĨƚŚĞŝŶŝƚŝĂůƚĞƌŵ͘ ^d/KE'ʹ/EDE/&/d/KE͕>/D/dd/KEK&>//>/dzE/E^hZE ϳ͘/ŶƚĞůůĞĐƚƵĂůWƌŽƉĞƌƚLJ/ŶĨƌŝŶŐĞŵĞŶƚ/ŶĚĞŵŶŝĨŝĐĂƚŝŽŶ͘ ϭ͘ϱtĞǁŝůůĚĞĨĞŶĚLJŽƵĂŐĂŝŶƐƚĂŶLJƚŚŝƌĚƉĂƌƚLJĐůĂŝŵ;ƐͿƚŚĂƚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŽƌŽĐƵŵĞŶƚĂƚŝŽŶ ŝŶĨƌŝŶŐĞƐƚŚĂƚƚŚŝƌĚƉĂƌƚLJ͛ƐƉĂƚĞŶƚ͕ĐŽƉLJƌŝŐŚƚ͕ŽƌƚƌĂĚĞŵĂƌŬ͕ŽƌŵŝƐĂƉƉƌŽƉƌŝĂƚĞƐŝƚƐƚƌĂĚĞƐĞĐƌĞƚƐ͕ĂŶĚ ǁŝůůƉĂLJƚŚĞĂŵŽƵŶƚŽĨĂŶLJƌĞƐƵůƚŝŶŐĂĚǀĞƌƐĞĨŝŶĂůũƵĚŐŵĞŶƚ;ŽƌƐĞƚƚůĞŵĞŶƚƚŽǁŚŝĐŚǁĞĐŽŶƐĞŶƚͿ͘ ϯ/&^Zs/^,sEWZ/^WZdK&^^&^͕d,Ed,WW>/>WZEd'^Zϳϱй͕ ϱϬй͕Ϯϱй ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϲ zŽƵŵƵƐƚŶŽƚŝĨLJƵƐƉƌŽŵƉƚůLJŝŶǁƌŝƚŝŶŐŽĨƚŚĞĐůĂŝŵĂŶĚŐŝǀĞƵƐƐŽůĞĐŽŶƚƌŽůŽǀĞƌŝƚƐĚĞĨĞŶƐĞŽƌ ƐĞƚƚůĞŵĞŶƚ͘zŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚƌĞĂƐŽŶĂďůĞĂƐƐŝƐƚĂŶĐĞ͕ĐŽŽƉĞƌĂƚŝŽŶ͕ĂŶĚŝŶĨŽƌŵĂƚŝŽŶŝŶ ĚĞĨĞŶĚŝŶŐƚŚĞĐůĂŝŵĂƚŽƵƌĞdžƉĞŶƐĞ͘ ϭ͘ϲKƵƌŽďůŝŐĂƚŝŽŶƐƵŶĚĞƌƚŚŝƐ^ĞĐƚŝŽŶ';ϭͿǁŝůůŶŽƚĂƉƉůLJƚŽƚŚĞĞdžƚĞŶƚƚŚĞĐůĂŝŵŽƌĂĚǀĞƌƐĞĨŝŶĂů ũƵĚŐŵĞŶƚŝƐďĂƐĞĚŽŶLJŽƵƌƵƐĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝŶĐŽŶƚƌĂĚŝĐƚŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͕ŝŶĐůƵĚŝŶŐ ǁŝƚŚŶŽŶͲůŝĐĞŶƐĞĚƚŚŝƌĚƉĂƌƚŝĞƐ͕ŽƌLJŽƵƌǁŝůůĨƵůŝŶĨƌŝŶŐĞŵĞŶƚ͘ ϭ͘ϳ/ĨǁĞƌĞĐĞŝǀĞŝŶĨŽƌŵĂƚŝŽŶĐŽŶĐĞƌŶŝŶŐĂŶŝŶĨƌŝŶŐĞŵĞŶƚŽƌŵŝƐĂƉƉƌŽƉƌŝĂƚŝŽŶĐůĂŝŵƌĞůĂƚĞĚƚŽƚŚĞdLJůĞƌ ^ŽĨƚǁĂƌĞ͕ǁĞŵĂLJ͕ĂƚŽƵƌĞdžƉĞŶƐĞĂŶĚǁŝƚŚŽƵƚŽďůŝŐĂƚŝŽŶƚŽĚŽƐŽ͕ĞŝƚŚĞƌ͗;ĂͿƉƌŽĐƵƌĞĨŽƌLJŽƵƚŚĞ ƌŝŐŚƚƚŽĐŽŶƚŝŶƵĞŝƚƐƵƐĞ͖;ďͿŵŽĚŝĨLJŝƚƚŽŵĂŬĞŝƚŶŽŶͲŝŶĨƌŝŶŐŝŶŐ͖Žƌ;ĐͿƌĞƉůĂĐĞŝƚǁŝƚŚĂĨƵŶĐƚŝŽŶĂů ĞƋƵŝǀĂůĞŶƚ͕ŝŶǁŚŝĐŚĐĂƐĞLJŽƵǁŝůůƐƚŽƉƌƵŶŶŝŶŐƚŚĞĂůůĞŐĞĚůLJŝ ŶĨƌŝŶŐŝŶŐdLJůĞƌ^ŽĨƚǁĂƌĞŝŵŵĞĚŝĂƚĞůLJ͘ ůƚĞƌŶĂƚŝǀĞůLJ͕ǁĞŵĂLJĚĞĐŝĚĞƚŽůŝƚŝŐĂƚĞƚŚĞĐůĂŝŵƚŽũƵĚŐŵĞŶƚ͕ŝŶǁŚŝĐŚĐĂƐĞLJŽƵŵĂLJĐŽŶƚŝŶƵĞƚŽ ƵƐĞƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞƚĞƌŵƐŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘ ϭ͘ϴ/ĨĂŶŝŶĨƌŝŶŐĞŵĞŶƚŽƌŵŝƐĂƉƉƌŽƉƌŝĂƚŝŽŶĐůĂŝŵŝƐĨƵůůLJůŝƚŝŐĂƚĞĚĂŶĚLJŽƵƌƵƐĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐ ĞŶũŽŝŶĞĚďLJĂĐŽƵƌƚŽĨĐŽŵƉĞƚĞŶƚũƵƌŝƐĚŝĐƚŝŽŶ͕ŝŶĂĚĚŝƚŝŽŶƚŽƉĂLJŝŶŐĂŶLJĂĚǀĞƌƐĞĨŝŶĂůũƵĚŐŵĞŶƚ;Žƌ ƐĞƚƚůĞŵĞŶƚƚŽǁŚŝĐŚǁĞĐŽŶƐĞŶƚͿ͕ǁĞǁŝůů͕ĂƚŽƵƌŽƉƚŝŽŶ͕ĞŝƚŚĞƌ͗;ĂͿƉƌŽĐƵƌĞƚŚĞƌŝŐŚƚƚŽĐŽŶƚŝŶƵĞŝƚƐ ƵƐĞ͖;ďͿŵŽĚŝĨLJŝƚƚŽŵĂŬĞŝƚŶŽŶͲŝŶĨƌŝŶŐŝŶŐ͖Žƌ;ĐͿƌĞƉůĂĐĞŝƚǁŝƚŚĂĨƵŶĐƚŝŽŶĂůĞƋƵŝǀĂůĞŶƚ͘dŚŝƐ ƐĞĐƚŝŽŶƉƌŽǀŝĚĞƐLJŽƵƌĞdžĐůƵƐŝǀĞƌĞŵĞĚLJĨŽƌƚŚŝƌĚƉĂƌƚLJĐŽƉLJƌŝŐŚƚ͕ƉĂƚĞŶƚ͕ŽƌƚƌĂĚĞŵĂƌŬŝŶĨƌŝŶŐĞŵĞŶƚ ĂŶĚƚƌĂĚĞƐĞĐƌĞƚŵŝƐĂƉƉƌŽƉƌŝĂƚŝŽŶĐůĂŝŵƐ͘ ϴ͘'ĞŶĞƌĂů/ŶĚĞŵŶŝĨŝĐĂƚŝŽŶ͘ Ϯ͘ϯtĞǁŝůůŝŶĚĞŵŶŝĨLJĂŶĚŚŽůĚŚĂƌŵůĞƐƐLJŽƵĂŶĚLJŽƵƌĂŐĞŶƚƐ͕ŽĨĨŝĐŝĂůƐ͕ĂŶĚĞŵƉůŽLJĞĞƐĨƌŽŵĂŶĚĂŐĂŝŶƐƚ ĂŶLJĂŶĚĂůůƚŚŝƌĚͲƉĂƌƚLJĐůĂŝŵƐ͕ůŽƐƐĞƐ͕ůŝĂďŝůŝƚŝĞƐ͕ĚĂŵĂŐĞƐ͕ĐŽƐƚƐ͕ĂŶĚĞdžƉĞŶƐĞƐ;ŝŶĐůƵĚŝŶŐƌĞĂƐŽŶĂďůĞ ĂƚƚŽƌŶĞLJΖƐĨĞĞƐĂŶĚĐŽƐƚƐͿĨŽƌ;ĂͿƉĞƌƐŽŶĂůŝŶũƵƌLJŽƌƉƌŽƉĞƌƚLJĚĂŵĂŐĞƚŽƚŚĞĞdžƚĞŶƚĐĂƵƐĞĚďLJŽƵƌ ŶĞŐůŝŐĞŶĐĞŽƌǁŝůůĨƵůŵŝƐĐŽŶĚƵĐƚ͖Žƌ;ďͿŽƵƌǀŝŽůĂƚŝŽŶŽĨW/Ͳ^^ƌĞƋƵŝƌĞŵĞŶƚƐŽƌĂůĂǁĂƉƉůŝĐĂďůĞƚŽ ŽƵƌƉĞƌĨŽƌŵĂŶĐĞƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘zŽƵŵƵƐƚŶŽƚŝĨLJƵƐƉƌŽŵƉƚůLJŝŶǁƌŝƚŝŶŐŽĨƚŚĞĐůĂŝŵĂŶĚ ŐŝǀĞƵƐƐŽůĞĐŽŶƚƌŽůŽǀĞƌŝƚƐĚĞĨĞŶƐĞŽƌƐĞƚƚůĞŵĞŶƚ͘zŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚƌĞĂƐŽŶĂďůĞ ĂƐƐŝƐƚĂŶĐĞ͕ĐŽŽƉĞƌĂƚŝŽŶ͕ĂŶĚŝŶĨŽƌŵĂƚŝŽŶŝŶĚĞĨĞŶĚŝŶŐƚŚĞĐůĂŝŵĂƚŽƵƌĞdžƉĞŶƐĞ͘ Ϯ͘ϰdŽƚŚĞĞdžƚĞŶƚƉĞƌŵŝƚƚĞĚďLJĂƉƉůŝĐĂďůĞůĂǁ͕LJŽƵǁŝůůŝŶĚĞŵŶŝĨLJĂŶĚŚŽůĚŚĂƌŵůĞƐƐƵƐĂŶĚŽƵƌĂŐĞŶƚƐ͕ ŽĨĨŝĐŝĂůƐ͕ĂŶĚĞŵƉůŽLJĞĞƐĨƌŽŵĂŶĚĂŐĂŝŶƐƚĂŶLJĂŶĚĂůůƚŚŝƌĚͲƉĂƌƚLJĐůĂŝŵƐ͕ůŽƐƐĞƐ͕ůŝĂďŝůŝƚŝĞƐ͕ĚĂŵĂŐĞƐ͕ ĐŽƐƚƐ͕ĂŶĚĞdžƉĞŶƐĞƐ;ŝŶĐůƵĚŝŶŐƌĞĂƐŽŶĂďůĞĂƚƚŽƌŶĞLJΖƐĨĞĞƐĂŶĚĐŽƐƚƐͿĨŽƌƉĞƌƐŽŶĂůŝŶũƵƌLJŽƌƉƌŽƉĞƌƚLJ ĚĂŵĂŐĞƚŽƚŚĞĞdžƚĞŶƚĐĂƵƐĞĚďLJLJŽƵƌŶĞŐůŝŐĞŶĐĞŽƌǁŝůůĨƵůŵŝƐĐŽŶĚƵĐƚ͖Žƌ;ďͿLJŽƵƌǀŝŽůĂƚŝŽŶŽĨĂůĂǁ ĂƉƉůŝĐĂďůĞƚŽLJŽƵƌƉĞƌĨŽƌŵĂŶĐĞƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘tĞǁŝůůŶŽƚŝĨLJLJŽƵƉƌŽŵƉƚůLJŝŶǁƌŝƚŝŶŐŽĨƚŚĞ ĐůĂŝŵĂŶĚǁŝůůŐŝǀĞLJŽƵƐŽůĞĐŽŶƚƌŽůŽǀĞƌŝƚƐĚĞĨĞŶƐĞŽƌƐĞƚƚůĞŵĞŶƚ͘tĞĂŐƌĞĞƚŽƉƌŽǀŝĚĞLJŽƵǁŝƚŚ ƌĞĂƐŽŶĂďůĞĂƐƐŝƐƚĂŶĐĞ͕ĐŽŽƉĞƌĂƚŝŽŶ͕ĂŶĚŝŶĨŽƌŵĂƚŝŽŶŝŶĚĞĨĞŶĚŝŶŐƚŚĞĐůĂŝŵĂƚLJŽƵƌĞdžƉĞŶƐĞ͘ ϵ͘/^>/DZ͘yWd&KZd,yWZ^^tZZEd/^WZKs//Ed,/^'ZDEdEdKd, Dy/DhDydEdWZD/ddzWW>/>>t͕t,Zz/^>/D>>Kd,ZtZZEd/^ EKE/d/KE^͕t,d,ZyWZ^^͕/DW>/͕KZ^ddhdKZz͕/E>h/E'͕hdEKd>/D/ddK͕ Ez/DW>/tZZEd/^͕hd/^͕KZKE/d/KE^K&DZ,Ed/>/dzKZ&/dE^^&KZ WZd/h>ZWhZWK^͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϳ ϭϬ͘>/D/dd/KEK&>//>/dz͘yWd^Kd,Zt/^yWZ^^>z^d&KZd,/Ed,/^'ZDEd͕KhZ >//>/dz&KZD'^Z/^/E'KhdK&d,/^'ZDEd͕t,d,Z^KEd,KZzK& KEdZdKZdKZd͕/E>h/E'E'>/'EE^dZ/d>//>/dz͕^,>>>/D/ddKzKhZ dh>/ZdD'^͕EKddKy;ͿhZ/E'd,/E/d/>dZD͕^^d&KZd,/E^d/KE &;ϭͿ͕dKd>&^W/^K&d,d/DK&d,>/D͖KZ;ͿhZ/E'EzZEt>dZD͕d, d,EͲhZZEdEEh>^^&^Wz>/Ed,dZEt>dZD͘d,WZd/^<EKt>' E'Zd,dd,WZ/^^d&KZd,/Ed,/^'ZDEdZ^d/EZ>/EhWKEd,/^ >/D/dd/KEK&>//>/dzEdKd,Dy/DhDydEd>>KthEZWW>/>>t͕d, y>h^/KEK&Zd/ED'^͕E,^,>>WW>zZ'Z>^^K&d,&/>hZK&E ^^Ed/>WhZWK^K&EzZDz͘d,&KZ'K/E'>/D/dd/KEK&>//>/dz^,>>EKdWW>z dK>/D^d,dZ^h:ddK^d/KE^';ϭͿE';ϮͿ͘ ϭϭ͘y>h^/KEK&Zd/ED'^͘dKd,Dy/DhDydEdWZD/ddzWW>/>>t͕/E EKsEd^,>>t>/>&KZEz^W/>͕/E/Ed>͕WhE/d/s͕/E/Zd͕KZ KE^YhEd/>D'^t,d^KsZ͕sE/&t,sEs/^K&d,WK^^//>/dzK& ^h,D'^͘ ϭϮ͘/ŶƐƵƌĂŶĐĞ͘ƵƌŝŶŐƚŚĞĐŽƵƌƐĞŽĨƉĞƌĨŽƌŵŝŶŐƐĞƌǀŝĐĞƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͕ǁĞĂŐƌĞĞƚŽŵĂŝŶƚĂŝŶƚŚĞ ĨŽůůŽǁŝŶŐůĞǀĞůƐŽĨŝŶƐƵƌĂŶĐĞ͗;ĂͿŽŵŵĞƌĐŝĂů'ĞŶĞƌĂů>ŝĂďŝůŝƚLJŽĨĂƚůĞĂƐƚΨϭ͕ϬϬϬ͕ϬϬϬ͖;ďͿƵƚŽŵŽďŝůĞ >ŝĂďŝůŝƚLJŽĨĂƚůĞĂƐƚΨϭ͕ϬϬϬ͕ϬϬϬ͖;ĐͿWƌŽĨĞƐƐŝŽŶĂů>ŝĂďŝůŝƚLJŽĨĂƚůĞĂƐƚΨϭ͕ϬϬϬ͕ϬϬϬ͖;ĚͿtŽƌŬĞƌƐ ŽŵƉĞŶƐĂƚŝŽŶĐŽŵƉůLJŝŶŐǁŝƚŚĂƉƉůŝĐĂďůĞƐƚĂƚƵƚŽƌLJƌĞƋƵŝƌĞŵĞŶƚƐ͖ĂŶĚ;ĞͿdžĐĞƐƐͬhŵďƌĞůůĂ>ŝĂďŝůŝƚLJŽĨĂƚ ůĞĂƐƚΨϱ͕ϬϬϬ͕ϬϬϬ͘tĞǁŝůůĂĚĚLJŽƵĂƐĂŶĂĚĚŝƚŝŽŶĂůŝŶƐƵƌĞĚƚŽŽƵƌŽŵŵĞƌĐŝĂů'ĞŶĞƌĂů>ŝĂďŝůŝƚLJĂŶĚ ƵƚŽŵŽďŝůĞ>ŝĂďŝůŝƚLJƉŽůŝĐŝĞƐ͕ǁŚŝĐŚǁŝůůĂƵƚŽŵĂƚŝĐĂůůLJĂĚĚLJŽƵĂƐĂŶĂĚĚŝƚŝŽŶĂůŝŶƐƵƌĞĚƚŽŽƵƌ džĐĞƐƐͬhŵďƌĞůůĂ>ŝĂďŝůŝƚLJƉŽůŝĐLJĂƐǁĞůů͘tĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚĐŽƉŝĞƐŽĨĐĞƌƚŝĨŝĐĂƚĞƐŽĨŝŶƐƵƌĂŶĐĞ ƵƉŽŶLJŽƵƌǁƌŝƚƚĞŶƌĞƋƵĞƐƚ͘ ^d/KE,ʹ'EZ>dZD^EKE/d/KE^ Ϯϰ͘ĚĚŝƚŝŽŶĂůWƌŽĚƵĐƚƐĂŶĚ^ĞƌǀŝĐĞƐ͘zŽƵŵĂLJƉƵƌĐŚĂƐĞĂĚĚŝƚŝŽŶĂůƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐĂƚƚŚĞƌĂƚĞƐƐĞƚ ĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĨŽƌƚǁĞůǀĞ;ϭϮͿŵŽŶƚŚƐĨƌŽŵƚŚĞĨĨĞĐƚŝǀĞĂƚĞďLJĞdžĞĐƵƚŝŶŐĂ ŵƵƚƵĂůůLJĂŐƌĞĞĚĂĚĚĞŶĚƵŵ͘/ĨŶŽƌĂƚĞŝƐƉƌŽǀŝĚĞĚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͕ŽƌƚŚŽƐĞƚǁĞůǀĞ;ϭϮͿ ŵŽŶƚŚƐŚĂǀĞĞdžƉŝƌĞĚ͕LJŽƵŵĂLJƉƵƌĐŚĂƐĞĂĚĚŝƚŝŽŶĂůƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚůŝƐƚƉƌŝĐĞ͕ ĂůƐŽďLJĞdžĞĐƵƚŝŶŐĂŵƵƚƵĂůůLJĂŐƌĞĞĚĂĚĚĞŶĚƵŵ͘dŚĞƚĞƌŵƐŽĨƚŚŝƐŐƌĞĞŵĞŶƚǁŝůůĐŽŶƚƌŽůĂŶLJƐƵĐŚ ĂĚĚŝƚŝŽŶĂůƉƵƌĐŚĂƐĞ;ƐͿ͕ƵŶůĞƐƐŽƚŚĞƌǁŝƐĞƐƉĞĐŝĨŝĐĂůůLJƉƌŽǀŝĚĞĚŝŶƚŚĞĂĚĚĞŶĚƵŵ͘ Ϯϱ͘KƉƚŝŽŶĂů/ƚĞŵƐ͘WƌŝĐŝŶŐĨŽƌĂŶLJůŝƐƚĞĚŽƉƚŝŽŶĂůƉƌŽĚƵĐƚƐĂŶĚƐĞƌǀŝĐĞƐŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJǁŝůůďĞ ǀĂůŝĚĨŽƌƚǁĞůǀĞ;ϭϮͿŵŽŶƚŚƐĨƌŽŵƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘ Ϯϲ͘ŝƐƉƵƚĞZĞƐŽůƵƚŝŽŶ͘zŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚǁƌŝƚƚĞŶŶŽƚŝĐĞǁŝƚŚŝŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨďĞĐŽŵŝŶŐ ĂǁĂƌĞŽĨĂĚŝƐƉƵƚĞ͘zŽƵĂŐƌĞĞƚŽĐŽŽƉĞƌĂƚĞǁŝƚŚƵƐŝŶƚƌLJŝŶŐƚŽƌĞĂƐŽŶĂďůLJƌĞƐŽůǀĞĂůůĚŝƐƉƵƚĞƐ͕ ŝŶĐůƵĚŝŶŐ͕ŝĨƌĞƋƵĞƐƚĞĚďLJĞŝƚŚĞƌƉĂƌƚLJ͕ĂƉƉŽŝŶƚŝŶŐĂƐĞŶŝŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞƚŽŵĞĞƚĂŶĚĞŶŐĂŐĞŝŶŐŽŽĚ ĨĂŝƚŚŶĞŐŽƚŝĂƚŝŽŶƐǁŝƚŚŽƵƌĂƉƉŽŝŶƚĞĚƐĞŶŝŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞ͘^ĞŶŝŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐǁŝůůĐŽŶǀĞŶĞǁŝƚŚŝŶ ƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨƚŚĞǁƌŝƚƚĞŶĚŝƐƉƵƚĞŶŽƚŝĐĞ͕ƵŶůĞƐƐŽƚŚĞƌǁŝƐĞĂŐƌĞĞĚ͘ůůŵĞĞƚŝŶŐƐĂŶĚĚŝƐĐƵƐƐŝŽŶƐ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϴ ďĞƚǁĞĞŶƐĞŶŝŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐǁŝůůďĞĚĞĞŵĞĚĐŽŶĨŝĚĞŶƚŝĂůƐĞƚƚůĞŵĞŶƚĚŝƐĐƵƐƐŝŽŶƐŶŽƚƐƵďũĞĐƚƚŽ ĚŝƐĐůŽƐƵƌĞƵŶĚĞƌ&ĞĚĞƌĂůZƵůĞŽĨǀŝĚĞŶĐĞϰϬϴŽƌĂŶLJƐŝŵŝůĂƌĂƉƉůŝĐĂďůĞƐƚĂƚĞƌƵůĞ͘/ĨǁĞĨĂŝůƚŽƌĞƐŽůǀĞ ƚŚĞĚŝƐƉƵƚĞ͕ƚŚĞŶƚŚĞƉĂƌƚŝĞƐƐŚĂůůƉĂƌƚŝĐŝƉĂƚĞŝŶŶŽŶͲďŝŶĚŝŶŐŵĞĚŝĂƚŝŽŶŝŶĂŶĞĨĨŽƌƚƚŽƌĞƐŽůǀĞƚŚĞ ĚŝƐƉƵƚĞ͘/ĨƚŚĞĚŝƐƉƵƚĞƌĞŵĂŝŶƐƵŶƌĞƐŽůǀĞĚĂĨƚĞƌŵĞĚŝĂƚŝŽŶ͕ƚŚĞŶĞŝƚŚĞƌŽĨƵƐŵĂLJĂƐƐĞƌƚŽƵƌƌĞƐƉĞĐƚŝǀĞ ƌŝŐŚƚƐĂŶĚƌĞŵĞĚŝĞƐŝŶĂĐŽƵƌƚŽĨĐŽŵƉĞƚĞŶƚũƵƌŝƐĚŝĐƚŝŽŶ͘EŽƚŚŝŶŐŝŶƚŚŝƐƐĞĐƚŝŽŶƐŚĂůůƉƌĞǀĞŶƚLJŽƵŽƌƵƐ ĨƌŽŵƐĞĞŬŝŶŐŶĞĐĞƐƐĂƌLJŝŶũƵŶĐƚŝǀĞƌĞůŝĞĨĚƵƌŝŶŐƚŚĞĚŝƐƉƵƚĞƌĞƐŽůƵƚŝŽŶƉƌŽĐĞĚƵƌĞƐ͘ Ϯϳ͘dĂdžĞƐ͘dŚĞĨĞĞƐŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĚŽŶŽƚŝŶĐůƵĚĞĂŶLJƚĂdžĞƐ͕ŝŶĐůƵĚŝŶŐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ ƐĂůĞƐ͕ƵƐĞ͕ŽƌĞdžĐŝƐĞƚĂdž͘/ĨLJŽƵĂƌĞĂƚĂdžͲĞdžĞŵƉƚĞŶƚŝƚLJ͕LJŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĂƚĂdžͲĞdžĞŵƉƚ ĐĞƌƚŝĨŝĐĂƚĞ͘KƚŚĞƌǁŝƐĞ͕ǁĞǁŝůůƉĂLJĂůůĂƉƉůŝĐĂďůĞƚĂdžĞƐƚŽƚŚĞƉƌŽƉĞƌĂƵƚŚŽƌŝƚŝĞƐĂŶĚLJŽƵǁŝůůƌĞŝŵďƵƌƐĞ ƵƐĨŽƌƐƵĐŚƚĂdžĞƐ͘/ĨLJŽƵŚĂǀĞĂǀĂůŝĚĚŝƌĞĐƚͲƉĂLJƉĞƌŵŝƚ͕LJŽƵĂŐƌĞĞƚŽƉƌŽǀŝĚĞƵƐǁŝƚŚĂĐŽƉLJ͘&ŽƌĐůĂƌŝƚLJ͕ ǁĞĂƌĞƌĞƐƉŽŶƐŝďůĞĨŽƌƉĂLJŝŶŐŽƵƌŝŶĐŽŵĞƚĂdžĞƐ͕ďŽƚŚĨĞĚĞƌĂůĂŶĚƐƚĂƚĞ͕ĂƐĂƉƉůŝĐĂďůĞ͕ĂƌŝƐŝŶŐĨƌŽŵŽƵƌ ƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘ Ϯϴ͘EŽŶĚŝƐĐƌŝŵŝŶĂƚŝŽŶ͘tĞǁŝůůŶŽƚĚŝƐĐƌŝŵŝŶĂƚĞĂŐĂŝŶƐƚĂŶLJƉĞƌƐŽŶĞŵƉůŽLJĞĚŽƌĂƉƉůLJŝŶŐĨŽƌĞŵƉůŽLJŵĞŶƚ ĐŽŶĐĞƌŶŝŶŐƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨŽƵƌƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘dŚŝƐĚŝƐĐƌŝŵŝŶĂƚŝŽŶ ƉƌŽŚŝďŝƚŝŽŶǁŝůůĂƉƉůLJƚŽĂůůŵĂƚƚĞƌƐŽĨŝŶŝƚŝĂůĞŵƉůŽLJŵĞŶƚ͕ƚĞŶƵƌĞ͕ĂŶĚƚĞƌŵƐŽĨĞŵƉůŽLJŵĞŶƚ͕Žƌ ŽƚŚĞƌǁŝƐĞǁŝƚŚƌĞƐƉĞĐƚƚŽĂŶLJŵĂƚƚĞƌĚŝƌĞĐƚůLJŽƌŝŶĚŝƌĞĐƚůLJƌĞůĂƚŝŶŐƚŽĞŵƉůŽLJŵĞŶƚĐŽŶĐĞƌŶŝŶŐƌĂĐĞ͕ ĐŽůŽƌ͕ƌĞůŝŐŝŽŶ͕ŶĂƚŝŽŶĂůŽƌŝŐŝŶ͕ĂŐĞ͕ƐĞdž͕ƐĞdžƵĂůŽƌŝĞŶƚĂƚŝŽŶ͕ĂŶĐĞƐƚƌLJ͕ĚŝƐĂďŝůŝƚLJƚŚĂƚŝƐƵŶƌĞůĂƚĞĚƚŽƚŚĞ ŝŶĚŝǀŝĚƵĂůΖƐĂďŝůŝƚLJƚŽƉĞƌĨŽƌŵƚŚĞĚƵƚŝĞƐŽĨĂƉĂƌƚŝĐƵůĂƌũŽďŽƌƉŽƐŝƚŝŽŶ͕ŚĞŝŐŚƚ͕ǁĞŝŐŚƚ͕ŵĂƌŝƚĂůƐƚĂƚƵƐ͕Žƌ ƉŽůŝƚŝĐĂůĂĨĨŝůŝĂƚŝŽŶ͘tĞǁŝůůƉŽƐƚ͕ǁŚĞƌĞĂƉƉƌŽƉƌŝĂƚĞ͕ĂůůŶŽƚŝĐĞƐƌĞůĂƚĞĚƚŽŶŽŶĚŝƐĐƌŝŵŝŶĂƚŝŽŶĂƐŵĂLJďĞ ƌĞƋƵŝƌĞĚďLJĂƉƉůŝĐĂďůĞůĂǁ͘ Ϯϵ͘ͲsĞƌŝĨLJ͘tĞŚĂǀĞĐŽŵƉůŝĞĚ͕ĂŶĚǁŝůůĐŽŵƉůLJ͕ǁŝƚŚƚŚĞͲsĞƌŝĨLJƉƌŽĐĞĚƵƌĞƐĂĚŵŝŶŝƐƚĞƌĞĚďLJƚŚĞh͘^͘ ŝƚŝnjĞŶƐŚŝƉĂŶĚ/ŵŵŝŐƌĂƚŝŽŶ^ĞƌǀŝĐĞƐsĞƌŝĨŝĐĂƚŝŽŶŝǀŝƐŝŽŶĨŽƌĂůůŽĨŽƵƌĞŵƉůŽLJĞĞƐĂƐƐŝŐŶĞĚƚŽLJŽƵƌ ƉƌŽũĞĐƚ͘ ϯϬ͘^ƵďĐŽŶƚƌĂĐƚŽƌƐ͘tĞǁŝůůŶŽƚƐƵďĐŽŶƚƌĂĐƚĂŶLJƐĞƌǀŝĐĞƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚǁŝƚŚŽƵƚLJŽƵƌƉƌŝŽƌǁƌŝƚƚĞŶ ĐŽŶƐĞŶƚ͕ŶŽƚƚŽďĞƵŶƌĞĂƐŽŶĂďůLJǁŝƚŚŚĞůĚ͘ ϯϭ͘ŝŶĚŝŶŐĨĨĞĐƚ͖EŽƐƐŝŐŶŵĞŶƚ͘dŚŝƐŐƌĞĞŵĞŶƚƐŚĂůůďĞďŝŶĚŝŶŐŽŶ͕ĂŶĚƐŚĂůůďĞĨŽƌƚŚĞďĞŶĞĨŝƚŽĨ͕ ĞŝƚŚĞƌLJŽƵƌŽƌŽƵƌƐƵĐĐĞƐƐŽƌ;ƐͿŽƌƉĞƌŵŝƚƚĞĚĂƐƐŝŐŶ;ƐͿ͘EĞŝƚŚĞƌƉĂƌƚLJŵĂLJĂƐƐŝŐŶƚŚŝƐŐƌĞĞŵĞŶƚǁŝƚŚŽƵƚ ƚŚĞƉƌŝŽƌǁƌŝƚƚĞŶĐŽŶƐĞŶƚŽĨƚŚĞŽƚŚĞƌƉĂƌƚLJ͖ƉƌŽǀŝĚĞĚ͕ŚŽǁĞǀĞƌ͕LJŽƵƌĐŽŶƐĞŶƚŝƐŶŽƚƌĞƋƵŝƌĞĚĨŽƌĂŶ ĂƐƐŝŐŶŵĞŶƚďLJƵƐĂƐĂƌĞƐƵůƚŽĨĂĐŽƌƉŽƌĂƚĞƌĞŽƌŐĂŶŝnjĂƚŝŽŶ͕ŵĞƌŐĞƌ͕ĂĐƋƵŝƐŝƚŝŽŶ͕ŽƌƉƵƌĐŚĂƐĞŽĨ ƐƵďƐƚĂŶƚŝĂůůLJĂůůŽĨŽƵƌĂƐƐĞƚƐ͘ ϯϮ͘&ŽƌĐĞDĂũĞƵƌĞ͘džĐĞƉƚĨŽƌLJŽƵƌƉĂLJŵĞŶƚŽďůŝŐĂƚŝŽŶƐ͕ŶĞŝƚŚĞƌƉĂƌƚLJǁŝůůďĞůŝĂďůĞĨŽƌĚĞůĂLJƐŝŶƉĞƌĨŽƌŵŝŶŐ ŝƚƐŽďůŝŐĂƚŝŽŶƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚƚŽƚŚĞĞdžƚĞŶƚƚŚĂƚƚŚĞĚĞůĂLJŝƐĐĂƵƐĞĚďLJ&ŽƌĐĞDĂũĞƵƌĞ͖ƉƌŽǀŝĚĞĚ͕ ŚŽǁĞǀĞƌ͕ƚŚĂƚǁŝƚŚŝŶƚĞŶ;ϭϬͿďƵƐŝŶĞƐƐĚĂLJƐŽĨƚŚĞ&ŽƌĐĞDĂũĞƵƌĞĞǀĞŶƚ͕ƚŚĞƉĂƌƚLJǁŚŽƐĞƉĞƌĨŽƌŵĂŶĐĞŝƐ ĚĞůĂLJĞĚƉƌŽǀŝĚĞƐƚŚĞŽƚŚĞƌƉĂƌƚLJǁŝƚŚǁƌŝƚƚĞŶŶŽƚŝĐĞĞdžƉůĂŝŶŝŶŐƚŚĞĐĂƵƐĞĂŶĚĞdžƚĞŶƚƚŚĞƌĞŽĨ͕ĂƐǁĞůůĂƐ ĂƌĞƋƵĞƐƚĨŽƌĂƌĞĂƐŽŶĂďůĞƚŝŵĞĞdžƚĞŶƐŝŽŶĞƋƵĂůƚŽƚŚĞĞƐƚŝŵĂƚĞĚĚƵƌĂƚŝŽŶŽĨƚŚĞ&ŽƌĐĞDĂũĞƵƌĞĞǀĞŶƚ͘ ϯϯ͘EŽ/ŶƚĞŶĚĞĚdŚŝƌĚWĂƌƚLJĞŶĞĨŝĐŝĂƌŝĞƐ͘dŚŝƐŐƌĞĞŵĞŶƚŝƐĞŶƚĞƌĞĚŝŶƚŽƐŽůĞůLJĨŽƌƚŚĞďĞŶĞĨŝƚŽĨLJŽƵĂŶĚ ƵƐ͘EŽƚŚŝƌĚƉĂƌƚLJǁŝůůďĞĚĞĞŵĞĚĂďĞŶĞĨŝĐŝĂƌLJŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͕ĂŶĚŶŽƚŚŝƌĚƉĂƌƚLJǁŝůůŚĂǀĞƚŚĞƌŝŐŚƚ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϳϵ ƚŽŵĂŬĞĂŶLJĐůĂŝŵŽƌĂƐƐĞƌƚĂŶLJƌŝŐŚƚƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘dŚŝƐƉƌŽǀŝƐŝŽŶĚŽĞƐŶŽƚĂĨĨĞĐƚƚŚĞƌŝŐŚƚƐŽĨ ƚŚŝƌĚƉĂƌƚŝĞƐƵŶĚĞƌĂŶLJdŚŝƌĚWĂƌƚLJdĞƌŵƐ͘ ϯϰ͘ŶƚŝƌĞŐƌĞĞŵĞŶƚ͖ŵĞŶĚŵĞŶƚ͘dŚŝƐŐƌĞĞŵĞŶƚƌĞƉƌĞƐĞŶƚƐƚŚĞĞŶƚŝƌĞĂŐƌĞĞŵĞŶƚďĞƚǁĞĞŶLJŽƵĂŶĚƵƐ ǁŝƚŚƌĞƐƉĞĐƚƚŽƚŚĞƐƵďũĞĐƚŵĂƚƚĞƌŚĞƌĞŽĨ͕ĂŶĚƐƵƉĞƌƐĞĚĞƐĂŶLJƉƌŝŽƌĂŐƌĞĞŵĞŶƚƐ͕ƵŶĚĞƌƐƚĂŶĚŝŶŐƐ͕ĂŶĚ ƌĞƉƌĞƐĞŶƚĂƚŝŽŶƐ͕ǁŚĞƚŚĞƌǁƌŝƚƚĞŶ͕ŽƌĂů͕ĞdžƉƌĞƐƐĞĚ͕ŝŵƉůŝĞĚ͕ŽƌƐƚĂƚƵƚŽƌLJ͘WƵƌĐŚĂƐĞŽƌĚĞƌƐƐƵďŵŝƚƚĞĚďLJ LJŽƵ͕ŝĨĂŶLJ͕ĂƌĞĨŽƌLJŽƵƌŝŶƚĞƌŶĂůĂĚŵŝŶŝƐƚƌĂƚŝǀĞƉƵƌƉŽƐĞƐŽŶůLJ͕ĂŶĚƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐĐŽŶƚĂŝŶĞĚ ŝŶƚŚŽƐĞƉƵƌĐŚĂƐĞŽƌĚĞƌƐǁŝůůŚĂǀĞŶŽĨŽƌĐĞŽƌĞĨĨĞĐƚ͘dŚŝƐŐƌĞĞŵĞŶƚŵĂLJŽŶůLJďĞŵŽĚŝĨŝĞĚďLJĂǁƌŝƚƚĞŶ ĂŵĞŶĚŵĞŶƚƐŝŐŶĞĚďLJĂŶĂƵƚŚŽƌŝnjĞĚƌĞƉƌĞƐĞŶƚĂƚŝǀĞŽĨĞĂĐŚƉĂƌƚLJ͘ ϯϱ͘^ĞǀĞƌĂďŝůŝƚLJ͘/ĨĂŶLJƚĞƌŵŽƌƉƌŽǀŝƐŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚŝƐŚĞůĚŝŶǀĂůŝĚŽƌƵŶĞŶĨŽƌĐĞĂďůĞ͕ƚŚĞƌĞŵĂŝŶĚĞƌ ŽĨƚŚŝƐŐƌĞĞŵĞŶƚǁŝůůďĞĐŽŶƐŝĚĞƌĞĚǀĂůŝĚĂŶĚĞŶĨŽƌĐĞĂďůĞƚŽƚŚĞĨƵůůĞƐƚĞdžƚĞŶƚƉĞƌŵŝƚƚĞĚďLJůĂǁ͘ ϯϲ͘EŽtĂŝǀĞƌ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐŽĨƚŚŝƐŐƌĞĞŵĞŶƚĂƌĞŶŽƚƐƚƌŝĐƚůLJĞŶĨŽƌĐĞĚďLJ ĞŝƚŚĞƌƉĂƌƚLJ͕ƐƵĐŚŶŽŶͲĞŶĨŽƌĐĞŵĞŶƚǁŝůůŶŽƚĂĐƚĂƐŽƌďĞĚĞĞŵĞĚƚŽĂĐƚĂƐĂǁĂŝǀĞƌŽƌŵŽĚŝĨŝĐĂƚŝŽŶŽĨ ƚŚŝƐŐƌĞĞŵĞŶƚ͕ŶŽƌǁŝůůƐƵĐŚŶŽŶͲĞŶĨŽƌĐĞŵĞŶƚƉƌĞǀĞŶƚƐƵĐŚƉĂƌƚLJĨƌŽŵĞŶĨŽƌĐŝŶŐĞĂĐŚĂŶĚĞǀĞƌLJƚĞƌŵ ŽĨƚŚŝƐŐƌĞĞŵĞŶƚƚŚĞƌĞĂĨƚĞƌ͘ ϯϳ͘/ŶĚĞƉĞŶĚĞŶƚŽŶƚƌĂĐƚŽƌ͘tĞĂƌĞĂŶŝŶĚĞƉĞŶĚĞŶƚĐŽŶƚƌĂĐƚŽƌĨŽƌĂůůƉƵƌƉŽƐĞƐƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘ ϯϴ͘EŽƚŝĐĞƐ͘ůůŶŽƚŝĐĞƐŽƌĐŽŵŵƵŶŝĐĂƚŝŽŶƐƌĞƋƵŝƌĞĚŽƌƉĞƌŵŝƚƚĞĚĂƐĂƉĂƌƚŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͕ƐƵĐŚĂƐ ŶŽƚŝĐĞŽĨĂŶĂůůĞŐĞĚŵĂƚĞƌŝĂůďƌĞĂĐŚĨŽƌĂƚĞƌŵŝŶĂƚŝŽŶĨŽƌĐĂƵƐĞŽƌĂĚŝƐƉƵƚĞƚŚĂƚŵƵƐƚďĞƐƵďŵŝƚƚĞĚƚŽ ĚŝƐƉƵƚĞƌĞƐŽůƵƚŝŽŶ͕ŵƵƐƚďĞŝŶǁƌŝƚŝŶŐĂŶĚǁŝůůďĞĚĞĞŵĞĚĚĞůŝǀĞƌĞĚƵƉŽŶƚŚĞĞĂƌůŝĞƌŽĨƚŚĞĨŽůůŽǁŝŶŐ͗;ĂͿ ĂĐƚƵĂůƌĞĐĞŝƉƚďLJƚŚĞƌĞĐĞŝǀŝŶŐƉĂƌƚLJ͖;ďͿƵƉŽŶƌĞĐĞŝƉƚďLJƐĞŶĚĞƌŽĨĂĐĞƌƚŝĨŝĞĚŵĂŝů͕ƌĞƚƵƌŶƌĞĐĞŝƉƚƐŝŐŶĞĚ ďLJĂŶĞŵƉůŽLJĞĞŽƌĂŐĞŶƚŽĨƚŚĞƌĞĐĞŝǀŝŶŐƉĂƌƚLJ͖;ĐͿƵƉŽŶƌĞĐĞŝƉƚďLJƐĞŶĚĞƌŽĨƉƌŽŽĨŽĨĞŵĂŝůĚĞůŝǀĞƌLJ͖Žƌ ;ĚͿŝĨŶŽƚĂĐƚƵĂůůLJƌĞĐĞŝǀĞĚ͕ĨŝǀĞ;ϱͿĚĂLJƐĂĨƚĞƌĚĞƉŽƐŝƚǁŝƚŚƚŚĞhŶŝƚĞĚ^ƚĂƚĞƐWŽƐƚĂů^ĞƌǀŝĐĞĂƵƚŚŽƌŝnjĞĚ ŵĂŝůĐĞŶƚĞƌǁŝƚŚƉƌŽƉĞƌƉŽƐƚĂŐĞ;ĐĞƌƚŝĨŝĞĚŵĂŝů͕ƌĞƚƵƌŶƌĞĐĞŝƉƚƌĞƋƵĞƐƚĞĚͿĂĨĨŝdžĞĚĂŶĚĂĚĚƌĞƐƐĞĚƚŽƚŚĞ ŽƚŚĞƌƉĂƌƚLJĂƚƚŚĞĂĚĚƌĞƐƐƐĞƚĨŽƌƚŚŽŶƚŚĞƐŝŐŶĂƚƵƌĞƉĂŐĞŚĞƌĞƚŽŽƌƐƵĐŚŽƚŚĞƌĂĚĚƌĞƐƐĂƐƚŚĞƉĂƌƚLJŵĂLJ ŚĂǀĞĚĞƐŝŐŶĂƚĞĚďLJƉƌŽƉĞƌŶŽƚŝĐĞ͘dŚĞĐŽŶƐĞƋƵĞŶĐĞƐĨŽƌƚŚĞĨĂŝůƵƌĞƚŽƌĞĐĞŝǀĞĂŶŽƚŝĐĞĚƵĞƚŽŝŵƉƌŽƉĞƌ ŶŽƚŝĨŝĐĂƚŝŽŶďLJƚŚĞŝŶƚĞŶĚĞĚƌĞĐĞŝǀŝŶŐƉĂƌƚLJŽĨĂĐŚĂŶŐĞŝŶĂĚĚƌĞƐƐǁŝůůďĞďŽƌŶĞďLJƚŚĞŝŶƚĞŶĚĞĚ ƌĞĐĞŝǀŝŶŐƉĂƌƚLJ͘ ϯϵ͘ůŝĞŶƚ>ŝƐƚƐ͘zŽƵĂŐƌĞĞƚŚĂƚǁĞŵĂLJŝĚĞŶƚŝĨLJLJŽƵďLJŶĂŵĞŝŶĐůŝĞŶƚůŝƐƚƐ͕ŵĂƌŬĞƚŝŶŐƉƌĞƐĞŶƚĂƚŝŽŶƐ͕ĂŶĚ ƉƌŽŵŽƚŝŽŶĂůŵĂƚĞƌŝĂůƐ͘ ϰϬ͘ŽŶĨŝĚĞŶƚŝĂůŝƚLJ͘ŽƚŚƉĂƌƚŝĞƐƌĞĐŽŐŶŝnjĞƚŚĂƚƚŚĞŝƌƌĞƐƉĞĐƚŝǀĞĞŵƉůŽLJĞĞƐĂŶĚĂŐĞŶƚƐ͕ŝŶƚŚĞĐŽƵƌƐĞŽĨ ƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͕ŵĂLJďĞĞdžƉŽƐĞĚƚŽĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶĂŶĚƚŚĂƚĚŝƐĐůŽƐƵƌĞŽĨƐƵĐŚ ŝŶĨŽƌŵĂƚŝŽŶĐŽƵůĚǀŝŽůĂƚĞƌŝŐŚƚƐƚŽƉƌŝǀĂƚĞŝŶĚŝǀŝĚƵĂůƐĂŶĚĞŶƚŝƚŝĞƐ͕ŝŶĐůƵĚŝŶŐƚŚĞƉĂƌƚŝĞƐ͘ŽŶĨŝĚĞŶƚŝĂů ŝŶĨŽƌŵĂƚŝŽŶŝƐŶŽŶƉƵďůŝĐŝŶĨŽƌŵĂƚŝŽŶƚŚĂƚĂƌĞĂƐŽŶĂďůĞƉĞƌƐŽŶǁŽƵůĚďĞůŝĞǀĞƚŽďĞĐŽŶĨŝĚĞŶƚŝĂůĂŶĚ ŝŶĐůƵĚĞƐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ƉĞƌƐŽŶĂůŝĚĞŶƚŝĨLJŝŶŐŝŶĨŽƌŵĂƚŝŽŶ;Ğ͘Ő͕͘ƐŽĐŝĂůƐĞĐƵƌŝƚLJŶƵŵďĞƌƐͿĂŶĚƚƌĂĚĞ ƐĞĐƌĞƚƐ͕ĞĂĐŚĂƐĚĞĨŝŶĞĚďLJĂƉƉůŝĐĂďůĞƐƚĂƚĞůĂǁ͘ĂĐŚƉĂƌƚLJĂŐƌĞĞƐƚŚĂƚŝƚǁŝůůŶŽƚĚŝƐĐůŽƐĞĂŶLJ ĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶŽĨƚŚĞŽƚŚĞƌƉĂƌƚLJĂŶĚĨƵƌƚŚĞƌĂŐƌĞĞƐƚŽƚĂŬĞĂůůƌĞĂƐŽŶĂďůĞĂŶĚĂƉƉƌŽƉƌŝĂƚĞ ĂĐƚŝŽŶƚŽƉƌĞǀĞŶƚƐƵĐŚĚŝƐĐůŽƐƵƌĞďLJŝƚƐĞŵƉůŽLJĞĞƐŽƌĂŐĞŶƚƐ͘dŚĞĐŽŶĨŝĚĞŶƚŝĂůŝƚLJĐŽǀĞŶĂŶƚƐĐŽŶƚĂŝŶĞĚ ŚĞƌĞŝŶǁŝůůƐƵƌǀŝǀĞƚŚĞƚĞƌŵŝŶĂƚŝŽŶŽƌĐĂŶĐĞůůĂƚŝŽŶŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘dŚŝƐŽďůŝŐĂƚŝŽŶŽĨĐŽŶĨŝĚĞŶƚŝĂůŝƚLJ ǁŝůůŶŽƚĂƉƉůLJƚŽŝŶĨŽƌŵĂƚŝŽŶƚŚĂƚ͗ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϬ ;ĞͿŝƐŝŶƚŚĞƉƵďůŝĐĚŽŵĂŝŶ͕ĞŝƚŚĞƌĂƚƚŚĞƚŝŵĞŽĨĚŝƐĐůŽƐƵƌĞŽƌĂĨƚĞƌǁĂƌĚƐ͕ĞdžĐĞƉƚďLJďƌĞĂĐŚŽĨƚŚŝƐ ŐƌĞĞŵĞŶƚďLJĂƉĂƌƚLJŽƌŝƚƐĞŵƉůŽLJĞĞƐŽƌĂŐĞŶƚƐ͖ ;ĨͿĂƉĂƌƚLJĐĂŶĞƐƚĂďůŝƐŚďLJƌĞĂƐŽŶĂďůĞƉƌŽŽĨǁĂƐŝŶƚŚĂƚƉĂƌƚLJΖƐƉŽƐƐĞƐƐŝŽŶĂƚƚŚĞƚŝŵĞŽĨŝŶŝƚŝĂů ĚŝƐĐůŽƐƵƌĞ͖ ;ŐͿĂƉĂƌƚLJƌĞĐĞŝǀĞƐĨƌŽŵĂƚŚŝƌĚƉĂƌƚLJǁŚŽŚĂƐĂƌŝŐŚƚƚŽĚŝƐĐůŽƐĞŝƚƚŽƚŚĞƌĞĐĞŝǀŝŶŐƉĂƌƚLJ͖Žƌ ;ŚͿŝƐƚŚĞƐƵďũĞĐƚŽĨĂůĞŐŝƚŝŵĂƚĞĚŝƐĐůŽƐƵƌĞƌĞƋƵĞƐƚƵŶĚĞƌƚŚĞŽƉĞŶƌĞĐŽƌĚƐůĂǁƐŽƌƐŝŵŝůĂƌ ĂƉƉůŝĐĂďůĞƉƵďůŝĐĚŝƐĐůŽƐƵƌĞůĂǁƐŐŽǀĞƌŶŝŶŐƚŚŝƐŐƌĞĞŵĞŶƚ͖ƉƌŽǀŝĚĞĚ͕ŚŽǁĞǀĞƌ͕ƚŚĂƚŝŶƚŚĞ ĞǀĞŶƚLJŽƵƌĞĐĞŝǀĞĂŶŽƉĞŶƌĞĐŽƌĚƐŽƌŽƚŚĞƌƐŝŵŝůĂƌĂƉƉůŝĐĂďůĞƌĞƋƵĞƐƚ͕LJŽƵǁŝůůŐŝǀĞƵƐƉƌŽŵƉƚ ŶŽƚŝĐĞĂŶĚŽƚŚĞƌǁŝƐĞƉĞƌĨŽƌŵƚŚĞĨƵŶĐƚŝŽŶƐƌĞƋƵŝƌĞĚďLJĂƉƉůŝĐĂďůĞůĂǁ͘ ϰϭ͘ƵƐŝŶĞƐƐ>ŝĐĞŶƐĞ͘/ŶƚŚĞĞǀĞŶƚĂůŽĐĂůďƵƐŝŶĞƐƐůŝĐĞŶƐĞŝƐƌĞƋƵŝƌĞĚĨŽƌƵƐƚŽƉĞƌĨŽƌŵƐĞƌǀŝĐĞƐŚĞƌĞƵŶĚĞƌ͕ LJŽƵǁŝůůƉƌŽŵƉƚůLJŶŽƚŝĨLJƵƐĂŶĚƉƌŽǀŝĚĞƵƐǁŝƚŚƚŚĞŶĞĐĞƐƐĂƌLJƉĂƉĞƌǁŽƌŬĂŶĚͬŽƌĐŽŶƚĂĐƚŝŶĨŽƌŵĂƚŝŽŶƐŽ ƚŚĂƚǁĞŵĂLJƚŝŵĞůLJŽďƚĂŝŶƐƵĐŚůŝĐĞŶƐĞ͘ ϰϮ͘'ŽǀĞƌŶŝŶŐ>Ăǁ͘dŚŝƐŐƌĞĞŵĞŶƚǁŝůůďĞŐŽǀĞƌŶĞĚďLJĂŶĚĐŽŶƐƚƌƵĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞůĂǁƐŽĨLJŽƵƌ ƐƚĂƚĞŽĨĚŽŵŝĐŝůĞ͕ǁŝƚŚŽƵƚƌĞŐĂƌĚƚŽŝƚƐƌƵůĞƐŽŶĐŽŶĨůŝĐƚƐŽĨůĂǁ͘ ϰϯ͘DƵůƚŝƉůĞKƌŝŐŝŶĂůƐĂŶĚƵƚŚŽƌŝnjĞĚ^ŝŐŶĂƚƵƌĞƐ͘dŚŝƐŐƌĞĞŵĞŶƚŵĂLJďĞĞdžĞĐƵƚĞĚŝŶŵƵůƚŝƉůĞŽƌŝŐŝŶĂůƐ͕ ĂŶLJŽĨǁŚŝĐŚǁŝůůďĞŝŶĚĞƉĞŶĚĞŶƚůLJƚƌĞĂƚĞĚĂƐĂŶŽƌŝŐŝŶĂůĚŽĐƵŵĞŶƚ͘ŶLJĞůĞĐƚƌŽŶŝĐ͕ĨĂdžĞĚ͕ƐĐĂŶŶĞĚ͕ ƉŚŽƚŽĐŽƉŝĞĚ͕ŽƌƐŝŵŝůĂƌůLJƌĞƉƌŽĚƵĐĞĚƐŝŐŶĂƚƵƌĞŽŶƚŚŝƐŐƌĞĞŵĞŶƚŽƌĂŶLJĂŵĞŶĚŵĞŶƚŚĞƌĞƚŽǁŝůůďĞ ĚĞĞŵĞĚĂŶŽƌŝŐŝŶĂůƐŝŐŶĂƚƵƌĞĂŶĚǁŝůůďĞĨƵůůLJĞŶĨŽƌĐĞĂďůĞĂƐŝĨĂŶŽƌŝŐŝŶĂůƐŝŐŶĂƚƵƌĞ͘ĂĐŚƉĂƌƚLJ ƌĞƉƌĞƐĞŶƚƐƚŽƚŚĞŽƚŚĞƌƚŚĂƚƚŚĞƐŝŐŶĂƚŽƌLJƐĞƚĨŽƌƚŚďĞůŽǁŝƐĚƵůLJĂƵƚŚŽƌŝnjĞĚƚŽďŝŶĚƚŚĂƚƉĂƌƚLJƚŽƚŚŝƐ ŐƌĞĞŵĞŶƚ͘ ϰϰ͘ŽŽƉĞƌĂƚŝǀĞWƌŽĐƵƌĞŵĞŶƚ͘dŽƚŚĞŵĂdžŝŵƵŵĞdžƚĞŶƚƉĞƌŵŝƚƚĞĚďLJĂƉƉůŝĐĂďůĞůĂǁ͕ǁĞĂŐƌĞĞƚŚĂƚƚŚŝƐ ŐƌĞĞŵĞŶƚŵĂLJďĞƵƐĞĚĂƐĂĐŽŽƉĞƌĂƚŝǀĞƉƌŽĐƵƌĞŵĞŶƚǀĞŚŝĐůĞďLJĞůŝŐŝďůĞũƵƌŝƐĚŝĐƚŝŽŶƐ͘tĞƌĞƐĞƌǀĞƚŚĞ ƌŝŐŚƚƚŽŶĞŐŽƚŝĂƚĞĂŶĚĐƵƐƚŽŵŝnjĞƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐƐĞƚĨŽƌƚŚŚĞƌĞŝŶ͕ŝŶĐůƵĚŝŶŐďƵƚŶŽƚůŝŵŝƚĞĚƚŽ ƉƌŝĐŝŶŐ͕ƚŽƚŚĞƐĐŽƉĞĂŶĚĐŝƌĐƵŵƐƚĂŶĐĞƐŽĨƚŚĂƚĐŽŽƉĞƌĂƚŝǀĞƉƌŽĐƵƌĞŵĞŶƚ͘ ϰϱ͘ŽŶƚƌĂĐƚŽĐƵŵĞŶƚƐ͘dŚŝƐŐƌĞĞŵĞŶƚŝŶĐůƵĚĞƐƚŚĞĨŽůůŽǁŝŶŐĞdžŚŝďŝƚƐ͗ džŚŝďŝƚ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ džŚŝďŝƚ /ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ ^ĐŚĞĚƵůĞϭ͗ƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJ džŚŝďŝƚ ^ĞƌǀŝĐĞ>ĞǀĞůŐƌĞĞŵĞŶƚ ^ĐŚĞĚƵůĞϭ͗^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ džŚŝďŝƚ dŚŝƌĚWĂƌƚLJdĞƌŵƐ džŚŝďŝƚ ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬ /Et/dE^^t,ZK&͕ĂĚƵůLJĂƵƚŚŽƌŝnjĞĚƌĞƉƌĞƐĞŶƚĂƚŝǀĞŽĨĞĂĐŚƉĂƌƚLJŚĂƐĞdžĞĐƵƚĞĚƚŚŝƐŐƌĞĞŵĞŶƚĂƐŽĨ ƚŚĞĚĂƚĞ;ƐͿƐĞƚĨŽƌƚŚďĞůŽǁ͘ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘/E^Zd>/EdED ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϭ LJ͗LJ͗ EĂŵĞ͗EĂŵĞ͗ dŝƚůĞ͗dŝƚůĞ͗ ĂƚĞ͗ĂƚĞ͗ ĚĚƌĞƐƐĨŽƌEŽƚŝĐĞƐ͗ĚĚƌĞƐƐĨŽƌEŽƚŝĐĞƐ͗ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ /E^Zd>/EdED KŶĞdLJůĞƌƌŝǀĞ /E^Zd zĂƌŵŽƵƚŚ͕DϬϰϬϵϲ /E^Zd ƚƚĞŶƚŝŽŶ͗ŚŝĞĨ>ĞŐĂůKĨĨŝĐĞƌ ƚƚĞŶƚŝŽŶ͗ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϮ džŚŝďŝƚ /ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ dŚĞĨŽůůŽǁŝŶŐ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĚĞƚĂŝůƐƚŚĞƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐƚŽďĞĚĞůŝǀĞƌĞĚďLJƵƐƚŽLJŽƵƵŶĚĞƌƚŚĞ ŐƌĞĞŵĞŶƚ͘dŚŝƐ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJŝƐĞĨĨĞĐƚŝǀĞĂƐŽĨƚŚĞĨĨĞĐƚŝǀĞĂƚĞ͘ĂƉŝƚĂůŝnjĞĚƚĞƌŵƐŶŽƚŽƚŚĞƌǁŝƐĞ ĚĞĨŝŶĞĚǁŝůůŚĂǀĞƚŚĞŵĞĂŶŝŶŐĂƐƐŝŐŶĞĚƚŽƐƵĐŚƚĞƌŵƐŝŶƚŚĞŐƌĞĞŵĞŶƚ͘ dLJůĞƌƐĂůĞƐƋƵŽƚĂƚŝŽŶƚŽďĞŝŶƐĞƌƚĞĚƉƌŝŽƌƚŽŐƌĞĞŵĞŶƚĞdžĞĐƵƚŝŽŶ͘ ZD/EZK&W'/EdEd/KE>>z>&d>E< ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϯ džŚŝďŝƚ /ŶǀŽŝĐŝŶŐĂŶĚWĂLJŵĞŶƚWŽůŝĐLJ tĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚƚŚĞƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJŽĨƚŚĞŐƌĞĞŵĞŶƚ͘ ĂƉŝƚĂůŝnjĞĚƚĞƌŵƐŶŽƚŽƚŚĞƌǁŝƐĞĚĞĨŝŶĞĚǁŝůůŚĂǀĞƚŚĞŵĞĂŶŝŶŐĂƐƐŝŐŶĞĚƚŽƐƵĐŚƚĞƌŵƐŝŶƚŚĞŐƌĞĞŵĞŶƚ͘ /ŶǀŽŝĐŝŶŐ͗tĞǁŝůůŝŶǀŽŝĐĞLJŽƵĨŽƌƚŚĞĂƉƉůŝĐĂďůĞƐŽĨƚǁĂƌĞĂŶĚƐĞƌǀŝĐĞƐŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĂƐƐĞƚ ĨŽƌƚŚďĞůŽǁ͘zŽƵƌƌŝŐŚƚƐƚŽĚŝƐƉƵƚĞĂŶLJŝŶǀŽŝĐĞĂƌĞƐĞƚĨŽƌƚŚŝŶƚŚĞŐƌĞĞŵĞŶƚ͘ ϭ͘^ĂĂ^&ĞĞƐ͘^ĂĂ^&ĞĞƐĂƌĞŝŶǀŽŝĐĞĚŽŶĂŶĂŶŶƵĂůďĂƐŝƐ͕ďĞŐŝŶŶŝŶŐŽŶƚŚĞĐŽŵŵĞŶĐĞŵĞŶƚŽĨƚŚĞŝŶŝƚŝĂů ƚĞƌŵĂƐƐĞƚĨŽƌƚŚŝŶ^ĞĐƚŝŽŶ&;ϭͿŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͘zŽƵƌĂŶŶƵĂů^ĂĂ^ĨĞĞƐĨŽƌƚŚĞŝŶŝƚŝĂůƚĞƌŵĂƌĞƐĞƚ ĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘hƉŽŶĞdžƉŝƌĂƚŝŽŶŽĨƚŚĞŝŶŝƚŝĂůƚĞƌŵ͕LJŽƵƌĂŶŶƵĂů^ĂĂ^ĨĞĞƐǁŝůůďĞ ĂƚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚƌĂƚĞƐ͘ Ϯ͘KƚŚĞƌdLJůĞƌ^ŽĨƚǁĂƌĞĂŶĚ^ĞƌǀŝĐĞƐ͘ Ϯ͘ϭsWEĞǀŝĐĞ͗dŚĞĨĞĞĨŽƌƚŚĞsWEĚĞǀŝĐĞǁŝůůďĞŝŶǀŽŝĐĞĚƵƉŽŶŝŶƐƚĂůůĂƚŝŽŶŽĨƚŚĞsWE͘ Ϯ͘Ϯ/ŵƉůĞŵĞŶƚĂƚŝŽŶĂŶĚKƚŚĞƌWƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ;ŝŶĐůƵĚŝŶŐƚƌĂŝŶŝŶŐͿ͗/ŵƉůĞŵĞŶƚĂƚŝŽŶĂŶĚŽƚŚĞƌ ƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐ;ŝŶĐůƵĚŝŶŐƚƌĂŝŶŝŶŐͿĂƌĞďŝůůĞĚĂŶĚŝŶǀŽŝĐĞĚĂƐĚĞůŝǀĞƌĞĚ͕ĂƚƚŚĞƌĂƚĞƐƐĞƚ ĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ϰ Ϯ͘ϯŽŶƐƵůƚŝŶŐ^ĞƌǀŝĐĞƐ͗/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚĂŶLJƵƐŝŶĞƐƐWƌŽĐĞƐƐŽŶƐƵůƚŝŶŐƐĞƌǀŝĐĞƐ͕ŝĨƚŚĞLJŚĂǀĞ ďĞĞŶƋƵŽƚĞĚĂƐĨŝdžĞĚͲĨĞĞƐĞƌǀŝĐĞƐ͕ƚŚĞLJǁŝůůďĞŝŶǀŽŝĐĞĚϱϬйƵƉŽŶLJŽƵƌĂĐĐĞƉƚĂŶĐĞŽĨƚŚĞĞƐƚ WƌĂĐƚŝĐĞZĞĐŽŵŵĞŶĚĂƚŝŽŶƐ͕ďLJŵŽĚƵůĞ͕ĂŶĚϱϬйƵƉŽŶLJŽƵƌĂĐĐĞƉƚĂŶĐĞŽĨĐƵƐƚŽŵĚĞƐŬƚŽƉ ƉƌŽĐĞĚƵƌĞƐ͕ďLJŵŽĚƵůĞ͘/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚĂŶLJƵƐŝŶĞƐƐWƌŽĐĞƐƐŽŶƐƵůƚŝŶŐƐĞƌǀŝĐĞƐĂŶĚ ƚŚĞLJĂƌĞƋƵŽƚĞĚĂƐĂŶĞƐƚŝŵĂƚĞ͕ƚŚĞŶǁĞǁŝůůďŝůůLJŽƵƚŚĞĂĐƚƵĂůƐĞƌǀŝĐĞƐĚĞůŝǀĞƌĞĚŽŶĂƚŝŵĞĂŶĚ ŵĂƚĞƌŝĂůƐďĂƐŝƐ͘ Ϯ͘ϰŽŶǀĞƌƐŝŽŶƐ͗&ŝdžĞĚͲĨĞĞĐŽŶǀĞƌƐŝŽŶƐĂƌĞŝŶǀŽŝĐĞĚϱϬйƵƉŽŶŝŶŝƚŝĂůĚĞůŝǀĞƌLJŽĨƚŚĞĐŽŶǀĞƌƚĞĚĂƚĂ͕ ďLJĐŽŶǀĞƌƐŝŽŶŽƉƚŝŽŶ͕ĂŶĚϱϬйƵƉŽŶůŝĞŶƚĂĐĐĞƉƚĂŶĐĞƚŽůŽĂĚƚŚĞĐŽŶǀĞƌƚĞĚĂƚĂŝŶƚŽ ϰ/&/DW>DEdd/KE^Zs/^͕d͘ZYhKd^WZdK&^^&^͕ZW>d,/^dydt/d,͗ ͞/DW>DEdd/KEEKEsZ^/KE^Zs/^ZYhKd^WZdK&zKhZ^^&^͕Et/>> /EsK/^^d&KZd,Ks͘͟ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϰ >ŝǀĞͬWƌŽĚƵĐƚŝŽŶĞŶǀŝƌŽŶŵĞŶƚ͕ďLJĐŽŶǀĞƌƐŝŽŶŽƉƚŝŽŶ͘tŚĞƌĞĐŽŶǀĞƌƐŝŽŶƐĂƌĞƋƵŽƚĞĚĂƐ ĞƐƚŝŵĂƚĞĚ͕ǁĞǁŝůůďŝůůLJŽƵƚŚĞĂĐƚƵĂůƐĞƌǀŝĐĞƐĚĞůŝǀĞƌĞĚŽŶĂƚŝŵĞĂŶĚŵĂƚĞƌŝĂůƐďĂƐŝƐ͘ϱ Ϯ͘ϱZĞƋƵĞƐƚĞĚDŽĚŝĨŝĐĂƚŝŽŶƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ͗ZĞƋƵĞƐƚĞĚŵŽĚŝĨŝĐĂƚŝŽŶƐƚŽƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞ ĂƌĞŝŶǀŽŝĐĞĚϱϬйƵƉŽŶĚĞůŝǀĞƌLJŽĨƐƉĞĐŝĨŝĐĂƚŝŽŶƐĂŶĚϱϬйƵƉŽŶĚĞůŝǀĞƌLJŽĨƚŚĞĂƉƉůŝĐĂďůĞ ŵŽĚŝĨŝĐĂƚŝŽŶ͘zŽƵŵƵƐƚƌĞƉŽƌƚĂŶLJĨĂŝůƵƌĞŽĨƚŚĞŵŽĚŝĨŝĐĂƚŝŽŶƚŽĐŽŶĨŽƌŵƚŽƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐ ǁŝƚŚŝŶƚŚŝƌƚLJ;ϯϬͿĚĂLJƐŽĨĚĞůŝǀĞƌLJ͖ŽƚŚĞƌǁŝƐĞ͕ƚŚĞŵŽĚŝĨŝĐĂƚŝŽŶǁŝůůďĞĚĞĞŵĞĚƚŽďĞŝŶ ĐŽŵƉůŝĂŶĐĞǁŝƚŚƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐĂĨƚĞƌƚŚĞϯϬͲĚĂLJǁŝŶĚŽǁŚĂƐƉĂƐƐĞĚ͘zŽƵŵĂLJƐƚŝůůƌĞƉŽƌƚ ĞĨĞĐƚƐƚŽƵƐĂƐƐĞƚĨŽƌƚŚŝŶƚŚŝƐŐƌĞĞŵĞŶƚ͘ Ϯ͘ϲKƚŚĞƌ&ŝdžĞĚWƌŝĐĞ^ĞƌǀŝĐĞƐ͗KƚŚĞƌĨŝdžĞĚƉƌŝĐĞƐĞƌǀŝĐĞƐĂƌĞŝŶǀŽŝĐĞĚĂƐĚĞůŝǀĞƌĞĚ͕ĂƚƚŚĞƌĂƚĞƐƐĞƚ ĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘&ŽƌƚŚĞĂǀŽŝĚĂŶĐĞŽĨĚŽƵďƚ͕ǁŚĞƌĞ͞WƌŽũĞĐƚWůĂŶŶŝŶŐ ^ĞƌǀŝĐĞƐ͟ĂƌĞƉƌŽǀŝĚĞĚ͕ƉĂLJŵĞŶƚǁŝůůďĞĚƵĞƵƉŽŶĚĞůŝǀĞƌLJŽĨƚŚĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶŶŝŶŐ ĚŽĐƵŵĞŶƚ͘ ĞĚŝĐĂƚĞĚWƌŽũĞĐƚDĂŶĂŐĞŵĞŶƚƐĞƌǀŝĐĞƐ͕ŝĨĂŶLJ͕ǁŝůůďĞďŝůůĞĚŵŽŶƚŚůLJŝŶĂƌƌĞĂƌƐ͕ďĞŐŝŶŶŝŶŐŽŶ ƚŚĞĨŝƌƐƚĚĂLJŽĨƚŚĞŵŽŶƚŚŝŵŵĞĚŝĂƚĞůLJĨŽůůŽǁŝŶŐŝŶŝƚŝĂƚŝŽŶŽĨƉƌŽũĞĐƚƉůĂŶŶŝŶŐ͘ ŚĂŶŐĞDĂŶĂŐĞŵĞŶƚ^ĞƌǀŝĐĞƐ͗/ĨLJŽƵŚĂǀĞƉƵƌĐŚĂƐĞĚĂŶLJĐŚĂŶŐĞŵĂŶĂŐĞŵĞŶƚƐĞƌǀŝĐĞƐ͕ƚŚŽƐĞ ƐĞƌǀŝĐĞƐǁŝůůďĞŝŶǀŽŝĐĞĚŝŶƚŚĞĨŽůůŽǁŝŶŐĂŵŽƵŶƚƐĂŶĚƵƉŽŶƚŚĞ ĨŽůůŽǁŝŶŐŵŝůĞƐƚŽŶĞƐ͗ ĐĐĞƉƚĂŶĐĞŽĨŚĂŶŐĞDĂŶĂŐĞŵĞŶƚŝƐĐŽǀĞƌLJŶĂůLJƐŝƐϭϱй ĞůŝǀĞƌLJŽĨŚĂŶŐĞDĂŶĂŐĞŵĞŶƚWůĂŶĂŶĚ^ƚƌĂƚĞŐLJWƌĞƐĞŶƚĂƚŝŽŶϭϬй ĐĐĞƉƚĂŶĐĞŽĨdžĞĐƵƚŝǀĞWůĂLJŬϭϱй ĐĐĞƉƚĂŶĐĞŽĨZĞƐŝƐƚĂŶĐĞDĂŶĂŐĞŵĞŶƚWůĂŶϭϱй ĐĐĞƉƚĂŶĐĞŽĨWƌŽĐĞĚƵƌĂůŚĂŶŐĞŽŵŵƵŶŝĐĂƚŝŽŶƐWůĂŶϭϬй ŚĂŶŐĞDĂŶĂŐĞŵĞŶƚŽĂĐŚdƌĂŝŶŝŶŐϮϬй ŚĂŶŐĞDĂŶĂŐĞŵĞŶƚĨƚĞƌͲĐƚŝŽŶZĞǀŝĞǁϭϱй ϯ͘dŚŝƌĚWĂƌƚLJWƌŽĚƵĐƚƐ͘ ϯ͘ϭdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ>ŝĐĞŶƐĞ&ĞĞƐ͗>ŝĐĞŶƐĞĨĞĞƐĨŽƌdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞ͕ŝĨĂŶLJ͕ĂƌĞŝŶǀŽŝĐĞĚ ǁŚĞŶǁĞŵĂŬĞŝƚĂǀĂŝůĂďůĞƚŽLJŽƵĨŽƌĚŽǁŶůŽĂĚŝŶŐ͘ ϯ͘ϮdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞDĂŝŶƚĞŶĂŶĐĞ͗dŚĞĨŝƌƐƚLJĞĂƌŵĂŝŶƚĞŶĂŶĐĞĨŽƌƚŚĞdŚŝƌĚWĂƌƚLJ^ŽĨƚǁĂƌĞŝƐ ŝŶǀŽŝĐĞĚǁŚĞŶǁĞŵĂŬĞŝƚĂǀĂŝůĂďůĞƚŽLJŽƵĨŽƌĚŽǁŶůŽĂĚŝŶŐ͘ ϯ͘ϯdŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞ͗dŚŝƌĚWĂƌƚLJ,ĂƌĚǁĂƌĞĐŽƐƚƐ͕ŝĨĂŶLJ͕ĂƌĞŝŶǀŽŝĐĞĚƵƉŽŶĚĞůŝǀĞƌLJ͘ ϯ͘ϰdŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͗&ĞĞƐĨŽƌdŚŝƌĚWĂƌƚLJ^ĞƌǀŝĐĞƐ͕ŝĨĂŶLJ͕ĂƌĞŝŶǀŽŝĐĞĚĂƐĚĞůŝǀĞƌĞĚ͕ĂůŽŶŐǁŝƚŚ ĂƉƉůŝĐĂďůĞĞdžƉĞŶƐĞƐ͕ĂƚƚŚĞƌĂƚĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘ ϱZDKs/&/DW>DEdd/KEEKEsZ^/KE^Zs/^&^ZK>>/EdK^^&^͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϱ ϯ͘ϱdLJůĞƌEŽƚŝĨLJDŝŶƵƚĞƐĂŶĚDĞƐƐĂŐĞƐ͗dLJůĞƌEŽƚŝĨLJDŝŶƵƚĞƐĂŶĚDĞƐƐĂŐĞƐĂƌĞŝŶǀŽŝĐĞĚǁŚĞŶǁĞ ŵĂŬĞdLJůĞƌEŽƚŝĨLJĂǀĂŝůĂďůĞƚŽLJŽƵ͘^ƵďƐĞƋƵĞŶƚĨĞĞƐĨŽƌŵŝŶƵƚĞƐĂŶĚŵĞƐƐĂŐĞƐ͕ĂƚŽƵƌƚŚĞŶͲ ĐƵƌƌĞŶƚƌĂƚĞƐ͕ǁŝůůďĞĚƵĞǁŚĞŶLJŽƵƌĞƋƵĞƐƚĂĚĚŝƚŝŽŶĂůŵŝŶƵƚĞƐĂŶĚŵĞƐƐĂŐĞƐĂŶĚƚŚĞLJĂƌĞ ŵĂĚĞĂǀĂŝůĂďůĞƚŽLJŽƵ͘ ϰ͘džƉĞŶƐĞƐ͘dŚĞƐĞƌǀŝĐĞƌĂƚĞƐŝŶƚŚĞ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJĚŽŶŽƚŝŶĐůƵĚĞƚƌĂǀĞůĞdžƉĞŶƐĞƐ͘džƉĞŶƐĞƐ ĨŽƌdLJůĞƌĚĞůŝǀĞƌĞĚƐĞƌǀŝĐĞƐǁŝůůďĞďŝůůĞĚĂƐŝŶĐƵƌƌĞĚĂŶĚŽŶůLJŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŽƵƌƚŚĞŶͲĐƵƌƌĞŶƚ ƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJ͕ƉůƵƐĂϭϬйƚƌĂǀĞůĂŐĞŶĐLJƉƌŽĐĞƐƐŝŶŐĨĞĞ͘KƵƌĐƵƌƌĞŶƚƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJŝƐ ĂƚƚĂĐŚĞĚƚŽƚŚŝƐdžŚŝďŝƚĂƚ^ĐŚĞĚƵůĞϭ͘ŽƉŝĞƐŽĨƌĞĐĞŝƉƚƐǁŝůůďĞƉƌŽǀŝĚĞĚƵƉŽŶƌĞƋƵĞƐƚ͖ǁĞ ƌĞƐĞƌǀĞƚŚĞƌŝŐŚƚƚŽĐŚĂƌŐĞLJŽƵĂŶĂĚŵŝŶŝƐƚƌĂƚŝǀĞĨĞĞĚĞƉĞŶĚŝŶŐŽŶƚŚĞĞdžƚĞŶƚŽĨLJŽƵƌƌĞƋƵĞƐƚƐ͘ ZĞĐĞŝƉƚƐĨŽƌŵŝƐĐĞůůĂŶĞŽƵƐŝƚĞŵƐůĞƐƐƚŚĂŶƚǁĞŶƚLJͲĨŝǀĞĚŽůůĂƌƐĂŶĚŵŝůĞĂŐĞůŽŐƐĂƌĞŶŽƚĂǀĂŝůĂďůĞ͘ ϱ͘ƌĞĚŝƚĨŽƌWƌĞƉĂŝĚDĂŝŶƚĞŶĂŶĐĞĂŶĚ^ƵƉƉŽƌƚ&ĞĞƐĨŽƌdLJůĞƌ^ŽĨƚǁĂƌĞ͘ůŝĞŶƚǁŝůůƌĞĐĞŝǀĞĂĐƌĞĚŝƚĨŽƌ ƚŚĞŵĂŝŶƚĞŶĂŶĐĞĂŶĚƐƵƉƉŽƌƚĨĞĞƐƉƌĞƉĂŝĚĨŽƌƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĨŽƌƚŚĞƚŝŵĞƉĞƌŝŽĚĐŽŵŵĞŶĐŝŶŐ ŽŶƚŚĞĨŝƌƐƚĚĂLJŽĨƚŚĞ^ĂĂ^dĞƌŵ͘ϲ WĂLJŵĞŶƚ͘WĂLJŵĞŶƚĨŽƌƵŶĚŝƐƉƵƚĞĚŝŶǀŽŝĐĞƐŝƐĚƵĞǁŝƚŚŝŶĨŽƌƚLJͲĨŝǀĞ;ϰϱͿĚĂLJƐŽĨƚŚĞŝŶǀŽŝĐĞĚĂƚĞ͘tĞƉƌĞĨĞƌ ƚŽƌĞĐĞŝǀĞƉĂLJŵĞŶƚƐĞůĞĐƚƌŽŶŝĐĂůůLJ͘KƵƌĞůĞĐƚƌŽŶŝĐƉĂLJŵĞŶƚŝŶĨŽƌŵĂƚŝŽŶŝƐĂǀĂŝůĂďůĞďLJĐŽŶƚĂĐƚŝŶŐ ZΛƚLJůĞƌƚĞĐŚ͘ĐŽŵ͘ ϲh^&KZ&>/WKEdZd^t,Zd,^^dZD'/E^&KZd,EK&d,EEh> D/EdEEdZD͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϲ džŚŝďŝƚ ^ĐŚĞĚƵůĞϭ ƵƐŝŶĞƐƐdƌĂǀĞůWŽůŝĐLJ ϲ͘ŝƌdƌĂǀĞů ͘ZĞƐĞƌǀĂƚŝŽŶƐΘdŝĐŬĞƚƐ dŚĞdƌĂǀĞůDĂŶĂŐĞŵĞŶƚŽŵƉĂŶLJ;dDͿƵƐĞĚďLJdLJůĞƌǁŝůůƉƌŽǀŝĚĞĂŶĞŵƉůŽLJĞĞǁŝƚŚĂĚŝƌĞĐƚĨůŝŐŚƚ ǁŝƚŚŝŶƚǁŽŚŽƵƌƐďĞĨŽƌĞŽƌĂĨƚĞƌƚŚĞƌĞƋƵĞƐƚĞĚĚĞƉĂƌƚƵƌĞƚŝŵĞ͕ĂƐƐƵŵŝŶŐƚŚĂƚĨůŝŐŚƚĚŽĞƐŶŽƚĂĚĚŵŽƌĞ ƚŚĂŶƚŚƌĞĞŚŽƵƌƐƚŽƚŚĞĞŵƉůŽLJĞĞ͛ƐƚŽƚĂůƚƌŝƉĚƵƌĂƚŝŽŶĂŶĚƚŚĞĨĂƌĞŝƐǁŝƚŚŝŶΨϭϬϬ;ĞĂĐŚǁĂLJͿŽĨƚŚĞ ůŽǁĞƐƚůŽŐŝĐĂůĨĂƌĞ͘/ĨĂŶĞƚƐĂǀŝŶŐƐŽĨΨϮϬϬŽƌŵŽƌĞ;ĞĂĐŚǁĂLJͿŝƐƉŽƐƐŝďůĞƚŚƌŽƵŐŚĂĐŽŶŶĞĐƚŝŶŐĨůŝŐŚƚ ƚŚĂƚŝƐǁŝƚŚŝŶƚǁŽŚŽƵƌƐďĞĨŽƌĞŽƌĂĨƚĞƌƚŚĞƌĞƋƵĞƐƚĞĚĚĞƉĂƌƚƵƌĞƚŝŵĞĂŶĚƚŚĂƚĚŽĞƐŶŽƚĂĚĚŵŽƌĞƚŚĂŶ ƚŚƌĞĞŚŽƵƌƐƚŽƚŚĞĞŵƉůŽLJĞĞ͛ƐƚŽƚĂůƚƌŝƉĚƵƌĂƚŝŽŶ͕ƚŚĞĐŽŶŶĞĐƚŝŶŐĨůŝŐŚƚƐŚŽƵůĚďĞĂĐĐĞƉƚĞĚ͘ ŵƉůŽLJĞĞƐĂƌĞĞŶĐŽƵƌĂŐĞĚƚŽŵĂŬĞĂĚǀĂŶĐĞĚƌĞƐĞƌǀĂƚŝŽŶƐƚŽƚĂŬĞĨƵůůĂĚǀĂŶƚĂŐĞŽĨĚŝƐĐŽƵŶƚ ŽƉƉŽƌƚƵŶŝƚŝĞƐ͘ŵƉůŽLJĞĞƐƐŚŽƵůĚƵƐĞĂůůƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽŵĂŬĞƚƌĂǀĞůĂƌƌĂŶŐĞŵĞŶƚƐĂƚůĞĂƐƚƚǁŽ;ϮͿ ǁĞĞŬƐŝŶĂĚǀĂŶĐĞŽĨĐŽŵŵŝƚŵĞŶƚƐ͘ƐĞǀĞŶ;ϳͿĚĂLJĂĚǀĂŶĐĞŬŝŶŐƌĞƋƵŝƌĞŵĞŶƚŝƐŵĂŶĚĂƚŽƌLJ͘tŚĞŶ ŬŝŶŐůĞƐƐƚŚĂŶƐĞǀĞŶ;ϳͿĚĂLJƐŝŶĂĚǀĂŶĐĞ͕ŵĂŶĂŐĞŵĞŶƚĂƉƉƌŽǀĂůǁŝůůďĞƌĞƋƵŝƌĞĚ͘ džĐĞƉƚŝŶƚŚĞĐĂƐĞŽĨŝŶƚĞƌŶĂƚŝŽŶĂůƚƌĂǀĞůǁŚĞƌĞĂƐĞŐŵĞŶƚŽĨĐŽŶƚŝŶƵŽƵƐĂŝƌƚƌĂǀĞůŝƐƐŝdž;ϲͿŽƌŵŽƌĞ ĐŽŶƐĞĐƵƚŝǀĞŚŽƵƌƐŝŶůĞŶŐƚŚ͕ŽŶůLJĞĐŽŶŽŵLJŽƌĐŽĂĐŚĐůĂƐƐƐĞĂƚŝŶŐŝƐƌĞŝŵďƵƌƐĂďůĞ͘ŵƉůŽLJĞĞƐƐŚĂůůŶŽƚ ďĞƌĞŝŵďƵƌƐĞĚĨŽƌ͞ĂƐŝĐĐŽŶŽŵLJ&ĂƌĞƐ͟ďĞĐĂƵƐĞƚŚĞƐĞĨĂƌĞƐĂƌĞŶŽŶͲƌĞĨƵŶĚĂďůĞĂŶĚŚĂǀĞŵĂŶLJ ƌĞƐƚƌŝĐƚŝŽŶƐƚŚĂƚŽƵƚǁĞŝŐŚƚŚĞĐŽƐƚͲƐĂǀŝŶŐƐ͘ ͘ĂŐŐĂŐĞ&ĞĞƐ ZĞŝŵďƵƌƐĞŵĞŶƚŽĨƉĞƌƐŽŶĂůďĂŐŐĂŐĞĐŚĂƌŐĞƐĂƌĞďĂƐĞĚŽŶƚƌŝƉĚƵƌĂƚŝŽŶĂƐĨŽůůŽǁƐ͗ hƉƚŽĨŝǀĞ;ϱͿĚĂLJƐсŽŶĞ;ϭͿĐŚĞĐŬĞĚďĂŐ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϳ ^ŝdž;ϲͿŽƌŵŽƌĞĚĂLJƐсƚǁŽ;ϮͿĐŚĞĐŬĞĚďĂŐƐ ĂŐŐĂŐĞĨĞĞƐĨŽƌƐƉŽƌƚƐĞƋƵŝƉŵĞŶƚĂƌĞŶŽƚƌĞŝŵďƵƌƐĂďůĞ͘ ϳ͘'ƌŽƵŶĚdƌĂŶƐƉŽƌƚĂƚŝŽŶ ͘WƌŝǀĂƚĞƵƚŽŵŽďŝůĞ DŝůĞĂŐĞůůŽǁĂŶĐĞʹƵƐŝŶĞƐƐƵƐĞŽĨĂŶĞŵƉůŽLJĞĞ͛ƐƉƌŝǀĂƚĞĂƵƚŽŵŽďŝůĞǁŝůůďĞƌĞŝŵďƵƌƐĞĚĂƚƚŚĞ ĐƵƌƌĞŶƚ/Z^ĂůůŽǁĂďůĞƌĂƚĞ͕ƉůƵƐŽƵƚŽĨƉŽĐŬĞƚĐŽƐƚƐĨŽƌƚŽůůƐĂŶĚƉĂƌŬŝŶŐ͘DŝůĞĂŐĞǁŝůůďĞĐĂůĐƵůĂƚĞĚďLJ ƵƐŝŶŐƚŚĞĞŵƉůŽLJĞĞΖƐŽĨĨŝĐĞĂƐƚŚĞƐƚĂƌƚŝŶŐĂŶĚĞŶĚŝŶŐƉŽŝŶƚ͕ŝŶĐŽŵƉůŝĂŶĐĞǁŝƚŚ/Z^ƌĞŐƵůĂƚŝŽŶƐ͘ ŵƉůŽLJĞĞƐǁŚŽŚĂǀĞďĞĞŶĚĞƐŝŐŶĂƚĞĚĂŚŽŵĞŽĨĨŝĐĞƐŚŽƵůĚĐĂůĐƵůĂƚĞŵŝůĞƐĨƌŽŵƚŚĞŝƌŚŽŵĞ͘ ͘ZĞŶƚĂůĂƌ ŵƉůŽLJĞĞƐĂƌĞĂƵƚŚŽƌŝnjĞĚƚŽƌĞŶƚĐĂƌƐŽŶůLJŝŶĐŽŶũƵŶĐƚŝŽŶǁŝƚŚĂŝƌƚƌĂǀĞůǁŚĞŶĐŽƐƚ͕ĐŽŶǀĞŶŝĞŶĐĞ͕ĂŶĚ ƚŚĞƐƉĞĐŝĨŝĐƐŝƚƵĂƚŝŽŶƌĞĂƐŽŶĂďůLJƌĞƋƵŝƌĞƚŚĞŝƌƵƐĞ͘tŚĞŶƌĞŶƚŝŶŐĂĐĂƌĨŽƌdLJůĞƌďƵƐŝŶĞƐƐ͕ĞŵƉůŽLJĞĞƐ ƐŚŽƵůĚƐĞůĞĐƚĂ͞ŵŝĚͲƐŝnjĞ͟Žƌ͞ŝŶƚĞƌŵĞĚŝĂƚĞ͟ĐĂƌ͘͞&Ƶůů͟ƐŝnjĞĐĂƌƐŵĂLJďĞƌĞŶƚĞĚǁŚĞŶƚŚƌĞĞŽƌŵŽƌĞ ĞŵƉůŽLJĞĞƐĂƌĞƚƌĂǀĞůŝŶŐƚŽŐĞƚŚĞƌ͘dLJůĞƌĐĂƌƌŝĞƐůĞĂƐĞĚǀĞŚŝĐůĞĐŽǀĞƌĂŐĞĨŽƌďƵƐŝŶĞƐƐĐĂƌƌĞŶƚĂůƐ͖ĞdžĐĞƉƚ ĨŽƌĞŵƉůŽLJĞĞƐƚƌĂǀĞůŝŶŐƚŽůĂƐŬĂĂŶĚŝŶƚĞƌŶĂƚŝŽŶĂůůLJ;ĞdžĐůƵĚŝŶŐĂŶĂĚĂͿ͕ĂĚĚŝƚŝŽŶĂůŝŶƐƵƌĂŶĐĞŽŶƚŚĞ ƌĞŶƚĂůĂŐƌĞĞŵĞŶƚƐŚŽƵůĚďĞĚĞĐůŝŶĞĚ͘ ͘WƵďůŝĐdƌĂŶƐƉŽƌƚĂƚŝŽŶ dĂdžŝŽƌĂŝƌƉŽƌƚůŝŵŽƵƐŝŶĞƐĞƌǀŝĐĞƐŵĂLJďĞĐŽŶƐŝĚĞƌĞĚǁŚĞŶƚƌĂǀĞůŝŶŐŝŶĂŶĚĂƌŽƵŶĚĐŝƚŝĞƐŽƌƚŽĂŶĚĨƌŽŵ ĂŝƌƉŽƌƚƐǁŚĞŶůĞƐƐĞdžƉĞŶƐŝǀĞŵĞĂŶƐŽĨƚƌĂŶƐƉŽƌƚĂƚŝŽŶĂƌĞƵŶĂǀĂŝůĂďůĞŽƌŝŵƉƌĂĐƚŝĐĂů͘dŚĞĂĐƚƵĂůĨĂƌĞ ƉůƵƐĂƌĞĂƐŽŶĂďůĞƚŝƉ;ϭϱͲϭϴйͿĂƌĞƌĞŝŵďƵƌƐĂďůĞ͘/ŶƚŚĞĐĂƐĞŽĨĂĨƌĞĞŚŽƚĞůƐŚƵƚƚůĞƚŽƚŚĞĂŝƌƉŽƌƚ͕ƚŝƉƐ ĂƌĞŝŶĐůƵĚĞĚŝŶƚŚĞƉĞƌĚŝĞŵƌĂƚĞƐĂŶĚǁŝůůŶŽƚďĞƌĞŝŵďƵƌƐĞĚƐĞƉĂƌĂƚĞůLJ͘ ͘WĂƌŬŝŶŐΘdŽůůƐ tŚĞŶƉĂƌŬŝŶŐĂƚƚŚĞĂŝƌƉŽƌƚ͕ĞŵƉůŽLJĞĞƐŵƵƐƚƵƐĞůŽŶŐĞƌƚĞƌŵƉĂƌŬŝŶŐĂƌĞĂƐƚŚĂƚĂƌĞŵĞĂƐƵƌĞĚŝŶĚĂLJƐ ĂƐŽƉƉŽƐĞĚƚŽŚŽƵƌƐ͘WĂƌŬĂŶĚĨůLJŽƉƚŝŽŶƐůŽĐĂƚĞĚŶĞĂƌƐŽŵĞĂŝƌƉŽƌƚƐŵĂLJĂůƐŽďĞƵƐĞĚ͘&ŽƌĞdžƚĞŶĚĞĚ ƚƌŝƉƐƚŚĂƚǁŽƵůĚƌĞƐƵůƚŝŶĞdžĐĞƐƐŝǀĞƉĂƌŬŝŶŐĐŚĂƌŐĞƐ͕ƉƵďůŝĐƚƌĂŶƐƉŽƌƚĂƚŝŽŶƚŽͬĨƌŽŵƚŚĞĂŝƌƉŽƌƚƐŚŽƵůĚďĞ ĐŽŶƐŝĚĞƌĞĚ͘dŽůůƐǁŝůůďĞƌĞŝŵďƵƌƐĞĚǁŚĞŶƌĞĐĞŝƉƚƐĂƌĞƉƌĞƐĞŶƚĞĚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϴ ϴ͘>ŽĚŐŝŶŐ dLJůĞƌ͛ƐdDǁŝůůƐĞůĞĐƚŚŽƚĞůĐŚĂŝŶƐƚŚĂƚĂƌĞǁĞůůĞƐƚĂďůŝƐŚĞĚ͕ƌĞĂƐŽŶĂďůĞŝŶƉƌŝĐĞ͕ĂŶĚĐŽŶǀĞŶŝĞŶƚůLJ ůŽĐĂƚĞĚŝŶƌĞůĂƚŝŽŶƚŽƚŚĞƚƌĂǀĞůĞƌΖƐǁŽƌŬĂƐƐŝŐŶŵĞŶƚ͘dLJƉŝĐĂůŚŽƚĞůĐŚĂŝŶƐŝŶĐůƵĚĞŽƵƌƚLJĂƌĚ͕&ĂŝƌĨŝĞůĚ /ŶŶ͕,ĂŵƉƚŽŶ/ŶŶ͕ĂŶĚ,ŽůŝĚĂLJ/ŶŶdžƉƌĞƐƐ͘/ĨƚŚĞĞŵƉůŽLJĞĞŚĂƐĂĚŝƐĐŽƵŶƚƌĂƚĞǁŝƚŚĂůŽĐĂůŚŽƚĞů͕ƚŚĞ ŚŽƚĞůƌĞƐĞƌǀĂƚŝŽŶƐŚŽƵůĚŶŽƚĞƚŚĂƚĚŝƐĐŽƵŶƚĂŶĚƚŚĞĞŵƉůŽLJĞĞƐŚŽƵůĚĐŽŶĨŝƌŵƚŚĞůŽǁĞƌƌĂƚĞǁŝƚŚƚŚĞ ŚŽƚĞůƵƉŽŶĂƌƌŝǀĂů͘ŵƉůŽLJĞĞŵĞŵďĞƌƐŚŝƉƐŝŶƚƌĂǀĞůĐůƵďƐƐƵĐŚĂƐƐŚŽƵůĚďĞŶŽƚĞĚŝŶƚŚĞŝƌƚƌĂǀĞů ƉƌŽĨŝůĞƐƐŽƚŚĂƚƚŚĞĞŵƉůŽLJĞĞĐĂŶƚĂŬĞĂĚǀĂŶƚĂŐĞŽĨĂŶLJůŽǁĞƌĐůƵďƌĂƚĞƐ͘ ͞EŽƐŚŽǁƐ͟ŽƌĐĂŶĐĞůůĂƚŝŽŶĨĞĞƐĂƌĞŶŽƚƌĞŝŵďƵƌƐĂďůĞŝĨƚŚĞĞŵƉůŽLJĞĞĚŽĞƐŶŽƚĐŽŵƉůLJǁŝƚŚƚŚĞŚŽƚĞů͛Ɛ ĐĂŶĐĞůůĂƚŝŽŶƉŽůŝĐLJ͘ dŝƉƐĨŽƌŵĂŝĚƐĂŶĚŽƚŚĞƌŚŽƚĞůƐƚĂĨĨĂƌĞŝŶĐůƵĚĞĚŝŶƚŚĞƉĞƌĚŝĞŵƌĂƚĞĂŶĚĂƌĞŶŽƚƌĞŝŵďƵƌƐĞĚƐĞƉĂƌĂƚĞůLJ͘ ŵƉůŽLJĞĞƐĂƌĞŶŽƚĂƵƚŚŽƌŝnjĞĚƚŽƌĞƐĞƌǀĞŶŽŶͲƚƌĂĚŝƚŝŽŶĂůƐŚŽƌƚͲƚĞƌŵůŽĚŐŝŶŐ͕ƐƵĐŚĂƐŝƌďŶď͕sZK͕ĂŶĚ ,ŽŵĞǁĂLJ͘ŵƉůŽLJĞĞƐǁŚŽĞůĞĐƚƚŽŵĂŬĞƐƵĐŚƌĞƐĞƌǀĂƚŝŽŶƐƐŚĂůůŶŽƚďĞƌĞŝŵďƵƌƐĞĚ͘ ϵ͘DĞĂůƐĂŶĚ/ŶĐŝĚĞŶƚĂůdžƉĞŶƐĞƐ ŵƉůŽLJĞĞŵĞĂůƐĂŶĚŝŶĐŝĚĞŶƚĂůĞdžƉĞŶƐĞƐǁŚŝůĞŽŶƚƌĂǀĞůƐƚĂƚƵƐǁŝƚŚŝŶƚŚĞĐŽŶƚŝŶĞŶƚĂůh͘^͘ĂƌĞŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞĨĞĚĞƌĂůƉĞƌĚŝĞŵƌĂƚĞƐƉƵďůŝƐŚĞĚďLJƚŚĞ'ĞŶĞƌĂů^ĞƌǀŝĐĞƐĚŵŝŶŝƐƚƌĂƚŝŽŶ͘/ŶĐŝĚĞŶƚĂů ĞdžƉĞŶƐĞƐŝŶĐůƵĚĞƚŝƉƐƚŽŵĂŝĚƐ͕ŚŽƚĞůƐƚĂĨĨ͕ĂŶĚƐŚƵƚƚůĞĚƌŝǀĞƌƐĂŶĚŽƚŚĞƌŵŝŶŽƌƚƌĂǀĞůĞdžƉĞŶƐĞƐ͘WĞƌ ĚŝĞŵƌĂƚĞƐĂƌĞĂǀĂŝůĂďůĞĂƚǁǁǁ͘ŐƐĂ͘ŐŽǀͬƉĞƌĚŝĞŵ͘ WĞƌĚŝĞŵĨŽƌůĂƐŬĂ͕,ĂǁĂŝŝ͕h͘^͘ƉƌŽƚĞĐƚŽƌĂƚĞƐĂŶĚŝŶƚĞƌŶĂƚŝŽŶĂůĚĞƐƚŝŶĂƚŝŽŶƐĂƌĞƉƌŽǀŝĚĞĚƐĞƉĂƌĂƚĞůLJďLJ ƚŚĞĞƉĂƌƚŵĞŶƚŽĨ^ƚĂƚĞĂŶĚǁŝůůďĞĚĞƚĞƌŵŝŶĞĚĂƐƌĞƋƵŝƌĞĚ͘ ͘KǀĞƌŶŝŐŚƚdƌĂǀĞů &ŽƌĞĂĐŚĨƵůůĚĂLJŽĨƚƌĂǀĞů͕ĂůůƚŚƌĞĞŵĞĂůƐĂƌĞƌĞŝŵďƵƌƐĂďůĞ͘WĞƌĚŝĞŵƐŽŶƚŚĞĨŝƌƐƚĂŶĚůĂƐƚĚĂLJŽĨĂƚƌŝƉ ĂƌĞŐŽǀĞƌŶĞĚĂƐƐĞƚĨŽƌƚŚďĞůŽǁ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϴϵ ĞƉĂƌƚƵƌĞĂLJ ĞƉĂƌƚďĞĨŽƌĞϭϮ͗ϬϬŶŽŽŶ >ƵŶĐŚĂŶĚĚŝŶŶĞƌ ĞƉĂƌƚĂĨƚĞƌϭϮ͗ϬϬŶŽŽŶ ZĞƚƵƌŶĂLJ ŝŶŶĞƌ ZĞƚƵƌŶďĞĨŽƌĞϭϮ͗ϬϬŶŽŽŶ ƌĞĂŬĨĂƐƚ ZĞƚƵƌŶďĞƚǁĞĞŶϭϮ͗ϬϬŶŽŽŶΘϳ͗ϬϬƉ͘ŵ͘ ƌĞĂŬĨĂƐƚĂŶĚůƵŶĐŚ ZĞƚƵƌŶĂĨƚĞƌϳ͗ϬϬƉ͘ŵ͘Ύ ƌĞĂŬĨĂƐƚ͕ůƵŶĐŚĂŶĚĚŝŶŶĞƌ Ύϳ͗ϬϬƉ͘ŵ͘ŝƐĚĞĨŝŶĞĚĂƐĚŝƌĞĐƚƚƌĂǀĞůƚŝŵĞĂŶĚĚŽĞƐŶŽƚŝŶĐůƵĚĞƚŝŵĞƚĂŬĞŶƚŽƐƚŽƉĨŽƌĚŝŶŶĞƌ͘ dŚĞƌĞŝŵďƵƌƐĞŵĞŶƚƌĂƚĞƐĨŽƌŝŶĚŝǀŝĚƵĂůŵĞĂůƐĂƌĞĐĂůĐƵůĂƚĞĚĂƐĂƉĞƌĐĞŶƚĂŐĞŽĨƚŚĞĨƵůůĚĂLJƉĞƌĚŝĞŵĂƐ ĨŽůůŽǁƐ͗ ƌĞĂŬĨĂƐƚ ϭϱй >ƵŶĐŚ Ϯϱй ŝŶŶĞƌ ϲϬй ͘^ĂŵĞĂLJdƌĂǀĞů ŵƉůŽLJĞĞƐƚƌĂǀĞůŝŶŐĂƚůĞĂƐƚϭϬϬŵŝůĞƐƚŽĂƐŝƚĞĂŶĚƌĞƚƵƌŶŝŶŐŝŶƚŚĞƐĂŵĞĚĂLJĂƌĞĞůŝŐŝďůĞƚŽĐůĂŝŵůƵŶĐŚ ŽŶĂŶĞdžƉĞŶƐĞƌĞƉŽƌƚ͘ŵƉůŽLJĞĞƐŽŶƐĂŵĞĚĂLJƚƌĂǀĞůƐƚĂƚƵƐĂƌĞĞůŝŐŝďůĞƚŽĐůĂŝŵĚŝŶŶĞƌŝŶƚŚĞĞǀĞŶƚ ƚŚĞLJƌĞƚƵƌŶŚŽŵĞĂĨƚĞƌϳ͗ϬϬƉ͘ŵ͘Ύ Ύϳ͗ϬϬƉ͘ŵ͘ŝƐĚĞĨŝŶĞĚĂƐĚŝƌĞĐƚƚƌĂǀĞůƚŝŵĞĂŶĚĚŽĞƐŶŽƚŝŶĐůƵĚĞƚŝŵĞƚĂŬĞŶƚŽƐƚŽƉĨŽƌĚŝŶŶĞƌ͘ ϭϬ͘/ŶƚĞƌŶĞƚĐĐĞƐƐʹ,ŽƚĞůƐĂŶĚŝƌƉŽƌƚƐ ŵƉůŽLJĞĞƐǁŚŽƚƌĂǀĞůŵĂLJŶĞĞĚƚŽĂĐĐĞƐƐƚŚĞŝƌĞͲŵĂŝůĂƚŶŝŐŚƚ͘DĂŶLJŚŽƚĞůƐƉƌŽǀŝĚĞĨƌĞĞŚŝŐŚƐƉĞĞĚ ŝŶƚĞƌŶĞƚĂĐĐĞƐƐĂŶĚdLJůĞƌĞŵƉůŽLJĞĞƐĂƌĞĞŶĐŽƵƌĂŐĞĚƚŽƵƐĞƐƵĐŚŚŽƚĞůƐǁŚĞŶĞǀĞƌƉŽƐƐŝďůĞ͘/ĨĂŶ ĞŵƉůŽLJĞĞ͛ƐŚŽƚĞůĐŚĂƌŐĞƐĨŽƌŝŶƚĞƌŶĞƚĂĐĐĞƐƐŝƚŝƐƌĞŝŵďƵƌƐĂďůĞƵƉƚŽΨϭϬ͘ϬϬƉĞƌĚĂLJ͘ŚĂƌŐĞƐĨŽƌ ŝŶƚĞƌŶĞƚĂĐĐĞƐƐĂƚĂŝƌƉŽƌƚƐĂƌĞŶŽƚƌĞŝŵďƵƌƐĂďůĞ͘ ϲ͘ /ŶƚĞƌŶĂƚŝŽŶĂůdƌĂǀĞů ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϬ ůůŝŶƚĞƌŶĂƚŝŽŶĂůĨůŝŐŚƚƐǁŝƚŚƚŚĞĞdžĐĞƉƚŝŽŶŽĨĨůŝŐŚƚƐďĞƚǁĞĞŶƚŚĞh͘^͘ĂŶĚĂŶĂĚĂƐŚŽƵůĚďĞƌĞƐĞƌǀĞĚ ƚŚƌŽƵŐŚdDƵƐŝŶŐƚŚĞ͞ůŽǁĞƐƚƉƌĂĐƚŝĐĂůĐŽĂĐŚĨĂƌĞ͟ǁŝƚŚƚŚĞĞdžĐĞƉƚŝŽŶŽĨĨůŝŐŚƚƐƚŚĂƚĂƌĞƐŝdž;ϲͿŽƌŵŽƌĞ ĐŽŶƐĞĐƵƚŝǀĞŚŽƵƌƐŝŶůĞŶŐƚŚ͘/ŶƐƵĐŚĞǀĞŶƚ͕ƚŚĞŶĞdžƚĂǀĂŝůĂďůĞƐĞĂƚŝŶŐĐůĂƐƐĂďŽǀĞĐŽĂĐŚƐŚĂůůďĞ ƌĞŝŵďƵƌƐĞĚ͘ tŚĞŶƌĞƋƵŝƌĞĚƚŽƚƌĂǀĞůŝŶƚĞƌŶĂƚŝŽŶĂůůLJĨŽƌďƵƐŝŶĞƐƐ͕ĞŵƉůŽLJĞĞƐƐŚĂůůďĞƌĞŝŵďƵƌƐĞĚĨŽƌƉŚŽƚŽĨĞĞƐ͕ ĂƉƉůŝĐĂƚŝŽŶĨĞĞƐ͕ĂŶĚĞdžĞĐƵƚŝŽŶĨĞĞƐǁŚĞŶŽďƚĂŝŶŝŶŐĂŶĞǁƉĂƐƐƉŽƌƚŬ͕ďƵƚĨĞĞƐƌĞůĂƚĞĚƚŽƉĂƐƐƉŽƌƚ ƌĞŶĞǁĂůƐĂƌĞŶŽƚƌĞŝŵďƵƌƐĂďůĞ͘sŝƐĂĂƉƉůŝĐĂƚŝŽŶĂŶĚůĞŐĂůĨĞĞƐ͕ĞŶƚƌLJƚĂdžĞƐĂŶĚĚĞƉĂƌƚƵƌĞƚĂdžĞƐĂƌĞ ƌĞŝŵďƵƌƐĂďůĞ͘ dŚĞĐŽƐƚŽĨǀĂĐĐŝŶĂƚŝŽŶƐƚŚĂƚĂƌĞĞŝƚŚĞƌƌĞƋƵŝƌĞĚĨŽƌƚƌĂǀĞůƚŽƐƉĞĐŝĨŝĐĐŽƵŶƚƌŝĞƐŽƌƐƵŐŐĞƐƚĞĚďLJƚŚĞh͘^͘ ĞƉĂƌƚŵĞŶƚŽĨ,ĞĂůƚŚΘ,ƵŵĂŶ^ĞƌǀŝĐĞƐĨŽƌƚƌĂǀĞůƚŽƐƉĞĐŝĨŝĐĐŽƵŶƚƌŝĞƐ͕ŝƐƌĞŝŵďƵƌƐĂďůĞ͘ ^ĞĐƚŝŽŶϰ͕DĞĂůƐΘ/ŶĐŝĚĞŶƚĂůdžƉĞŶƐĞƐ͕ĂŶĚ^ĞĐƚŝŽŶϮ͘ď͕͘ZĞŶƚĂůĂƌ͕ƐŚĂůůĂƉƉůLJƚŽƚŚŝƐƐĞĐƚŝŽŶ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϭ džŚŝďŝƚ ^Zs/>s>'ZDEd /͘ ŐƌĞĞŵĞŶƚKǀĞƌǀŝĞǁ dŚŝƐ^>ŽƉĞƌĂƚĞƐŝŶĐŽŶũƵŶĐƚŝŽŶǁŝƚŚ͕ĂŶĚĚŽĞƐŶŽƚƐƵƉĞƌƐĞĚĞŽƌƌĞƉůĂĐĞĂŶLJƉĂƌƚŽĨ͕ƚŚĞŐƌĞĞŵĞŶƚ͘/ƚ ŽƵƚůŝŶĞƐƚŚĞŝŶĨŽƌŵĂƚŝŽŶƚĞĐŚŶŽůŽŐLJƐĞƌǀŝĐĞůĞǀĞůƐƚŚĂƚǁĞǁŝůůƉƌŽǀŝĚĞƚŽLJŽƵƚŽĞŶƐƵƌĞƚŚĞĂǀĂŝůĂďŝůŝƚLJŽĨƚŚĞ ĂƉƉůŝĐĂƚŝŽŶƐĞƌǀŝĐĞƐƚŚĂƚLJŽƵŚĂǀĞƌĞƋƵĞƐƚĞĚƵƐƚŽƉƌŽǀŝĚĞ͘ůůŽƚŚĞƌƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐĂƌĞĚŽĐƵŵĞŶƚĞĚŝŶƚŚĞ ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͘ //͘ ĞĨŝŶŝƚŝŽŶƐ͘džĐĞƉƚĂƐĚĞĨŝŶĞĚďĞůŽǁ͕ĂůůĚĞĨŝŶĞĚƚĞƌŵƐŚĂǀĞƚŚĞŵĞĂŶŝŶŐƐĞƚĨŽƌƚŚŝŶƚŚĞŐƌĞĞŵĞŶƚ͘ ƚƚĂŝŶŵĞŶƚ͗dŚĞ ƉĞƌĐĞŶƚĂŐĞ ŽĨ ƚŝŵĞ ƚŚĞ dLJůĞƌ ^ŽĨƚǁĂƌĞ ŝƐ ĂǀĂŝůĂďůĞ ĚƵƌŝŶŐ Ă ĐĂůĞŶĚĂƌ ƋƵĂƌƚĞƌ͕ ǁŝƚŚ ƉĞƌĐĞŶƚĂŐĞƐƌŽƵŶĚĞĚƚŽƚŚĞŶĞĂƌĞƐƚǁŚŽůĞŶƵŵďĞƌ͘ ůŝĞŶƚƌƌŽƌ/ŶĐŝĚĞŶƚ͗ŶLJƐĞƌǀŝĐĞƵŶĂǀĂŝůĂďŝůŝƚLJƌĞƐƵůƚŝŶŐĨƌŽŵLJŽƵƌĂƉƉůŝĐĂƚŝŽŶƐ͕ĐŽŶƚĞŶƚŽƌĞƋƵŝƉŵĞŶƚ͕ŽƌƚŚĞ ĂĐƚƐŽƌŽŵŝƐƐŝŽŶƐŽĨĂŶLJŽĨLJŽƵƌƐĞƌǀŝĐĞƵƐĞƌƐŽƌƚŚŝƌĚͲƉĂƌƚLJƉƌŽǀŝĚĞƌƐŽǀĞƌǁŚŽŵǁĞĞdžĞƌĐŝƐĞŶŽĐŽŶƚƌŽů͘ ŽǁŶƚŝŵĞ͗dŚŽƐĞŵŝŶƵƚĞƐĚƵƌŝŶŐǁŚŝĐŚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐŶŽƚĂǀĂŝůĂďůĞĨŽƌLJŽƵƌƵƐĞ͘ŽǁŶƚŝŵĞĚŽĞƐŶŽƚ ŝŶĐůƵĚĞƚŚŽƐĞŝŶƐƚĂŶĐĞƐŝŶǁŚŝĐŚŽŶůLJĂĞĨĞĐƚŝƐƉƌĞƐĞŶƚ͘ ^ĞƌǀŝĐĞǀĂŝůĂďŝůŝƚLJ͗dŚĞƚŽƚĂůŶƵŵďĞƌŽĨŵŝŶƵƚĞƐŝŶĂĐĂůĞŶĚĂƌƋƵĂƌƚĞƌƚŚĂƚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐĐĂƉĂďůĞŽĨ ƌĞĐĞŝǀŝŶŐ͕ƉƌŽĐĞƐƐŝŶŐ͕ĂŶĚƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐ͕ĞdžĐůƵĚŝŶŐŵĂŝŶƚĞŶĂŶĐĞǁŝŶĚŽǁƐ͕ůŝĞŶƚƌƌŽƌ/ŶĐŝĚĞŶƚƐĂŶĚ &ŽƌĐĞDĂũĞƵƌĞ͘ ///͘ ^ĞƌǀŝĐĞǀĂŝůĂďŝůŝƚLJ dŚĞ^ĞƌǀŝĐĞǀĂŝůĂďŝůŝƚLJŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞŝƐŝŶƚĞŶĚĞĚƚŽďĞϮϰͬϳͬϯϲϱ͘tĞƐĞƚ^ĞƌǀŝĐĞǀĂŝůĂďŝůŝƚLJŐŽĂůƐĂŶĚ ŵĞĂƐƵƌĞƐǁŚĞƚŚĞƌǁĞŚĂǀĞŵĞƚƚŚŽƐĞŐŽĂůƐďLJƚƌĂĐŬŝŶŐƚƚĂŝŶŵĞŶƚ͘ Ă͘ zŽƵƌZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ tŚĞŶĞǀĞƌLJŽƵĞdžƉĞƌŝĞŶĐĞŽǁŶƚŝŵĞ͕LJŽƵŵƵƐƚŵĂŬĞĂƐƵƉƉŽƌƚĐĂůůĂĐĐŽƌĚŝŶŐƚŽƚŚĞƉƌŽĐĞĚƵƌĞƐŽƵƚůŝŶĞĚŝŶ ƚŚĞ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ͘zŽƵǁŝůůƌĞĐĞŝǀĞĂƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŶƵŵďĞƌ͘ zŽƵŵƵƐƚĚŽĐƵŵĞŶƚ͕ŝŶǁƌŝƚŝŶŐ͕ĂůůŽǁŶƚŝŵĞƚŚĂƚLJŽƵŚĂǀĞĞdžƉĞƌŝĞŶĐĞĚĚƵƌŝŶŐĂĐĂůĞŶĚĂƌƋƵĂƌƚĞƌ͘zŽƵŵƵƐƚ ĚĞůŝǀĞƌƐƵĐŚĚŽĐƵŵĞŶƚĂƚŝŽŶƚŽƵƐǁŝƚŚŝŶϯϬĚĂLJƐŽĨĂƋƵĂƌƚĞƌ͛ƐĞŶĚ͘ dŚĞĚŽĐƵŵĞŶƚĂƚŝŽŶLJŽƵƉƌŽǀŝĚĞŵƵƐƚĞǀŝĚĞŶĐĞƚŚĞŽǁŶƚŝŵĞĐůĞĂƌůLJĂŶĚĐŽŶǀŝŶĐŝŶŐůLJ͘/ƚŵƵƐƚŝŶĐůƵĚĞ͕ĨŽƌ ĞdžĂŵƉůĞ͕ƚŚĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŶƵŵďĞƌ;ƐͿĂŶĚƚŚĞĚĂƚĞ͕ƚŝŵĞĂŶĚĚƵƌĂƚŝŽŶŽĨƚŚĞŽǁŶƚŝŵĞ;ƐͿ͘ ď͘ KƵƌZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϮ tŚĞŶŽƵƌƐƵƉƉŽƌƚƚĞĂŵƌĞĐĞŝǀĞƐĂĐĂůůĨƌŽŵLJŽƵƚŚĂƚŽǁŶƚŝŵĞŚĂƐŽĐĐƵƌƌĞĚŽƌŝƐŽĐĐƵƌƌŝŶŐ͕ǁĞǁŝůůǁŽƌŬ ǁŝƚŚLJŽƵƚŽŝĚĞŶƚŝĨLJƚŚĞĐĂƵƐĞŽĨƚŚĞŽǁŶƚŝŵĞ;ŝŶĐůƵĚŝŶŐǁŚĞƚŚĞƌŝƚŵĂLJďĞƚŚĞƌĞƐƵůƚŽĨĂůŝĞŶƚƌƌŽƌ /ŶĐŝĚĞŶƚŽƌ&ŽƌĐĞDĂũĞƵƌĞͿ͘tĞǁŝůůĂůƐŽǁŽƌŬǁŝƚŚLJŽƵƚŽƌĞƐƵŵĞŶŽƌŵĂůŽƉĞƌĂƚŝŽŶƐ͘ hƉŽŶƚŝŵĞůLJƌĞĐĞŝƉƚŽĨLJŽƵƌŽǁŶƚŝŵĞƌĞƉŽƌƚ͕ǁĞǁŝůůĐŽŵƉĂƌĞƚŚĂƚƌĞƉŽƌƚƚŽŽƵƌŽǁŶŽƵƚĂŐĞůŽŐƐĂŶĚƐƵƉƉŽƌƚ ƚŝĐŬĞƚƐƚŽĐŽŶĨŝƌŵƚŚĂƚŽǁŶƚŝŵĞĨŽƌǁŚŝĐŚǁĞǁĞƌĞƌĞƐƉŽŶƐŝďůĞŝŶĚĞĞĚŽĐĐƵƌƌĞĚ͘ tĞǁŝůůƌĞƐƉŽŶĚƚŽLJŽƵƌŽǁŶƚŝŵĞƌĞƉŽƌƚǁŝƚŚŝŶϯϬĚĂLJ;ƐͿŽĨƌĞĐĞŝƉƚ͘dŽƚŚĞĞdžƚĞŶƚǁĞŚĂǀĞĐŽŶĨŝƌŵĞĚ ŽǁŶƚŝŵĞĨŽƌǁŚŝĐŚǁĞĂƌĞƌĞƐƉŽŶƐŝďůĞ͕ǁĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚƚŚĞƌĞůŝĞĨƐĞƚĨŽƌƚŚďĞůŽǁ͘ Đ͘ ůŝĞŶƚZĞůŝĞĨ tŚĞŶĂ^ĞƌǀŝĐĞǀĂŝůĂďŝůŝƚLJŐŽĂůŝƐŶŽƚŵĞƚĚƵĞƚŽĐŽŶĨŝƌŵĞĚŽǁŶƚŝŵĞ͕ǁĞǁŝůůƉƌŽǀŝĚĞLJŽƵǁŝƚŚƌĞůŝĞĨƚŚĂƚ ĐŽƌƌĞƐƉŽŶĚƐƚŽƚŚĞƉĞƌĐĞŶƚĂŐĞĂŵŽƵŶƚďLJǁŚŝĐŚƚŚĂƚŐŽĂůǁĂƐŶŽƚĂĐŚŝĞǀĞĚ͕ĂƐƐĞƚĨŽƌƚŚŝŶƚŚĞůŝĞŶƚZĞůŝĞĨ ^ĐŚĞĚƵůĞďĞůŽǁ͘ EŽƚǁŝƚŚƐƚĂŶĚŝŶŐƚŚĞĂďŽǀĞ͕ƚŚĞƚŽƚĂůĂŵŽƵŶƚŽĨĂůůƌĞůŝĞĨƚŚĂƚǁŽƵůĚďĞĚƵĞƵŶĚĞƌƚŚŝƐ^>ƉĞƌƋƵĂƌƚĞƌǁŝůů ŶŽƚĞdžĐĞĞĚϱйŽĨŽŶĞƋƵĂƌƚĞƌŽĨƚŚĞƚŚĞŶͲĐƵƌƌĞŶƚ^ĂĂ^&ĞĞ͘dŚĞƚŽƚĂůĐƌĞĚŝƚƐĐŽŶĨŝƌŵĞĚďLJƵƐŝŶŽŶĞŽƌŵŽƌĞ ƋƵĂƌƚĞƌƐŽĨĂďŝůůŝŶŐĐLJĐůĞǁŝůůďĞĂƉƉůŝĞĚƚŽƚŚĞ^ĂĂ^&ĞĞĨŽƌ ƚŚĞŶĞdžƚďŝůůŝŶŐĐLJĐůĞ͘/ƐƐƵŝŶŐŽĨƐƵĐŚĐƌĞĚŝƚĚŽĞƐ ŶŽƚƌĞůŝĞǀĞƵƐŽĨŽƵƌŽďůŝŐĂƚŝŽŶƐƵŶĚĞƌƚŚĞŐƌĞĞŵĞŶƚƚŽĐŽƌƌĞĐƚƚŚĞƉƌŽďůĞŵǁŚŝĐŚĐƌĞĂƚĞĚƚŚĞƐĞƌǀŝĐĞ ŝŶƚĞƌƌƵƉƚŝŽŶ͘ ǀĞƌLJƋƵĂƌƚĞƌ͕ǁĞǁŝůůĐŽŵƉĂƌĞĐŽŶĨŝƌŵĞĚŽǁŶƚŝŵĞƚŽ^ĞƌǀŝĐĞǀĂŝůĂďŝůŝƚLJ͘/ŶƚŚĞĞǀĞŶƚĂĐƚƵĂůƚƚĂŝŶŵĞŶƚ ĚŽĞƐŶŽƚŵĞĞƚƚŚĞƚĂƌŐĞƚĞĚƚƚĂŝŶŵĞŶƚ͕ƚŚĞĨŽůůŽǁŝŶŐůŝĞŶƚƌĞůŝĞĨǁŝůůĂƉƉůLJ͕ŽŶĂƋƵĂƌƚĞƌůLJďĂƐŝƐ͗ dĂƌŐĞƚĞĚƚƚĂŝŶŵĞŶƚĐƚƵĂůƚƚĂŝŶŵĞŶƚůŝĞŶƚZĞůŝĞĨ ϭϬϬй ϵϴͲϵϵй ZĞŵĞĚŝĂůĂĐƚŝŽŶǁŝůůďĞƚĂŬĞŶ͘ ϭϬϬй ϵϱͲϵϳй ϰйĐƌĞĚŝƚŽĨĨĞĞĨŽƌĂĨĨĞĐƚĞĚĐĂůĞŶĚĂƌƋƵĂƌƚĞƌ ǁŝůůďĞƉŽƐƚĞĚƚŽŶĞdžƚďŝůůŝŶŐĐLJĐůĞ ϭϬϬй фϵϱй ϱйĐƌĞĚŝƚŽĨĨĞĞĨŽƌĂĨĨĞĐƚĞĚĐĂůĞŶĚĂƌƋƵĂƌƚĞƌ ǁŝůůďĞƉŽƐƚĞĚƚŽŶĞdžƚďŝůůŝŶŐĐLJĐůĞ zŽƵŵĂLJƌĞƋƵĞƐƚĂƌĞƉŽƌƚĨƌŽŵƵƐƚŚĂƚĚŽĐƵŵĞŶƚƐƚŚĞƉƌĞĐĞĚŝŶŐƋƵĂƌƚĞƌ͛Ɛ^ĞƌǀŝĐĞǀĂŝůĂďŝůŝƚLJ͕ŽǁŶƚŝŵĞ͕ĂŶLJ ƌĞŵĞĚŝĂůĂĐƚŝŽŶƐƚŚĂƚŚĂǀĞďĞĞŶͬǁŝůůďĞƚĂŬĞŶ͕ĂŶĚĂŶLJĐƌĞĚŝƚƐƚŚĂƚŵĂLJďĞŝƐƐƵĞĚ͘ /s͘ ƉƉůŝĐĂďŝůŝƚLJ dŚĞĐŽŵŵŝƚŵĞŶƚƐƐĞƚĨŽƌƚŚŝŶƚŚŝƐ^>ĚŽŶŽƚĂƉƉůLJĚƵƌŝŶŐŵĂŝŶƚĞŶĂŶĐĞǁŝŶĚŽǁƐ͕ůŝĞŶƚƌƌŽƌ/ŶĐŝĚĞŶƚƐ͕ĂŶĚ &ŽƌĐĞDĂũĞƵƌĞ͘ tĞƉĞƌĨŽƌŵŵĂŝŶƚĞŶĂŶĐĞĚƵƌŝŶŐůŝŵŝƚĞĚǁŝŶĚŽǁƐƚŚĂƚĂƌĞŚŝƐƚŽƌŝĐĂůůLJŬŶŽǁŶƚŽďĞƌĞůŝĂďůLJůŽǁͲƚƌĂĨĨŝĐƚŝŵĞƐ͘ /ĨĂŶĚǁŚĞŶŵĂŝŶƚĞŶĂŶĐĞŝƐƉƌĞĚŝĐƚĞĚƚŽŽĐĐƵƌĚƵƌŝŶŐƉĞƌŝŽĚƐŽĨŚŝŐŚĞƌƚƌĂĨĨŝĐ͕ǁĞǁŝůůƉƌŽǀŝĚĞĂĚǀĂŶĐĞ ŶŽƚŝĐĞŽĨƚŚŽƐĞǁŝŶĚŽǁƐĂŶĚǁŝůůĐŽŽƌĚŝŶĂƚĞƚŽƚŚĞŐƌĞĂƚĞƐƚĞdžƚĞŶƚƉŽƐƐŝďůĞǁŝƚŚLJŽƵ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϯ s͘ &ŽƌĐĞDĂũĞƵƌĞ zŽƵǁŝůůŶŽƚŚŽůĚƵƐƌĞƐƉŽŶƐŝďůĞĨŽƌŶŽƚŵĞĞƚŝŶŐƐĞƌǀŝĐĞůĞǀĞůƐŽƵƚůŝŶĞĚŝŶƚŚŝƐ^>ƚŽƚŚĞĞdžƚĞŶƚĂŶLJĨĂŝůƵƌĞƚŽ ĚŽƐŽŝƐĐĂƵƐĞĚďLJ&ŽƌĐĞDĂũĞƵƌĞ͘/ŶƚŚĞĞǀĞŶƚŽĨ&ŽƌĐĞDĂũĞƵƌĞ͕ǁĞǁŝůůĨŝůĞǁŝƚŚLJŽƵĂƐŝŐŶĞĚƌĞƋƵĞƐƚƚŚĂƚ ƐĂŝĚĨĂŝůƵƌĞďĞĞdžĐƵƐĞĚ͘dŚĂƚǁƌŝƚŝŶŐǁŝůůĂƚůĞĂƐƚŝŶĐůƵĚĞƚŚĞĞƐƐĞŶƚŝĂůĚĞƚĂŝůƐĂŶĚĐŝƌĐƵŵƐƚĂŶĐĞƐƐƵƉƉŽƌƚŝŶŐ ŽƵƌƌĞƋƵĞƐƚĨŽƌƌĞůŝĞĨƉƵƌƐƵĂŶƚƚŽƚŚŝƐ^ĞĐƚŝŽŶ͘zŽƵǁŝůůŶŽƚƵŶƌĞĂƐŽŶĂďůLJǁŝƚŚŚŽůĚŝƚƐĂĐĐĞƉƚĂŶĐĞŽĨƐƵĐŚĂ ƌĞƋƵĞƐƚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϰ džŚŝďŝƚ ^ĐŚĞĚƵůĞϭ ^ƵƉƉŽƌƚĂůůWƌŽĐĞƐƐ ^ƵƉƉŽƌƚŚĂŶŶĞůƐ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ƉƌŽǀŝĚĞƐƚŚĞĨŽůůŽǁŝŶŐĐŚĂŶŶĞůƐŽĨƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚ͗ ;ϱͿdLJůĞƌŽŵŵƵŶŝƚLJʹĂŶŽŶͲůŝŶĞƌĞƐŽƵƌĐĞ͕dLJůĞƌŽŵŵƵŶŝƚLJƉƌŽǀŝĚĞƐĂǀĞŶƵĞĨŽƌĂůůdLJůĞƌĐůŝĞŶƚƐǁŝƚŚ ĐƵƌƌĞŶƚŵĂŝŶƚĞŶĂŶĐĞĂŐƌĞĞŵĞŶƚƐƚŽĐŽůůĂďŽƌĂƚĞǁŝƚŚŽŶĞĂŶŽƚŚĞƌ͕ƐŚĂƌĞďĞƐƚƉƌĂĐƚŝĐĞƐĂŶĚ ƌĞƐŽƵƌĐĞƐ͕ĂŶĚĂĐĐĞƐƐĚŽĐƵŵĞŶƚĂƚŝŽŶ͘ ;ϲͿKŶͲůŝŶĞƐƵďŵŝƐƐŝŽŶ;ƉŽƌƚĂůͿʹĨŽƌůĞƐƐƵƌŐĞŶƚĂŶĚĨƵŶĐƚŝŽŶĂůŝƚLJͲďĂƐĞĚƋƵĞƐƚŝŽŶƐ͕ƵƐĞƌƐŵĂLJĐƌĞĂƚĞ ƵŶůŝŵŝƚĞĚƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐƚŚƌŽƵŐŚƚŚĞĐƵƐƚŽŵĞƌƌĞůĂƚŝŽŶƐŚŝƉŵĂŶĂŐĞŵĞŶƚƉŽƌƚĂůĂǀĂŝůĂďůĞĂƚƚŚĞ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐǁĞďƐŝƚĞ͘ ;ϳͿŵĂŝůʹĨŽƌůĞƐƐƵƌŐĞŶƚƐŝƚƵĂƚŝŽŶƐ͕ƵƐĞƌƐŵĂLJƐƵďŵŝƚƵŶůŝŵŝƚĞĚĞŵĂŝůƐĚŝƌĞĐƚůLJƚŽƚŚĞƐŽĨƚǁĂƌĞ ƐƵƉƉŽƌƚŐƌŽƵƉ͘ ;ϴͿdĞůĞƉŚŽŶĞʹĨŽƌƵƌŐĞŶƚŽƌĐŽŵƉůĞdžƋƵĞƐƚŝŽŶƐ͕ƵƐĞƌƐƌĞĐĞŝǀĞƚŽůůͲĨƌĞĞ͕ƵŶůŝŵŝƚĞĚƚĞůĞƉŚŽŶĞƐŽĨƚǁĂƌĞ ƐƵƉƉŽƌƚ͘ ^ƵƉƉŽƌƚZĞƐŽƵƌĐĞƐ ŶƵŵďĞƌŽĨĂĚĚŝƚŝŽŶĂůƌĞƐŽƵƌĐĞƐĂƌĞĂǀĂŝůĂďůĞƚŽƉƌŽǀŝĚĞĂĐŽŵƉƌĞŚĞŶƐŝǀĞĂŶĚĐŽŵƉůĞƚĞƐƵƉƉŽƌƚ ĞdžƉĞƌŝĞŶĐĞ͗ ;ϱͿdLJůĞƌtĞďƐŝƚĞʹǁǁǁ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵʹĨŽƌĂĐĐĞƐƐŝŶŐĐůŝĞŶƚƚŽŽůƐĂŶĚŽƚŚĞƌŝŶĨŽƌŵĂƚŝŽŶŝŶĐůƵĚŝŶŐ ƐƵƉƉŽƌƚĐŽŶƚĂĐƚŝŶĨŽƌŵĂƚŝŽŶ͘ ;ϲͿdLJůĞƌŽŵŵƵŶŝƚLJʹĂǀĂŝůĂďůĞƚŚƌŽƵŐŚůŽŐŝŶ͕dLJůĞƌŽŵŵƵŶŝƚLJƉƌŽǀŝĚĞƐĂǀĞŶƵĞĨŽƌĐůŝĞŶƚƐƚŽƐƵƉƉŽƌƚ ŽŶĞĂŶŽƚŚĞƌĂŶĚƐŚĂƌĞďĞƐƚƉƌĂĐƚŝĐĞƐĂŶĚƌĞƐŽƵƌĐĞƐ͘ ;ϳͿ<ŶŽǁůĞĚŐĞďĂƐĞʹĨƵůůLJƐĞĂƌĐŚĂďůĞĚĞƉŽƐŝƚŽƌLJŽĨƚŚŽƵƐĂŶĚƐŽĨĚŽĐƵŵĞŶƚƐƌĞůĂƚĞĚƚŽƉƌŽĐĞĚƵƌĞƐ͕ ďĞƐƚƉƌĂĐƚŝĐĞƐ͕ƌĞůĞĂƐĞŝŶĨŽƌŵĂƚŝŽŶ͕ĂŶĚũŽďĂŝĚĞƐ͘ ;ϴͿWƌŽŐƌĂŵhƉĚĂƚĞƐʹǁŚĞƌĞĚĞǀĞůŽƉŵĞŶƚĂĐƚŝǀŝƚLJŝƐŵĂĚĞĂǀĂŝůĂďůĞĨŽƌĐůŝĞŶƚĐŽŶƐƵŵƉƚŝŽŶ ^ƵƉƉŽƌƚǀĂŝůĂďŝůŝƚLJ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƐƵƉƉŽƌƚŝƐĂǀĂŝůĂďůĞĚƵƌŝŶŐƚŚĞůŽĐĂůďƵƐŝŶĞƐƐŚŽƵƌƐŽĨϴDƚŽϱWD;DŽŶĚĂLJʹ&ƌŝĚĂLJͿ ĂĐƌŽƐƐĨŽƵƌh^ƚŝŵĞnjŽŶĞƐ;WĂĐŝĨŝĐ͕DŽƵŶƚĂŝŶ͕ĞŶƚƌĂůĂŶĚĂƐƚĞƌŶͿ͘ůŝĞŶƚƐŵĂLJƌĞĐĞŝǀĞĐŽǀĞƌĂŐĞĂĐƌŽƐƐ ƚŚĞƐĞƚŝŵĞnjŽŶĞƐ͘dLJůĞƌ͛ƐŚŽůŝĚĂLJƐĐŚĞĚƵůĞŝƐŽƵƚůŝŶĞĚďĞůŽǁ͘dŚĞƌĞǁŝůůďĞŶŽƐƵƉƉŽƌƚĐŽǀĞƌĂŐĞŽŶƚŚĞƐĞ ĚĂLJƐ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϱ EĞǁzĞĂƌ͛ƐĂLJ dŚĂŶŬƐŐŝǀŝŶŐĂLJ DĞŵŽƌŝĂůĂLJĂLJĂĨƚĞƌdŚĂŶŬƐŐŝǀŝŶŐ /ŶĚĞƉĞŶĚĞŶĐĞĂLJ ŚƌŝƐƚŵĂƐĂLJ >ĂďŽƌĂLJ /ƐƐƵĞ,ĂŶĚůŝŶŐ /ŶĐŝĚĞŶƚdƌĂĐŬŝŶŐ ǀĞƌLJƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŝƐůŽŐŐĞĚŝŶƚŽdLJůĞƌ͛ƐƵƐƚŽŵĞƌZĞůĂƚŝŽŶƐŚŝƉDĂŶĂŐĞŵĞŶƚ^LJƐƚĞŵĂŶĚŐŝǀĞŶĂƵŶŝƋƵĞ ŝŶĐŝĚĞŶƚŶƵŵďĞƌ͘dŚŝƐƐLJƐƚĞŵƚƌĂĐŬƐƚŚĞŚŝƐƚŽƌLJŽĨĞĂĐŚŝŶĐŝĚĞŶƚ͘dŚĞŝŶĐŝĚĞŶƚƚƌĂĐŬŝŶŐŶƵŵďĞƌŝƐƵƐĞĚƚŽ ƚƌĂĐŬĂŶĚƌĞĨĞƌĞŶĐĞŽƉĞŶŝƐƐƵĞƐǁŚĞŶĐůŝĞŶƚƐĐŽŶƚĂĐƚƐƵƉƉŽƌƚ͘ůŝĞŶƚƐŵĂLJƚƌĂĐŬŝŶĐŝĚĞŶƚƐ͕ƵƐŝŶŐƚŚĞŝŶĐŝĚĞŶƚ ŶƵŵďĞƌ͕ƚŚƌŽƵŐŚƚŚĞƉŽƌƚĂůĂƚdLJůĞƌ͛ƐǁĞďƐŝƚĞŽƌďLJĐĂůůŝŶŐƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚĚŝƌĞĐƚůLJ͘ /ŶĐŝĚĞŶƚWƌŝŽƌŝƚLJ ĂĐŚŝŶĐŝĚĞŶƚŝƐĂƐƐŝŐŶĞĚĂƉƌŝŽƌŝƚLJŶƵŵďĞƌ͕ǁŚŝĐŚĐŽƌƌĞƐƉŽŶĚƐƚŽƚŚĞĐůŝĞŶƚ͛ƐŶĞĞĚƐĂŶĚĚĞĂĚůŝŶĞƐ͘dŚĞ ĐůŝĞŶƚŝƐƌĞƐƉŽŶƐŝďůĞĨŽƌƌĞĂƐŽŶĂďůLJƐĞƚƚŝŶŐƚŚĞƉƌŝŽƌŝƚLJŽĨƚŚĞŝŶĐŝĚĞŶƚƉĞƌƚŚĞĐŚĂƌƚďĞůŽǁ͘dŚŝƐĐŚĂƌƚŝƐŶŽƚ ŝŶƚĞŶĚĞĚƚŽĂĚĚƌĞƐƐĞǀĞƌLJƚLJƉĞŽĨƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚ͕ĂŶĚĐĞƌƚĂŝŶ͞ĐŚĂƌĂĐƚĞƌŝƐƚŝĐƐ͟ŵĂLJŽƌŵĂLJŶŽƚĂƉƉůLJ ĚĞƉĞŶĚŝŶŐŽŶǁŚĞƚŚĞƌƚŚĞdLJůĞƌƐŽĨƚǁĂƌĞŚĂƐďĞĞŶĚĞƉůŽLJĞĚŽŶĐƵƐƚŽŵĞƌŝŶĨƌĂƐƚƌƵĐƚƵƌĞŽƌƚŚĞdLJůĞƌĐůŽƵĚ͘ dŚĞŐŽĂůŝƐƚŽŚĞůƉŐƵŝĚĞƚŚĞĐůŝĞŶƚƚŽǁĂƌĚƐĐůĞĂƌůLJƵŶĚĞƌƐƚĂŶĚŝŶŐĂŶĚĐŽŵŵƵŶŝĐĂƚŝŶŐƚŚĞŝŵƉŽƌƚĂŶĐĞŽĨƚŚĞ ŝƐƐƵĞĂŶĚƚŽĚĞƐĐƌŝďĞŐĞŶĞƌĂůůLJĞdžƉĞĐƚĞĚƌĞƐƉŽŶƐĞƐĂŶĚƌĞƐŽůƵƚŝŽŶƐ͘ WƌŝŽƌŝƚLJ >ĞǀĞůŚĂƌĂĐƚĞƌŝƐƚŝĐƐŽĨ^ƵƉƉŽƌƚ/ŶĐŝĚĞŶƚZĞƐŽůƵƚŝŽŶdĂƌŐĞƚƐ ϭ ƌŝƚŝĐĂů ^ƵƉƉŽƌƚŝŶĐŝĚĞŶƚƚŚĂƚĐĂƵƐĞƐ;ĂͿĐŽŵƉůĞƚĞ ĂƉƉůŝĐĂƚŝŽŶĨĂŝůƵƌĞŽƌĂƉƉůŝĐĂƚŝŽŶ ƵŶĂǀĂŝůĂďŝůŝƚLJ͖;ďͿĂƉƉůŝĐĂƚŝŽŶĨĂŝůƵƌĞŽƌ ƵŶĂǀĂŝůĂďŝůŝƚLJŝŶŽŶĞŽƌŵŽƌĞŽĨƚŚĞĐůŝĞŶƚ͛Ɛ ƌĞŵŽƚĞůŽĐĂƚŝŽŶ͖Žƌ;ĐͿƐLJƐƚĞŵŝĐůŽƐƐŽĨ ŵƵůƚŝƉůĞĞƐƐĞŶƚŝĂůƐLJƐƚĞŵĨƵŶĐƚŝŽŶƐ͘ dLJůĞƌƐŚĂůůƉƌŽǀŝĚĞĂŶŝŶŝƚŝĂůƌĞƐƉŽŶƐĞƚŽWƌŝŽƌŝƚLJ>ĞǀĞůϭŝŶĐŝĚĞŶƚƐ ǁŝƚŚŝŶŽŶĞ;ϭͿďƵƐŝŶĞƐƐŚŽƵƌŽĨƌĞĐĞŝƉƚŽĨƚŚĞƐƵƉƉŽƌƚ ŝŶĐŝĚĞŶƚ͘dLJůĞƌƐŚĂůůƵƐĞĐŽŵŵĞƌĐŝĂůůLJƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞƐŽůǀĞ ƐƵĐŚƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐŽƌƉƌŽǀŝĚĞĂĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞǁŝƚŚŝŶ ŽŶĞ;ϭͿďƵƐŝŶĞƐƐĚĂLJ͘&ŽƌŶŽŶͲŚŽƐƚĞĚĐƵƐƚŽŵĞƌƐ͕dLJůĞƌ͛Ɛ ƌĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌůŽƐƚŽƌĐŽƌƌƵƉƚĞĚĂƚĂŝƐůŝŵŝƚĞĚƚŽĂƐƐŝƐƚŝŶŐƚŚĞ ĐůŝĞŶƚŝŶƌĞƐƚŽƌŝŶŐŝƚƐůĂƐƚĂǀĂŝůĂďůĞĚĂƚĂďĂƐĞ͘ Ϯ ,ŝŐŚ ^ƵƉƉŽƌƚŝŶĐŝĚĞŶƚƚŚĂƚĐĂƵƐĞƐ;ĂͿƌĞƉĞĂƚĞĚ͕ ĐŽŶƐŝƐƚĞŶƚĨĂŝůƵƌĞŽĨĞƐƐĞŶƚŝĂůĨƵŶĐƚŝŽŶĂůŝƚLJ ĂĨĨĞĐƚŝŶŐŵŽƌĞƚŚĂŶŽŶĞƵƐĞƌŽƌ;ďͿůŽƐƐŽƌ ĐŽƌƌƵƉƚŝŽŶŽĨĂƚĂ͘ dLJůĞƌƐŚĂůůƉƌŽǀŝĚĞĂŶŝŶŝƚŝĂůƌĞƐƉŽŶƐĞƚŽWƌŝŽƌŝƚLJ>ĞǀĞůϮŝŶĐŝĚĞŶƚƐ ǁŝƚŚŝŶĨŽƵƌ;ϰͿďƵƐŝŶĞƐƐŚŽƵƌƐŽĨƌĞĐĞŝƉƚŽĨƚŚĞƐƵƉƉŽƌƚ ŝŶĐŝĚĞŶƚ͘dLJůĞƌƐŚĂůůƵƐĞĐŽŵŵĞƌĐŝĂůůLJƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞƐŽůǀĞ ƐƵĐŚƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐŽƌƉƌŽǀŝĚĞĂĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞǁŝƚŚŝŶ ƚĞŶ;ϭϬͿďƵƐŝŶĞƐƐĚĂLJƐ͘&ŽƌŶŽŶͲŚŽƐƚĞĚĐƵƐƚŽŵĞƌƐ͕dLJůĞƌ͛Ɛ ƌĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌůŽƐƐŽƌĐŽƌƌƵƉƚĞĚĂƚĂŝƐůŝŵŝƚĞĚƚŽĂƐƐŝƐƚŝŶŐƚŚĞ ĐůŝĞŶƚŝŶƌĞƐƚŽƌŝŶŐŝƚƐůĂƐƚĂǀĂŝůĂďůĞĚĂƚĂďĂƐĞ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϲ WƌŝŽƌŝƚLJ >ĞǀĞůŚĂƌĂĐƚĞƌŝƐƚŝĐƐŽĨ^ƵƉƉŽƌƚ/ŶĐŝĚĞŶƚZĞƐŽůƵƚŝŽŶdĂƌŐĞƚƐ ϯ DĞĚŝƵŵ WƌŝŽƌŝƚLJ>ĞǀĞůϭŝŶĐŝĚĞŶƚǁŝƚŚĂŶĞdžŝƐƚŝŶŐ ĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞ͕ŽƌĂWƌŝŽƌŝƚLJ>ĞǀĞů ϮŝŶĐŝĚĞŶƚƚŚĂƚĂĨĨĞĐƚƐŽŶůLJŽŶĞƵƐĞƌŽƌĨŽƌ ǁŚŝĐŚƚŚĞƌĞŝƐĂŶĞdžŝƐƚŝŶŐĐŝƌĐƵŵǀĞŶƚŝŽŶ ƉƌŽĐĞĚƵƌĞ͘ dLJůĞƌƐŚĂůůƉƌŽǀŝĚĞĂŶŝŶŝƚŝĂůƌĞƐƉŽŶƐĞƚŽWƌŝŽƌŝƚLJ>ĞǀĞůϯŝŶĐŝĚĞŶƚƐ ǁŝƚŚŝŶŽŶĞ;ϭͿďƵƐŝŶĞƐƐĚĂLJŽĨƌĞĐĞŝƉƚŽĨƚŚĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚ͘dLJůĞƌ ƐŚĂůůƵƐĞĐŽŵŵĞƌĐŝĂůůLJƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞƐŽůǀĞƐƵĐŚƐƵƉƉŽƌƚ ŝŶĐŝĚĞŶƚƐǁŝƚŚŽƵƚƚŚĞŶĞĞĚĨŽƌĂĐŝƌĐƵŵǀĞŶƚŝŽŶƉƌŽĐĞĚƵƌĞǁŝƚŚƚŚĞ ŶĞdžƚƉƵďůŝƐŚĞĚŵĂŝŶƚĞŶĂŶĐĞƵƉĚĂƚĞŽƌƐĞƌǀŝĐĞƉĂĐŬ͘&ŽƌŶŽŶͲŚŽƐƚĞĚ ĐƵƐƚŽŵĞƌƐ͕dLJůĞƌ͛ƐƌĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌůŽƐƚŽƌĐŽƌƌƵƉƚĞĚĂƚĂŝƐůŝŵŝƚĞĚ ƚŽĂƐƐŝƐƚŝŶŐƚŚĞĐůŝĞŶƚŝŶƌĞƐƚŽƌŝŶŐŝƚƐůĂƐƚĂǀĂŝůĂďůĞĚĂƚĂďĂƐĞ͘ ϰ EŽŶͲ ĐƌŝƚŝĐĂů ^ƵƉƉŽƌƚŝŶĐŝĚĞŶƚƚŚĂƚĐĂƵƐĞƐĨĂŝůƵƌĞŽĨŶŽŶͲ ĞƐƐĞŶƚŝĂůĨƵŶĐƚŝŽŶĂůŝƚLJŽƌĂĐŽƐŵĞƚŝĐŽƌŽƚŚĞƌ ŝƐƐƵĞƚŚĂƚĚŽĞƐŶŽƚƋƵĂůŝĨLJĂƐĂŶLJŽƚŚĞƌ WƌŝŽƌŝƚLJ>ĞǀĞů͘ dLJůĞƌƐŚĂůůƉƌŽǀŝĚĞĂŶŝŶŝƚŝĂůƌĞƐƉŽŶƐĞƚŽWƌŝŽƌŝƚLJ>ĞǀĞůϰŝŶĐŝĚĞŶƚƐ ǁŝƚŚŝŶƚǁŽ;ϮͿďƵƐŝŶĞƐƐĚĂLJƐ͘dLJůĞƌƐŚĂůůƵƐĞĐŽŵŵĞƌĐŝĂůůLJ ƌĞĂƐŽŶĂďůĞĞĨĨŽƌƚƐƚŽƌĞƐŽůǀĞƐƵĐŚƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚƐ͕ĂƐǁĞůůĂƐ ĐŽƐŵĞƚŝĐŝƐƐƵĞƐ͕ǁŝƚŚĂĨƵƚƵƌĞǀĞƌƐŝŽŶƌĞůĞĂƐĞ͘ /ŶĐŝĚĞŶƚƐĐĂůĂƚŝŽŶ dLJůĞƌdĞĐŚŶŽůŽŐLJ͛ƐƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚĐŽŶƐŝƐƚƐŽĨĨŽƵƌůĞǀĞůƐŽĨƉĞƌƐŽŶŶĞů͗ ;ϱͿ>ĞǀĞůϭ͗ĨƌŽŶƚͲůŝŶĞƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐ ;ϲͿ>ĞǀĞůϮ͗ŵŽƌĞƐĞŶŝŽƌŝŶƚŚĞŝƌƐƵƉƉŽƌƚƌŽůĞ͕ƚŚĞLJĂƐƐŝƐƚĨƌŽŶƚͲůŝŶĞƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐĂŶĚƚĂŬĞŽŶ ĞƐĐĂůĂƚĞĚŝƐƐƵĞƐ ;ϳͿ>ĞǀĞůϯ͗ĂƐƐŝƐƚŝŶŝŶĐŝĚĞŶƚĞƐĐĂůĂƚŝŽŶƐĂŶĚƐƉĞĐŝĂůŝnjĞĚĐůŝĞŶƚŝƐƐƵĞƐ ;ϴͿ>ĞǀĞůϰ͗ƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞŵĂŶĂŐĞŵĞŶƚŽĨƐƵƉƉŽƌƚƚĞĂŵƐĨŽƌĞŝƚŚĞƌĂƐŝŶŐůĞƉƌŽĚƵĐƚŽƌĂƉƌŽĚƵĐƚ ŐƌŽƵƉ /ĨĂĐůŝĞŶƚĨĞĞůƐƚŚĞLJĂƌĞŶŽƚƌĞĐĞŝǀŝŶŐƚŚĞƐĞƌǀŝĐĞŶĞĞĚĞĚ͕ƚŚĞLJŵĂLJĐŽŶƚĂĐƚƚŚĞĂƉƉƌŽƉƌŝĂƚĞ^ŽĨƚǁĂƌĞ ^ƵƉƉŽƌƚDĂŶĂŐĞƌ͘ĨƚĞƌƌĞĐĞŝǀŝŶŐƚŚĞŝŶĐŝĚĞŶƚƚƌĂĐŬŝŶŐŶƵŵďĞƌ͕ƚŚĞŵĂŶĂŐĞƌǁŝůůĨŽůůŽǁƵƉŽŶƚŚĞŽƉĞŶ ŝƐƐƵĞĂŶĚĚĞƚĞƌŵŝŶĞƚŚĞŶĞĐĞƐƐĂƌLJĂĐƚŝŽŶƚŽŵĞĞƚƚŚĞĐůŝĞŶƚ͛ƐŶĞĞĚƐ͘ KŶŽĐĐĂƐŝŽŶ͕ƚŚĞƉƌŝŽƌŝƚLJŽƌŝŵŵĞĚŝĂĐLJŽĨĂƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚŵĂLJĐŚĂŶŐĞĂĨƚĞƌŝŶŝƚŝĂƚŝŽŶ͘dLJůĞƌ ĞŶĐŽƵƌĂŐĞƐĐůŝĞŶƚƐƚŽĐŽŵŵƵŶŝĐĂƚĞƚŚĞůĞǀĞůŽĨƵƌŐĞŶĐLJŽƌƉƌŝŽƌŝƚLJŽĨƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝƐƐƵĞƐƐŽƚŚĂƚǁĞĐĂŶ ƌĞƐƉŽŶĚĂƉƉƌŽƉƌŝĂƚĞůLJ͘ƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝŶĐŝĚĞŶƚĐĂŶďĞĞƐĐĂůĂƚĞĚďLJĂŶLJŽĨƚŚĞĨŽůůŽǁŝŶŐŵĞƚŚŽĚƐ͗ ;ϰͿdĞůĞƉŚŽŶĞʹĨŽƌŝŵŵĞĚŝĂƚĞƌĞƐƉŽŶƐĞ͕ĐĂůůƚŽůůͲĨƌĞĞƚŽĞŝƚŚĞƌĞƐĐĂůĂƚĞĂŶŝŶĐŝĚĞŶƚ͛ƐƉƌŝŽƌŝƚLJŽƌƚŽ ĞƐĐĂůĂƚĞĂŶŝƐƐƵĞƚŚƌŽƵŐŚŵĂŶĂŐĞŵĞŶƚĐŚĂŶŶĞůƐĂƐĚĞƐĐƌŝďĞĚĂďŽǀĞ͘ ;ϱͿŵĂŝůʹĐůŝĞŶƚƐĐĂŶƐĞŶĚĂŶĞŵĂŝůƚŽƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚŝŶŽƌĚĞƌƚŽĞƐĐĂůĂƚĞƚŚĞƉƌŝŽƌŝƚLJŽĨĂŶŝƐƐƵĞ ;ϲͿKŶͲůŝŶĞ^ƵƉƉŽƌƚ/ŶĐŝĚĞŶƚWŽƌƚĂůʹĐůŝĞŶƚƐĐĂŶĂůƐŽĞƐĐĂůĂƚĞƚŚĞƉƌŝŽƌŝƚLJŽĨĂŶŝƐƐƵĞďLJůŽŐŐŝŶŐŝŶƚŽƚŚĞ ĐůŝĞŶƚŝŶĐŝĚĞŶƚƉŽƌƚĂůĂŶĚƌĞĨĞƌĞŶĐŝŶŐƚŚĞĂƉƉƌŽƉƌŝĂƚĞŝŶĐŝĚĞŶƚƚƌĂĐŬŝŶŐŶƵŵďĞƌ͘ ZĞŵŽƚĞ^ƵƉƉŽƌƚdŽŽů ^ŽŵĞƐƵƉƉŽƌƚĐĂůůƐƌĞƋƵŝƌĞĨƵƌƚŚĞƌĂŶĂůLJƐŝƐŽĨƚŚĞĐůŝĞŶƚ͛ƐĚĂƚĂďĂƐĞ͕ƉƌŽĐĞƐƐŽƌƐĞƚƵƉƚŽĚŝĂŐŶŽƐĞĂƉƌŽďůĞŵ ŽƌƚŽĂƐƐŝƐƚǁŝƚŚĂƋƵĞƐƚŝŽŶ͘dLJůĞƌǁŝůů͕ĂƚŝƚƐĚŝƐĐƌĞƚŝŽŶ͕ƵƐĞĂŶŝŶĚƵƐƚƌLJͲƐƚĂŶĚĂƌĚƌĞŵŽƚĞƐƵƉƉŽƌƚƚŽŽů͘ ^ƵƉƉŽƌƚŝƐĂďůĞƚŽƋƵŝĐŬůLJĐŽŶŶĞĐƚƚŽƚŚĞĐůŝĞŶƚ͛ƐĚĞƐŬƚŽƉĂŶĚǀŝĞǁƚŚĞƐŝƚĞ͛ƐƐĞƚƵƉ͕ĚŝĂŐŶŽƐĞƉƌŽďůĞŵƐ͕Žƌ ĂƐƐŝƐƚǁŝƚŚƐĐƌĞĞŶŶĂǀŝŐĂƚŝŽŶ͘DŽƌĞŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚƚŚĞƌĞŵŽƚĞƐƵƉƉŽƌƚƚŽŽůdLJůĞƌƵƐĞƐŝƐĂǀĂŝůĂďůĞƵƉŽŶ ƌĞƋƵĞƐƚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϳ džŚŝďŝƚ ŶĚhƐĞƌ>ŝĐĞŶƐĞŐƌĞĞŵĞŶƚϳ ZD/EZK&W'/EdEd/KE>>z>&d>E< ϳ/E>hKE>zt,Zdz>Z&KZD^ZWZdK&>/E^DKh>^͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϴ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϮϵϵ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϬ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϭ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϮ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϯ džŚŝďŝƚ DLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJĂŶĚ/sZ ϭ͘DLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ>ŝĐĞŶƐŝŶŐ͘ĐĐĞƐƐƚŽDLJ'ŽǀWĂLJĂŶĚͬŽƌsŝƌƚƵĂůWĂLJŝƐŚĞƌĞďLJŐƌĂŶƚĞĚŝĨƵƐƚŽŵĞƌ ĞůĞĐƚƐƚŽƵƐĞDLJ'ŽǀWĂLJŽƌsŝƌƚƵĂůWĂLJ͕ƉƌŽĚƵĐƚƐŽĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ;WŽǁĞƌĞĚďLJWĞƌƐŽůǀĞŶƚͿ͕ĚĞƐŝŐŶĞĚĨŽƌ ŝƚŝnjĞŶhƐĞƌƐƚŽƵƐĞĨŽƌƉƌŽĐĞƐƐŝŶŐŽŶůŝŶĞƉĂLJŵĞŶƚƐ͘ ;ĂͿ^ƉĞĐŝĂůDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJĞĨŝŶŝƚŝŽŶƐ͘ ͞DĞƌĐŚĂŶƚŐƌĞĞŵĞŶƚ͟ŵĞĂŶƐƚŚĞĂŐƌĞĞŵĞŶƚďĞƚǁĞĞŶƵƐƚŽŵĞƌĂŶĚWĞƌƐŽůǀĞŶƚƚŚĂƚƉƌŽǀŝĚĞƐĨŽƌƚŚĞ DĞƌĐŚĂŶƚ&ĞĞƐ͘ ͞DĞƌĐŚĂŶƚ&ĞĞƐ͟ŵĞĂŶƐĚŝƌĞĐƚĐŽƐƚƐůĞǀŝĞĚďLJsŝƐĂͬDĂƐƚĞƌĐĂƌĚͬŝƐĐŽǀĞƌŽƌŽƚŚĞƌƉĂLJŵĞŶƚĐĂƌĚĐŽŵƉĂŶŝĞƐĨŽƌ /ŶƚĞƌĐŚĂŶŐĞ&ĞĞƐ͕ƵĞƐ͕ƐƐĞƐƐŵĞŶƚƐĂŶĚKĐĐƵƌƌĞŶĐĞ&ĞĞƐ͕ŽǀĞƌǁŚŝĐŚdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŚĂƐŶŽĂƵƚŚŽƌŝƚLJ͘ ͞DLJ'ŽǀWĂLJ͟ŵĞĂŶƐƚŚĞWƌŽĚƵĐƚŽĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƚŚĂƚĂůůŽǁƐŵĞŵďĞƌƐŽĨƚŚĞƉƵďůŝĐƚŽƉĂLJĨŽƌƵƐƚŽŵĞƌ͛Ɛ ƐĞƌǀŝĐĞƐǁŝƚŚĂĐƌĞĚŝƚŽƌŽƚŚĞƌƉĂLJŵĞŶƚĐĂƌĚŽŶƚŚĞƵƐƚŽŵĞƌ͛ƐĐŝƚŝnjĞŶͲĨĂĐŝŶŐǁĞďƉŽƌƚĂů͘ ͞WĞƌƐŽůǀĞŶƚ͟ŵĞĂŶƐWĞƌƐŽůǀĞŶƚ͕ĨŽƌŵĞƌůLJĂŶŬĂƌĚ^ĞƌǀŝĐĞƐtŽƌůĚǁŝĚĞ͕ĂWĂLJŵĞŶƚĂƌĚ/ŶĚƵƐƚƌLJ;W/Ϳ ĐŽŵƉůŝĂŶƚƉƌŽĐĞƐƐŝŶŐĂŐĞŶƚƚŚƌŽƵŐŚǁŚŝĐŚƚŚĞŶĞƌ'Žǀ^ŽĨƚǁĂƌĞƉĂƐƐĞƐĐƌĞĚŝƚĐĂƌĚƚƌĂŶƐĂĐƚŝŽŶƐ͘ ͞hƐĞ&ĞĞƐ͟ŵĞĂŶƐƚŚĞdĞĐŚŶŽůŽŐLJ&ĞĞƐ͕ƵƚŚŽƌŝnjĂƚŝŽŶ&ĞĞƐĂŶĚWƌŽŐƌĂŵͬŽŶǀĞŶŝĞŶĐĞ&ĞĞƐĂƐůŝƐƚĞĚŝŶhƐĞ&ĞĞƐ dĂďůĞŝŶ^ĞĐƚŝŽŶϮ͕ƚŝƚůĞĚDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ͘ ͞sŝƌƚƵĂůWĂLJ͟ŵĞĂŶƐƚŚĞWƌŽĚƵĐƚŽĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƚŚĂƚĂůůŽǁƐƚŚĞƵƐƚŽŵĞƌƚŽĂĐĐĞƉƚĂŶĚƉƌŽĐĞƐƐĐŝƚŝnjĞŶ ƵƐĞƌ͛ƐĐƌĞĚŝƚŽƌŽƚŚĞƌƉĂLJŵĞŶƚĐĂƌĚƵƐŝŶŐƚŚĞŶĞƌ'Žǀ^ŽĨƚǁĂƌĞ͘ ;ďͿŽŶĚŝƚŝŽŶƐŽĨhƐĞ͘/ĨĐƵƐƚŽŵĞƌĞůĞĐƚƐƚŽƵƐĞDLJ'ŽǀWĂLJĂŶĚͬŽƌsŝƌƚƵĂůWĂLJƚŚĞĨŽůůŽǁŝŶŐƚĞƌŵƐĂƉƉůLJ͗ ;ϭͿƵƐƚŽŵĞƌŵƵƐƚĂƉƉůLJĨŽƌĂŶĚĂŐƌĞĞƚŽĂDĞƌĐŚĂŶƚŐƌĞĞŵĞŶƚǁŝƚŚWĞƌƐŽůǀĞŶƚ͘ ;ϮͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚŝƚŝnjĞŶhƐĞƌƐǁŝůůďĞƐƵďũĞĐƚƚŽhƐĞ&ĞĞƐĂƐůŝƐƚĞĚŝŶhƐĞ&ĞĞƐƚĂďůĞŝŶ^ĞĐƚŝŽŶϮ͘ ;ϯͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚhƐĞ&ĞĞƐĂƌĞƐĞƉĂƌĂƚĞĨƌŽŵĂŶĚŝŶĚĞƉĞŶĚĞŶƚŽĨDĞƌĐŚĂŶƚ&ĞĞƐ͘ ;ϰͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚƚŚŝƐŐƌĞĞŵĞŶƚĚŽĞƐŶŽƚƌĞƉƌĞƐĞŶƚĂŶLJŵŽĚŝĨŝĐĂƚŝŽŶƚŽƵƐƚŽŵĞƌ͛ƐDĞƌĐŚĂŶƚ ŐƌĞĞŵĞŶƚǁŝƚŚWĞƌƐŽůǀĞŶƚ͘ ;ϱͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚhƐĞ&ĞĞƐĂƌĞĨŽƌƵƐĞŽŶƚŚĞDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJŽŶůŝŶĞƐLJƐƚĞŵĂŶĚǁŝůůŶŽƚďĞ ĚĞƉŽƐŝƚĞĚŽƌŽǁĞĚƚŽƵƐƚŽŵĞƌŝŶĂŶLJǁĂLJ͘ ;ϲͿƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚDLJ'ŽǀWĂLJ͛ƐĂŶĚsŝƌƚƵĂůWĂLJ͛ƐĂďŝůŝƚLJƚŽĂƐƐĞƐƐhƐĞ&ĞĞƐŝƐĚŝĐƚĂƚĞĚďLJƚŚĞĂƌĚ ƐƐŽĐŝĂƚŝŽŶƐǁŚŽƐĞƌƵůĞƐŵĂLJĐŚĂŶŐĞĂƚĂŶLJƚŝŵĞĂŶĚĨŽƌĂŶLJƌĞĂƐŽŶ͘/ĨDLJ'ŽǀWĂLJĂŶĚͬŽƌsŝƌƚƵĂůWĂLJ͕ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϰ ĨŽƌĂŶLJƌĞĂƐŽŶ͕ĂƌĞƵŶĂďůĞƚŽƉƌŽĐĞƐƐƉĂLJŵĞŶƚƐƵƐŝŶŐhƐĞ&ĞĞƐ͕ƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚ DLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽŶĞŐŽƚŝĂƚĞĂŶĞǁƉƌŝĐŝŶŐŵŽĚĞůǁŝƚŚƵƐƚŽŵĞƌĨŽƌƚŚĞ ĐŽŶƚŝŶƵĞĚƵƐĞŽĨDLJ'ŽǀWĂLJĂŶĚͬŽƌsŝƌƚƵĂůWĂLJ͘ Ϯ͘DLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ&ĞĞƐ͘ƵƐƚŽŵĞƌĂŐƌĞĞƐƚŚĂƚƚŚĞhƐĞ&ĞĞƐƐĞƚĨŽƌƚŚŽŶƚŚĞĨŽůůŽǁŝŶŐƉĂŐĞǁŝůůĂƉƉůLJŝĨ ƵƐƚŽŵĞƌĞůĞĐƚƐƚŽƵƐĞDLJ'ŽǀWĂLJͬsŝƌƚƵĂůWĂLJ͘ h^&^d>&K>>Kt^KEEydW' ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϱ hƐĞ&ĞĞƐ ŶĞƌ'Žǀ͛ƐDLJ'ŽǀWĂLJ;KŶůŝŶĞͬĐĂƌĚͲŶŽƚͲƉƌĞƐĞŶƚƉĂLJŵĞŶƚƐͿΎΎ DLJ'ŽǀWĂLJ;KŶůŝŶĞWĂLJŵĞŶƚƐͿDLJ'ŽǀWĂLJ;KŶůŝŶĞWĂLJŵĞŶƚƐͿ WĞƌĐĞŶƚĂŐĞĂƐĞĚ&ĞĞнdƌĂŶƐĂĐƚŝŽŶ&ĞĞ KƉƚŝŽŶϭ͗ 'ŽǀĞƌŶŵĞŶƚŶƚŝƚLJWĂŝĚ Ϯ͘ϳϵй ΨϬ͘ϮϬ KƉƚŝŽŶϮ͗ WĂƚƌŽŶWĂŝĚ ϯ͘Ϯϵй Eͬ ΎΎ,ƉƌŽĐĞƐƐŝŶŐŝƐĂǀĂŝůĂďůĞĨŽƌĂĨĞĞŽĨΨϮϬƉĞƌŵŽŶƚŚĂŶĚΨϬ͘ϯϬƉĞƌƚƌĂŶƐĂĐƚŝŽŶ͘ ŶĞƌ'Žǀ͛ƐsŝƌƚƵĂůWĂLJ;ƌĞƚĂŝůĐĂƌĚƉƌĞƐĞŶƚͿ sŝƌƚƵĂůWĂLJ;ZĞƚĂŝůWĂLJŵĞŶƚƐͿsŝƌƚƵĂůWĂLJ;ZĞƚĂŝůWĂLJŵĞŶƚƐͿ WĞƌĐĞŶƚĂŐĞĂƐĞĚ&ĞĞнdƌĂŶƐĂĐƚŝŽŶ&ĞĞ KƉƚŝŽŶϭ͗ 'ŽǀĞƌŶŵĞŶƚŶƚŝƚLJWĂŝĚ Ϯ͘ϱϵй ΨϬ͘ϭϱ KƉƚŝŽŶϮ͗ WĂƚƌŽŶWĂŝĚ Ϯ͘ϵϵй Eͬ WĂƚƌŽŶWĂŝĚĨĞĞƐǁŝůůďĞĐŽŵŵƵŶŝĐĂƚĞĚĂƐΗ^ĞƌǀŝĐĞ&ĞĞƐΗƚŽƚŚĞĐĂƌĚŚŽůĚĞƌ͕ĂƚƚŚĞƚŝŵĞŽĨƚƌĂŶƐĂĐƚŝŽŶ͘/ŶƚŚĞ ĞǀĞŶƚƚŚĂƚƚŚĞĂǀĞƌĂŐĞŵŽŶƚŚůLJƚƌĂŶƐĂĐƚŝŽŶĂŵŽƵŶƚŝƐďĞůŽǁΨϯϬ͕ŽŶƚƌĂĐƚŽƌƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽĂƉƉůLJĂŶ ĂĚĚŝƚŝŽŶĂůΨϬ͘ϮϬƐĞƌǀŝĐĞĨĞĞĂďŽǀĞƚŚĞƋƵŽƚĞĚƌĂƚĞƐĂďŽǀĞ͘ ϯ͘/ŶƚĞƌĂĐƚŝǀĞsŽŝĐĞZĞƐƉŽŶƐĞ;͞/sZ͟Ϳ͘/Ĩ/sZŝƐƐĞůĞĐƚĞĚďLJƵƐƚŽŵĞƌĂŶĚŝŶĐůƵĚĞĚŝŶƚŚĞƉƌŝĐŝŶŐ͕ƚŚĞĨŽůůŽǁŝŶŐ ĂĚĚŝƚŝŽŶĂůƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐƐŚĂůůĂƉƉůLJŽĨƚŚŝƐŐƌĞĞŵĞŶƚ͗ ;ĂͿEĞƚǁŽƌŬ^ĞĐƵƌŝƚLJ͘ƵƐƚŽŵĞƌĂĐŬŶŽǁůĞĚŐĞƐƚŚĂƚĂƚŚŝƌĚͲƉĂƌƚLJŝƐƵƐĞĚďLJdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƚŽƉƌŽĐĞƐƐ/sZ ĂƚĂ͘ƵƐƚŽŵĞƌ͛ƐĐŽŶƚĞŶƚǁŝůůƉĂƐƐƚŚƌŽƵŐŚĂŶĚďĞƐƚŽƌĞĚŽŶƚŚĞƚŚŝƌĚͲƉĂƌƚLJƐĞƌǀĞƌƐĂŶĚǁŝůůŶŽƚďĞƐĞŐƌĞŐĂƚĞĚ ŽƌŝŶĂƐĞƉĂƌĂƚĞƉŚLJƐŝĐĂůůŽĐĂƚŝŽŶĨƌŽŵƐĞƌǀĞƌƐŽŶǁŚŝĐŚŽƚŚĞƌĐƵƐƚŽŵĞƌƐ͛ĐŽŶƚĞŶƚŝƐŽƌǁŝůůďĞƚƌĂŶƐŵŝƚƚĞĚŽƌ ƐƚŽƌĞĚ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϲ ;ďͿŽŶƚĞŶƚ͘ƵƐƚŽŵĞƌŝƐƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞĐƌĞĂƚŝŽŶ͕ĞĚŝƚŽƌŝĂůĐŽŶƚĞŶƚ͕ĐŽŶƚƌŽů͕ĂŶĚĂůůŽƚŚĞƌĂƐƉĞĐƚƐŽĨĐŽŶƚĞŶƚ ƚŽďĞƵƐĞĚƐŽůĞůLJŝŶĐŽŶũƵŶĐƚŝŽŶǁŝƚŚƚŚĞŶĞƌ'Žǀ^ŽĨƚǁĂƌĞ͘ ;ĐͿ>ĂǁĨƵůWƵƌƉŽƐĞƐ͘ƵƐƚŽŵĞƌƐŚĂůůŶŽƚƵƐĞƚŚĞ/sZƐLJƐƚĞŵĨŽƌĂŶLJƵŶůĂǁĨƵůƉƵƌƉŽƐĞ͘ ;ĚͿƌŝƚŝĐĂůƉƉůŝĐĂƚŝŽŶ͘ƵƐƚŽŵĞƌǁŝůůŶŽƚƵƐĞƚŚĞ/sZƐLJƐƚĞŵĨŽƌĂŶLJůŝĨĞͲƐƵƉƉŽƌƚĂƉƉůŝĐĂƚŝŽŶŽƌŽƚŚĞƌĐƌŝƚŝĐĂů ĂƉƉůŝĐĂƚŝŽŶǁŚĞƌĞĨĂŝůƵƌĞŽƌƉŽƚĞŶƚŝĂůĨĂŝůƵƌĞŽĨƚŚĞ/sZƐLJƐƚĞŵĐĂŶĐĂƵƐĞŝŶũƵƌLJ͕ŚĂƌŵ͕ĚĞĂƚŚ͕ŽƌŽƚŚĞƌŐƌĂǀĞ ƉƌŽďůĞŵƐ͕ŝŶĐůƵĚŝŶŐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ůŽƐƐŽĨĂŝƌĐƌĂĨƚĐŽŶƚƌŽů͕ŚŽƐƉŝƚĂůůŝĨĞͲƐƵƉƉŽƌƚƐLJƐƚĞŵ͕ĂŶĚĚĞůĂLJƐŝŶ ŐĞƚƚŝŶŐŵĞĚŝĐĂƚĞĐĂƌĞŽƌŽƚŚĞƌĞŵĞƌŐĞŶĐLJƐĞƌǀŝĐĞƐ͘ ;ĞͿEŽ,ĂƌŵĨƵůŽĚĞ͘ƵƐƚŽŵĞƌƌĞƉƌĞƐĞŶƚƐĂŶĚǁĂƌƌĂŶƚƐƚŚĂƚŶŽ ĐŽŶƚĞŶƚĚĞƐŝŐŶĞĚƚŽĚĞůĞƚĞ͕ĚŝƐĂďůĞ͕ ĚĞĂĐƚŝǀĂƚĞ͕ŝŶƚĞƌĨĞƌĞǁŝƚŚŽƌŽƚŚĞƌǁŝƐĞŚĂƌŵĂŶLJĂƐƉĞĐƚŽĨƚŚĞ/sZƐLJƐƚĞŵŶŽǁŽƌŝŶƚŚĞĨƵƚƵƌĞ͕ƐŚĂůůďĞ ŬŶŽǁŝŶŐůLJƚƌĂŶƐŵŝƚƚĞĚďLJƵƐƚŽŵĞƌŽƌhƐĞƌƐ͘ ;ĨͿ/sZtZZEdz͘džĐĞƉƚĂƐĞdžƉƌĞƐƐůLJƐĞƚĨŽƌƚŚŝŶƚŚŝƐŐƌĞĞŵĞŶƚ͕dz>Zd,EK>K'/^D<^EK ZWZ^Edd/KEEydE^EKtZZEd/^K&Ez</E͕/d,ZyWZ^^KZ/DW>/͕/E>h/E' tZZEd/^K&d/d>͕EKEͲ/E&Z/E'DEd͕DZ,Ed/>/dzKZ&/dE^^&KZWZd/h>ZWhZWK^&KZ /sZ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϳ džŚŝďŝƚ ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬ ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬ͕ŝĨĂƉƉůŝĐĂďůĞ͕ƚŽďĞŝŶƐĞƌƚĞĚƉƌŝŽƌƚŽŐƌĞĞŵĞŶƚĞdžĞĐƵƚŝŽŶ͘ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϴ ^K&dtZ^KhZK^ZKt'ZDEd dZD^EKE/d/KE^ /EKE^/Zd/KEK&ƚŚĞƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐŽĨƚŚĞŐƌĞĞŵĞŶƚĂŶĚŽƚŚĞƌŐŽŽĚĂŶĚǀĂůƵĂďůĞĐŽŶƐŝĚĞƌĂƚŝŽŶ͕ƚŚĞƉĂƌƚŝĞƐŚĞƌĞƚŽĂŐƌĞĞ ĂƐĨŽůůŽǁƐ͗ ^ZKt 'ZDEd͘ dLJůĞƌ dĞĐŚŶŽůŽŐŝĞƐ ĂŐƌĞĞƐ ƚŽ ŶĂŵĞ͕ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺŚĞƌĞŝŶĂĨƚĞƌ >/Ed͕ ĂƐ Ă ďĞŶĞĨŝĐŝĂƌLJ ŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞƉƌŽǀŝƐŝŽŶƐŽĨƚŚĞ^ŽĨƚǁĂƌĞƐĐƌŽǁ^ĞƌǀŝĐĞŐƌĞĞŵĞŶƚdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐŵĂŝŶƚĂŝŶƐǁŝƚŚĂŶŝŶĚĞƉĞŶĚĞŶƚĞƐĐƌŽǁ ƐĞƌǀŝĐĞ͘ WZ/͘>/EdĂŐƌĞĞƐƚŽƉĂLJĂŶŝŶŝƚŝĂůƐƚĂƌƚͲƵƉĨĞĞŽĨΨϭϱϬϬ͘ϬϬ͕ĚƵĞƵƉŽŶĞdžĞĐƵƚŝŽŶŽĨƚŚŝƐĂŐƌĞĞŵĞŶƚ͘&ƵƚƵƌĞĂŶŶƵĂůƉĂLJŵĞŶƚƐŽĨ ΨϭϱϬϬ͘ϬϬǁŝůůďĞŝŶǀŽŝĐĞĚŝŶƚŚĞŵŽŶƚŚƉƌŝŽƌƚŽƚŚĞƌĞŶĞǁĂůĚĂƚĞĂŶĚǁŝůůďĞĚƵĞŝŶĨƵůůĨŽƌƚŚŝƐĂŐƌĞĞŵĞŶƚƚŽĐŽŶƚŝŶƵĞŝŶĞĨĨĞĐƚ͘ ^K&dtZ^KhZKKsZ͘dŚŝƐŐƌĞĞŵĞŶƚĂƉƉůŝĞƐƚŽĂůůdLJůĞƌ^ŽĨƚǁĂƌĞWƌŽĚƵĐƚƐĨŽƌǁŚŝĐŚ>/EdŚĂƐƉĂŝĚƚŚĞĨƵůůĂŐƌĞĞĚ ƵƉŽŶƉƌŝĐĞŽĨƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞůŝĐĞŶƐĞ͘/Ĩ>/EdĂĐƋƵŝƌĞƐĂĚĚŝƚŝŽŶĂůdLJůĞƌ^ŽĨƚǁĂƌĞWƌŽĚƵĐƚƐŝŶƚŚĞĨƵƚƵƌĞ͕ƐƵĐŚƐŽĨƚǁĂƌĞƐŚĂůůĂůƐŽďĞ ĐŽǀĞƌĞĚďLJƚŚŝƐŐƌĞĞŵĞŶƚ͘/Ĩ>/EdĨĂŝůƐƚŽƉĂLJƚŚĞƐĐƌŽǁĨĞĞǁŚĞŶĚƵĞ͕dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƐŚĂůůŚĂǀĞƚŚĞƌŝŐŚƚŝŶŝƚƐƐŽůĞĚŝƐĐƌĞƚŝŽŶƚŽ ƐƵƐƉĞŶĚŝƚƐƉĞƌĨŽƌŵĂŶĐĞŽƌƚĞƌŵŝŶĂƚĞƚŚŝƐŐƌĞĞŵĞŶƚ͘ dZD͘dŚŝƐŐƌĞĞŵĞŶƚƐŚĂůůďĞĐŽŵĞĞĨĨĞĐƚŝǀĞŽŶƚŚĞĚĂƚĞĞdžĞĐƵƚĞĚďLJĂŶŽĨĨŝĐĞƌŽĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĂŶĚƐŚĂůůŚĂǀĞĂƚĞƌŵĞŶĚŝŶŐƵƉŽŶ ƚŚĞůĂƐƚĚĂLJŽĨƚŚĞŵŽŶƚŚŽŶĞLJĞĂƌĨŽůůŽǁŝŶŐƚŚĂƚĚĂƚĞ͘ ͘dŚŝƐŐƌĞĞŵĞŶƚǁŝůůĂƵƚŽŵĂƚŝĐĂůůLJƌĞŶĞǁĨŽƌƐƵďƐĞƋƵĞŶƚŽŶĞLJĞĂƌƚĞƌŵƐƵŶůĞƐƐĞŝƚŚĞƌƉĂƌƚLJŐŝǀĞƐƚŚĞŽƚŚĞƌƉĂƌƚLJĂƚůĞĂƐƚƚŚŝƌƚLJĚĂLJƐ ƉƌŝŽƌǁƌŝƚƚĞŶŶŽƚŝĐĞŽĨŝƚƐŝŶƚĞŶƚŶŽƚƚŽƌĞŶĞǁ͘&ĞĞƐĨŽƌƐƵďƐĞƋƵĞŶƚLJĞĂƌƐĂƌĞƐƵďũĞĐƚƚŽĐŚĂŶŐĞ͘ WZKs/^/KE^͘ƐĂŵŝŶŝŵƵŵƌĞƋƵŝƌĞŵĞŶƚ͕dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĂŐƌĞĞƐƚŽƉƌŽǀŝĚĞƚŚĞĨŽůůŽǁŝŶŐƐĞƌǀŝĐĞƚŽ>/EdƚŚƌŽƵŐŚĂŶĞƐĐƌŽǁ ĂŐƌĞĞŵĞŶƚ͗ ͘dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐǁŝůůŵĂŝŶƚĂŝŶĂƐŽĨƚǁĂƌĞĞƐĐƌŽǁƐĞƌǀŝĐĞĂŐƌĞĞŵĞŶƚǁŝƚŚĂŶŝŶĚĞƉĞŶĚĞŶƚĞƐĐƌŽǁƐĞƌǀŝĐĞƉƌŽǀŝĚĞƌ͘ ͘dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐǁŝůůĚĞƉŽƐŝƚĂĐƵƌƌĞŶƚĐŽƉLJŽĨƐŽƵƌĐĞĐŽĚĞĨŽƌĂůůůŝĐĞŶƐĞĚdLJůĞƌ^ŽĨƚǁĂƌĞWƌŽĚƵĐƚƐĂŶĚǁŝůůƵƉĚĂƚĞƚŚĞĚĞƉŽƐŝƚ ǁŚĞŶĂŵĂũŽƌƌĞǀŝƐŝŽŶŽĨƚŚĞƐŽĨƚǁĂƌĞŝƐƌĞůĞĂƐĞĚ͘ ͘/ĨdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĐŚŽŽƐĞƐƚŽĐŚĂŶŐĞƚŚĞƉƌŽǀŝĚĞƌŽĨƚŚĞĞƐĐƌŽǁƐĞƌǀŝĐĞ͕dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐǁŝůůŶŽƚŝĨLJ>/EdŽĨƚŚĞŶĂŵĞ ĂŶĚĂĚĚƌĞƐƐŽĨƚŚĞŶĞǁĞƐĐƌŽǁƐĞƌǀŝĐĞƉƌŽǀŝĚĞƌ͘ ͘dŚĞƉƌŽǀŝƐŝŽŶƐŝŶĐůƵĚĞĚŝŶƚŚĞĞƐĐƌŽǁƐĞƌǀŝĐĞĂŐƌĞĞŵĞŶƚǁŝůůŝŶĐůƵĚĞƉƌŽǀŝƐŝŽŶƐĨŽƌƚŚĞďĞŶĞĨŝĐŝĂƌLJƚŽƌĞĐĞŝǀĞĂĐĐĞƐƐƚŽƚŚĞ dLJůĞƌ^ŽĨƚǁĂƌĞWƌŽĚƵĐƚƐƐŽƵƌĐĞĐŽĚĞǁŚĞŶƚŚĞĞƐĐƌŽǁƐĞƌǀŝĐĞƉƌŽǀŝĚĞƌŚĂƐƌĞĐĞŝǀĞĚǁƌŝƚƚĞŶŝŶƐƚƌƵĐƚŝŽŶĚŝƌĞĐƚůLJĨƌŽŵdLJůĞƌ dĞĐŚŶŽůŽŐŝĞƐ͕dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͛ƚƌƵƐƚĞĞŝŶďĂŶŬƌƵƉƚĐLJ͕ŽƌĂĐŽƵƌƚŽĨĐŽŵƉĞƚĞŶƚũƵƌŝƐĚŝĐƚŝŽŶĂŶĚƉĂLJŵĞŶƚƚŽƚŚĞĞƐĐƌŽǁƐĞƌǀŝĐĞ ƉƌŽǀŝĚĞƌŽĨƚŚĞĚĞƉŽƐŝƚĐŽƉLJŝŶŐĂŶĚĚĞůŝǀĞƌLJĨĞĞƐ͕ƚŚĞŶƚŚĞĞƐĐƌŽǁƐĞƌǀŝĐĞƉƌŽǀŝĚĞƌǁŝůůƌĞůĞĂƐĞĂĐŽƉLJŽĨƚŚĞĚĞƉŽƐŝƚŵĂƚĞƌŝĂůƐ ƚŽ>/Ed͘ Wdz͗Wdz͗ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϬϵ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘>/EdED >ŽĐĂů'ŽǀĞƌŶŵĞŶƚŝǀŝƐŝŽŶ LJ͗LJ͗ EĂŵĞ͗EĂŵĞ͗ dŝƚůĞ͗dŝƚůĞ͗ ĂƚĞ͗ĂƚĞ͗ ^ĞĐƚŝŽŶϴ͘ϬͲ^ĂŵƉůĞŽĐƵŵĞŶƚƐ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϭϬ ^ĞĐƚŝŽŶϵ͘ϬͲWƌŝĐĞWƌŽƉŽƐĂů;dŽĞ^ƵďŵŝƚƚĞĚ hŶĚĞƌ^ĞƉĂƌĂƚĞŽǀĞƌͿ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϭϭ ^ĞĐƚŝŽŶϵ͘ϬͲWƌŝĐĞWƌŽƉŽƐĂů;dŽĞ^ƵďŵŝƚƚĞĚhŶĚĞƌ ^ĞƉĂƌĂƚĞŽǀĞƌͿ WůĞĂƐĞƐĞĞdLJůĞƌ͛ƐWƌŝĐĞWƌŽƉŽƐĂůĚŽĐƵŵĞŶƚƚŚĂƚŚĂĚďĞĞŶŝŶĐůƵĚĞĚŝŶƚŚŝƐƐƵďŵŝƐƐŝŽŶƐĞƉĂƌĂƚĞůLJĂƐƌĞƋƵĞƐƚĞĚ ŝŶƚŚĞZ&W͘ ^ĞĐƚŝŽŶϵ͘ϬͲWƌŝĐĞWƌŽƉŽƐĂů;dŽĞ^ƵďŵŝƚƚĞĚ hŶĚĞƌ^ĞƉĂƌĂƚĞŽǀĞƌͿ ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůWĂŐĞϯϭϮ KZ/'/E> ŝƚLJŽĨŽƌĐŽƌĂŶ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵWƌŝĐĞ WƌŽƉŽƐĂů dŚƵƌƐĚĂLJ͕&ĞďƌƵĂƌLJϭϴ͕ϮϬϮϭ ŽĚLJ'ƵŶƐƚĞŶƐŽŶͲĐĐŽƵŶƚdžĞĐƵƚŝǀĞ ϱϱϭϵϱϯƌĚ^ƚƌĞĞƚ͕>ƵďďŽĐŬ͕dyϳϵϰϭϰ WŚŽŶĞ͗Ϯϭϰ͘ϱϳϴ͘ϱϭϲϲ ŵĂŝů͗ŽĚLJ͘'ƵŶƐƚĞŶƐŽŶΛƚLJůĞƌƚĞĐŚ͘ĐŽŵ KWz ŝƚLJŽĨŽƌĐŽƌĂŶ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵWƌŝĐĞ WƌŽƉŽƐĂů dŚƵƌƐĚĂLJ͕&ĞďƌƵĂƌLJϭϴ͕ϮϬϮϭ ŽĚLJ'ƵŶƐƚĞŶƐŽŶͲĐĐŽƵŶƚdžĞĐƵƚŝǀĞ ϱϱϭϵϱϯƌĚ^ƚƌĞĞƚ͕>ƵďďŽĐŬ͕dyϳϵϰϭϰ WŚŽŶĞ͗Ϯϭϰ͘ϱϳϴ͘ϱϭϲϲ ŵĂŝů͗ŽĚLJ͘'ƵŶƐƚĞŶƐŽŶΛƚLJůĞƌƚĞĐŚ͘ĐŽŵ ZĞƐƚƌŝĐƚŝŽŶƐŽŶŝƐĐůŽƐƵƌĞ dŚŝƐƉƌŽƉŽƐĂůĨƌŽŵdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘;͞dLJůĞƌ͟ͿĐŽŶƚĂŝŶƐƉƌŽƉƌŝĞƚĂƌLJĂŶĚĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶ͕ ŝŶĐůƵĚŝŶŐƚƌĂĚĞƐĞĐƌĞƚƐ͕ďĞůŽŶŐŝŶŐƚŽdLJůĞƌŽƌdLJůĞƌ͛ƐƉĂƌƚŶĞƌƐ͘dLJůĞƌŝƐƐƵďŵŝƚƚŝŶŐƚŚŝƐƉƌŽƉŽƐĂůŽŶƚŚĞĞdžƉƌĞƐƐ ĐŽŶĚŝƚŝŽŶƚŚĂƚƚŚĞĨŽůůŽǁŝŶŐƉŽƌƚŝŽŶƐǁŝůůŶŽƚďĞĚƵƉůŝĐĂƚĞĚ͕ĚŝƐĐůŽƐĞĚ͕ŽƌŽƚŚĞƌǁŝƐĞŵĂĚĞĂǀĂŝůĂďůĞ͕ĞdžĐĞƉƚĨŽƌ ŝŶƚĞƌŶĂůĞǀĂůƵĂƚŝŽŶƉƵƌƉŽƐĞƐ͗ xZĞƐƉŽŶƐĞƚŽƚŚĞ&ƵŶĐƚŝŽŶĂůZĞƋƵŝƌĞŵĞŶƚƐ͕Žƌ͞ŚĞĐŬůŝƐƚ͟ x>ŝŶĞͲŝƚĞŵƉƌŝĐŝŶŐ;ƚŽƚĂůƉƌŽƉŽƐĞĚĐŽŶƚƌĂĐƚĂŵŽƵŶƚŵĂLJďĞĚŝƐĐůŽƐĞĚͿ x^ĐƌĞĞŶƐŚŽƚƐ͕ŝĨĂŶLJ xĞƚĂŝůĞĚŝŶĨŽƌŵĂƚŝŽŶƌĞŐĂƌĚŝŶŐĐƵƌƌĞŶƚĐƵƐƚŽŵĞƌƐ xĞƚĂŝůĞĚĞŵƉůŽLJĞĞƌĞƐƵŵĞƐͬsƐ xƵƐƚŽŵŝnjĞĚ^ƚĂƚĞŵĞŶƚŽĨtŽƌŬͬ/ŵƉůĞŵĞŶƚĂƚŝŽŶWůĂŶ dŽƚŚĞĞdžƚĞŶƚĚŝƐĐůŽƐƵƌĞŽĨƚŚŽƐĞƉŽƌƚŝŽŶƐŝƐƌĞƋƵĞƐƚĞĚŽƌŽƌĚĞƌĞĚ͕dLJůĞƌƌĞƋƵŝƌĞƐǁƌŝƚƚĞŶŶŽƚŝĐĞŽĨƚŚĞ ƌĞƋƵĞƐƚŽƌŽƌĚĞƌ͘/ĨĚŝƐĐůŽƐƵƌĞŝƐƐƵďũĞĐƚƚŽdLJůĞƌ͛ƐƉĞƌŵŝƐƐŝŽŶ͕dLJůĞƌǁŝůůŐƌĂŶƚƚŚĂƚƉĞƌŵŝƐƐŝŽŶŝŶǁƌŝƚŝŶŐ͕ŝŶ dLJůĞƌ͛ƐƐŽůĞĚŝƐĐƌĞƚŝŽŶ͘/ĨĚŝƐĐůŽƐƵƌĞŝƐƐƵďũĞĐƚƚŽĂĐŽƵƌƚŽƌŽƚŚĞƌůĞŐĂůŽƌĚĞƌ͕dLJůĞƌǁŝůůƚĂŬĞǁŚĂƚĞǀĞƌĂĐƚŝŽŶ dLJůĞƌĚĞĞŵƐŶĞĐĞƐƐĂƌLJƚŽƉƌŽƚĞĐƚŝƚƐƉƌŽƉƌŝĞƚĂƌLJĂŶĚĐŽŶĨŝĚĞŶƚŝĂůŝŶĨŽƌŵĂƚŝŽŶĂŶĚǁŝůůĂƐƐƵŵĞĂůů ƌĞƐƉŽŶƐŝďŝůŝƚLJĂŶĚůŝĂďŝůŝƚLJĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĂƚĂĐƚŝŽŶ͘ dLJůĞƌĂŐƌĞĞƐƚŚĂƚĂŶLJƉŽƌƚŝŽŶƐŶŽƚůŝƐƚĞĚĂďŽǀĞĂŶĚŵĂƌŬĞĚĂĐĐŽƌĚŝŶŐůLJĂƌĞƚŽďĞŵĂĚĞĂǀĂŝůĂďůĞĨŽƌƉƵďůŝĐ ĚŝƐĐůŽƐƵƌĞ͕ĂƐƌĞƋƵŝƌĞĚƵŶĚĞƌĂƉƉůŝĐĂďůĞƉƵďůŝĐƌĞĐŽƌĚƐůĂǁƐĂŶĚƉƌŽĐƵƌĞŵĞŶƚƉƌŽĐĞƐƐĞƐ͘ dƌĂĚĞŵĂƌŬƐŝƐĐůĂŝŵĞƌ ĞĐĂƵƐĞŽĨƚŚĞŶĂƚƵƌĞŽĨƚŚŝƐƉƌŽƉŽƐĂů͕ƚŚŝƌĚͲƉĂƌƚLJŚĂƌĚǁĂƌĞĂŶĚƐŽĨƚǁĂƌĞƉƌŽĚƵĐƚƐŵĂLJďĞŵĞŶƚŝŽŶĞĚďLJ ŶĂŵĞ͘dŚĞƐĞŶĂŵĞƐŵĂLJďĞƚƌĂĚĞŵĂƌŬĞĚďLJƚŚĞĐŽŵƉĂŶŝĞƐƚŚĂƚŵĂŶƵĨĂĐƚƵƌĞƚŚĞƉƌŽĚƵĐƚƐ͘/ƚŝƐŶŽƚdLJůĞƌ͛Ɛ ŝŶƚĞŶƚƚŽĐůĂŝŵƚŚĞƐĞŶĂŵĞƐŽƌƚƌĂĚĞŵĂƌŬƐĂƐŽƵƌŽǁŶ͘ dŚƵƌƐĚĂLJ͕&ĞďƌƵĂƌLJϭϴ͕ϮϬϮϭ ŽǀĞƌ>ĞƚƚĞƌ ŝƚLJŽĨŽƌĐŽƌĂŶ :ĞƐƐŝĐĂĞŝƐĞ ĚŵŝŶŝƐƚƌĂƚŝǀĞ^ĞƌǀŝĐĞƐŝƌĞĐƚŽƌ ϴϮϬϬŽƵŶƚLJZŽĂĚϭϭϲ ŽƌĐŽƌĂŶ͕DEϱϱϯϰϬ ĞĂƌ:ĞƐƐŝĐĂĞŝƐĞ͕ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘;dLJůĞƌͿŝƐƉůĞĂƐĞĚƚŽƐƵďŵŝƚƚŚĞĞŶĐůŽƐĞĚĨĞĞƉƌŽƉŽƐĂůĨŽƌLJŽƵƌĞǀĂůƵĂƚŝŽŶĂŶĚ ĐŽŶƐŝĚĞƌĂƚŝŽŶŝŶƌĞƐƉŽŶƐĞƚŽƚŚĞŝƚLJŽĨŽƌĐŽƌĂŶ͛ƐZ&WŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵWƌŝĐĞ WƌŽƉŽƐĂů͘ƐƌĞƋƵĞƐƚĞĚ͕ǁĞŚĂǀĞŝŶĐůƵĚĞĚƉƌŝĐŝŶŐĂƐĂƐƉĞƌĂƚĞĚŽĐƵŵĞŶƚƚŽƚŚŝƐƌĞƐƉŽŶƐĞ͘ dLJůĞƌŚĂƐĐĂƌĞĨƵůůLJƌĞǀŝĞǁĞĚƚŚĞƉƌŽũĞĐƚŐŽĂůƐ͕ƐƚĂƚĞĚŽďũĞĐƚŝǀĞƐ͕ĂŶĚƌĞƋƵŝƌĞŵĞŶƚƐĚĞĨŝŶĞĚǁŝƚŚŝŶƚŚĞZ&W͕ ĂŶĚǁĞĂƌĞĞdžĐŝƚĞĚĂďŽƵƚƚŚĞŽƉƉŽƌƚƵŶŝƚLJƚŽǁŽƌŬǁŝƚŚƚŚĞŝƚLJŽŶƚŚŝƐƉƌŽũĞĐƚ͘tĞĂƌĞĐŽŶĨŝĚĞŶƚƚŚĂƚdLJůĞƌ͛Ɛ /ŶĐŽĚĞƐŽůƵƚŝŽŶďƌŝŶŐƐƚŚĞƌŝŐŚƚƐƚĂŶĚĂƌĚŽĨƌĞƐŽƵƌĐĞƐ͕ĞdžƉĞƌŝĞŶĐĞ͕ĂŶĚƚĞĐŚŶŽůŽŐLJƚŽĨŽƐƚĞƌĂŶĞŶǀŝƌŽŶŵĞŶƚ ĨŽƌƐƵĐĐĞƐƐ͘ dŚŝƐĨĞĞƉƌŽƉŽƐĂůŝƐǀĂůŝĚĂŶĚďŝŶĚŝŶŐĨŽƌϭϮϬĚĂLJƐĨŽůůŽǁŝŶŐƚŚĞZ&WĚƵĞĚĂƚĞ͘tŝƚŚƚŚĞĞdžĐĞƉƚŝŽŶŽĨǁŚĂƚŝƐ ƐĞƚĨŽƌƚŚŝŶƚŚŝƐƉƌŽƉŽƐĂů͕ƚŚŝƐƉƌŽƉŽƐĂůĐĂŶďĞƌĞůĞĂƐĞĚŝŶƉĂƌƚŽƌŝŶƚŽƚĂůĂƐƉƵďůŝĐŝŶĨŽƌŵĂƚŝŽŶŝŶĂĐĐŽƌĚĂŶĐĞ ǁŝƚŚƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚĞůĂǁƐĐŽǀĞƌŝŶŐƐĂŵĞ͘ dLJůĞƌĐŽŶƚŝŶƵĂůůLJƐĞĞŬƐŽƵƚďƵƐŝŶĞƐƐƉĂƌƚŶĞƌƐƚŽƐŚĂƌĞŝŶŽƵƌƐƵĐĐĞƐƐƌĂƚŚĞƌƚŚĂŶũƵƐƚĐƵƐƚŽŵĞƌƐ͘KƵƌƉĂƌƚŶĞƌƐ͕ ůŝŬĞLJŽƵ͕ƵŶĚĞƌƐƚĂŶĚƚŚĞĚŝĨĨĞƌĞŶĐĞďĞƚǁĞĞŶǀĂůƵĞĂŶĚĐŽƐƚĂŶĚǁĂŶƚǁŚĂƚŝƐďĞƐƚĨŽƌƚŚĞŝƌĐŽŵŵƵŶŝƚŝĞƐ͘/Ĩ LJŽƵŚĂǀĞĂŶLJƋƵĞƐƚŝŽŶƐ͕͕ƉůĞĂƐĞĐŽŶƚĂĐƚŽĚLJ'ƵŶƐƚĞŶƐŽŶ͕LJŽƵƌĐĐŽƵŶƚdžĞĐƵƚŝǀĞĂƚϮϭϰ͘ϱϳϴ͘ϱϭϲϲŽƌǀŝĂ ĞŵĂŝůĂƚŽĚLJ͘'ƵŶƐƚĞŶƐŽŶΛƚLJůĞƌƚĞĐŚ͘ĐŽŵĨŽƌŵŽƌĞŝŶĨŽƌŵĂƚŝŽŶ͘ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐĂƵƚŚŽƌŝnjĞƐƚŚĞƐŝŐŶĂƚŽƌLJŽĨƚŚŝƐůĞƚƚĞƌƚŽŶĞŐŽƚŝĂƚĞĂŶĚďŝŶĚdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐƚŽƚŚŝƐ ƌĞƐƉŽŶƐĞ͘ ZĞƐƉĞĐƚĨƵůůLJƐƵďŵŝƚƚĞĚ͕ ĂŶĞtŽŵďůĞ WƌĞƐŝĚĞŶƚʹ>ŽĐĂů'ŽǀĞƌŶŵĞŶƚŝǀŝƐŝŽŶ͕dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ dLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ŝƐĂƉƵďůŝĐůLJƚƌĂĚĞĚĐŽƌƉŽƌĂƚŝŽŶ;Ez^͗dz>Ϳ /E͗ϳϱͲϮϯϬϯϵϮϬ ϱϱϭϵϱϯƌĚ^ƚƌĞĞƚ >ƵďďŽĐŬ͕dyϳϵϰϭϰ W͗ϴϬϬ͘ϲϰϲ͘Ϯϲϯϯ &͗ϴϬϲ͘ϳϵϳ͘ϰϴϰϵ ǁǁǁ͘ƚLJůĞƌƚĞĐŚ͘ĐŽŵ KE&/Ed/>ΘWZKWZ/dZz WƌŝĐĞWƌŽƉŽƐĂů ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵWƌŝĐĞWƌŽƉŽƐĂůWĂŐĞϳ WƌŝĐĞWƌŽƉŽƐĂů EŽƚĞƐ dŚĞĨŽůůŽǁŝŶŐWƌŝĐĞWƌŽƉŽƐĂůŝƐďĂƐĞĚŽŶƚŚĞƐƚĂƚĞĚƌĞƋƵŝƌĞŵĞŶƚƐƉƌŽǀŝĚĞĚďLJŝƚLJŽĨŽƌĐŽƌĂŶŝŶƚŚŝƐZ&W͘/ƚ ŝŶĐůƵĚĞƐdLJůĞƌƐŽĨƚǁĂƌĞůŝĐĞŶƐĞĨĞĞƐ͕ĞƐƚŝŵĂƚĞĚƐĞƌǀŝĐĞƐ͕ƉƌŽũĞĐƚŵĂŶĂŐĞŵĞŶƚ͕ĂŶĚĐŽŶǀĞƌƐŝŽŶĐŽƐƚƐ͘ ŶLJƐƚĂƚĞĚĐŽŶǀĞƌƐŝŽŶƉƌŝĐĞƐŵĂLJǀĂƌLJĚĞƉĞŶĚŝŶŐŽŶĐŽŽƉĞƌĂƚŝŽŶŽĨƉƌĞǀŝŽƵƐǀĞŶĚŽƌĂŶĚͬŽƌƚŚĞĐŽŵƉůĞdžŝƚLJ ŽĨĐŽŶǀĞƌƚŝŶŐƚŚĞĚĂƚĂ͘ dŚĞůŝĐĞŶƐĞĨĞĞƐůŝƐƚĞĚŝŶƚŚŝƐŽƐƚ^ƵŵŵĂƌLJĚŽŶŽƚŝŶĐůƵĚĞĂŶLJƚĂdžŽƌŽƚŚĞƌŐŽǀĞƌŶŵĞŶƚĂůŝŵƉŽƐŝƚŝŽŶƐ ŝŶĐůƵĚŝŶŐ͕ǁŝƚŚŽƵƚůŝŵŝƚĂƚŝŽŶ͕ƐĂůĞƐ͕ƵƐĞ͕ŽƌĞdžĐŝƐĞƚĂdž͘ůůĂƉƉůŝĐĂďůĞƐĂůĞƐƚĂdž͕ƵƐĞƚĂdž͕ŽƌĞdžĐŝƐĞƚĂdžƐŚĂůůďĞ ƉĂŝĚďLJĐůŝĞŶƚĂŶĚƐŚĂůůďĞƉĂŝĚŽǀĞƌƚŽƚŚĞƉƌŽƉĞƌĂƵƚŚŽƌŝƚŝĞƐďLJĐůŝĞŶƚŽƌƌĞŝŵďƵƌƐĞĚďLJĐůŝĞŶƚƚŽdLJůĞƌ dĞĐŚŶŽůŽŐLJŽŶĚĞŵĂŶĚŝŶƚŚĞĞǀĞŶƚƚŚĂƚdLJůĞƌdĞĐŚŶŽůŽŐLJŝƐƌĞƐƉŽŶƐŝďůĞŽƌĚĞŵĂŶĚŝƐŵĂĚĞŽŶdLJůĞƌ dĞĐŚŶŽůŽŐLJĨŽƌƚŚĞƉĂLJŵĞŶƚƚŚĞƌĞŽĨ͘/ĨƚĂdžͲĞdžĞŵƉƚ͕ĐůŝĞŶƚŵƵƐƚƉƌŽǀŝĚĞdLJůĞƌdĞĐŚŶŽůŽŐLJǁŝƚŚĐůŝĞŶƚΖƐƚĂdžͲ ĞdžĞŵƉƚŶƵŵďĞƌŽƌĨŽƌŵ͘ dLJůĞƌ^ĂĂ^ tŝƚŚƚŚĞdLJůĞƌ^ŽĨƚǁĂƌĞĂƐĂ^ĞƌǀŝĐĞ;^ĂĂ^ͿƐŽůƵƚŝŽŶ͕ǁĞǁŝůůŚŽƐƚĂŶĚŵĂŶĂŐĞƚŚĞ/ŶĐŽĚĞĂƉƉůŝĐĂƚŝŽŶƐĨƌŽŵ ŽƵƌĨĂĐŝůŝƚŝĞƐ͘ůůŽĨLJŽƵƌdLJůĞƌĂƉƉůŝĐĂƚŝŽŶƐĂƌĞŚŽƐƚĞĚ͕ŵĂŝŶƚĂŝŶĞĚ͕ƐƵƉƉŽƌƚĞĚĂŶĚĂĚŵŝŶŝƐƚĞƌĞĚŽŶĂƉƌŝǀĂƚĞ ĐůŽƵĚďLJdLJůĞƌƉĞƌƐŽŶŶĞůĂƚŽƵƌzĂƌŵŽƵƚŚ͕DĂŝŶĞ͕ŽƌĂůůĂƐ͕dĞdžĂƐ͕ĨĂĐŝůŝƚŝĞƐ͘tĞŵĂŶĂŐĞĂůůƌĞŐƵůĂƌ ĂĚŵŝŶŝƐƚƌĂƚŝǀĞƚĂƐŬƐͶŝŶĐůƵĚŝŶŐŝŶƐƚĂůůĂƚŝŽŶ͕ƵƉŐƌĂĚĞƐ͕ƐƵƉƉŽƌƚĂŶĚĨŝůĞŵĂŝŶƚĞŶĂŶĐĞͶĂŶĚĞŶƐƵƌĞĂůůLJŽƵƌ ĚĂƚĂďĂƐĞƐ͕ĚĂƚĂďĂƐĞƐĞƌǀĞƌƐ͕ŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵ͕ĂƉƉůŝĐĂƚŝŽŶĨŝůĞƐĂŶĚŝŵĂŐĞĨŝůĞƐĂƌĞƵƉƚŽĚĂƚĞĂŶĚƐĞĐƵƌĞ͘ hƐĞƌƐƐŝŵƉůLJĂĐĐĞƐƐĐŽŵƉƌĞŚĞŶƐŝǀĞdLJůĞƌĂƉƉůŝĐĂƚŝŽŶƐĂŶĚĚĂƚĂƚŚƌŽƵŐŚĂƐĞĐƵƌĞtĞďŝŶƚĞƌĨĂĐĞƚŚĂƚƚƌĂŶƐŵŝƚƐ ĞŶĐƌLJƉƚĞĚĚĂƚĂďĞƚǁĞĞŶĞĂĐŚĐůŝĞŶƚǁŽƌŬƐƚĂƚŝŽŶĂŶĚŽƵƌĚĞĚŝĐĂƚĞĚƐĞƌǀĞƌƐ͘>ŽĐĂůŐŽǀĞƌŶŵĞŶƚƐĂŶĚƐĐŚŽŽůƐ ŽĨĂůůƐŝnjĞƐĐĂŶĞĂƐŝůLJĞŵƉůŽLJƚŚŝƐƐƚƌĞĂŵůŝŶĞĚƐLJƐƚĞŵ͕ƚĂŬŝŶŐĂĚǀĂŶƚĂŐĞŽĨĂƉƌŽǀĞŶƉƌŽĚƵĐƚĂŶĚĚŽŝŶŐŵŽƌĞ ǁŝƚŚůĞƐƐ͘EŽŚĞĂǀLJƵƉͲĨƌŽŶƚĨĞĞƐ͕ŶŽĚĞĚŝĐĂƚĞĚ/dƐƚĂĨĨ͕ŶŽŵĂŝŶƚĞŶĂŶĐĞƌĞƋƵŝƌĞĚ͘/ƚ͛ƐƐĂĨĞ͕ƌĞůŝĂďůĞ͕ ĂĨĨŽƌĚĂďůĞĂŶĚĞĂƐLJƚŽƵƐĞ͘ DĂŶĂŐĞĚ,ŽƐƚĞĚ^ŽůƵƚŝŽŶ tŝƚŚdLJůĞƌ͛ƐDĂŶĂŐĞĚ,ŽƐƚŝŶŐ^ŽůƵƚŝŽŶ͕ǁĞǁŝůůŚŽƐƚĂŶĚŵĂŶĂŐĞLJŽƵƌdLJůĞƌƐŽĨƚǁĂƌĞĂƉƉůŝĐĂƚŝŽŶƐĨƌŽŵŽƵƌ ĨĂĐŝůŝƚŝĞƐ͘tĞǁŝůůƉƌŽǀŝĚĞƚŚĞŽŶŐŽŝŶŐƐƵƉƉŽƌƚ͕ŵĂŝŶƚĞŶĂŶĐĞ͕ĂŶĚƵƉŐƌĂĚĞƐŽĨƚŚĞĂƉƉůŝĐĂƚŝŽŶƐ͕ŚĂƌĚǁĂƌĞ͕ ĂŶĚŽƉĞƌĂƚŝŶŐƐLJƐƚĞŵƐ͘ tŝƚŚƚŚŝƐƐŽůƵƚŝŽŶLJŽƵƌĞĐĞŝǀĞĐůĞĂƌ͕ĐŽŶĐŝƐĞĚŽĐƵŵĞŶƚĂƚŝŽŶ͕ĚĞĨŝŶŝŶŐĂůůĂƐƉĞĐƚƐŽĨƚŚĞƌĞůĂƚŝŽŶƐŚŝƉ͘zŽƵǁŝůů ƌĞĐĞŝǀĞĂŽŶƚƌĂĐƚĂŶĚ^ĞƌǀŝĐĞ>ĞǀĞůŐƌĞĞŵĞŶƚƐƚĂƚŝŶŐŵĞĂƐƵƌĂďůĞĞdžƉĞĐƚĂƚŝŽŶƐŽĨƉĞƌĨŽƌŵĂŶĐĞ͕ĂŶĚƚŚĞ ĨŽůůŽǁŝŶŐďĞŶĞĨŝƚƐ͗ xǀĂŝůĂďŝůŝƚLJʹǀĂŝůĂďůĞϮϰdžϳdžϯϲϱ͕ƌĞŵŽƚĞĂĐĐĞƐƐ xĂƐĞŽĨ/ŵƉůĞŵĞŶƚĂƚŝŽŶʹŽƐƚĞĨĨĞĐƚŝǀĞĂŶĚƐĐĂůĂďůĞǁĂLJƚŽĚĞůŝǀĞƌĂƉƉůŝĐĂƚŝŽŶƐĂŶĚƐĞƌǀŝĐĞƐŝŶĂ ƚŝŵĞůLJŵĂŶŶĞƌ xWƌĞĚŝĐƚĂďůĞŽƐƚƐʹůŝŵŝŶĂƚĞďŝŐƵƉͲĨƌŽŶƚĐŽƐƚƐƚŽƵƉŐƌĂĚĞĂŶĚƵƉĚĂƚĞŚĂƌĚǁĂƌĞŶĞĞĚƐ xŝƐĂƐƚĞƌZĞĐŽǀĞƌLJʹƵŝůƚͲŝŶĚŝƐĂƐƚĞƌƌĞĐŽǀĞƌLJͬďƵƐŝŶĞƐƐĐŽŶƚŝŶƵŝƚLJ ƐĐƌŽǁͲ^ŽƵƌĐĞŽĚĞ dLJůĞƌŚĂƐĞƐƚĂďůŝƐŚĞĚĂƌĞůĂƚŝŽŶƐŚŝƉǁŝƚŚĂƚŚŝƌĚƉĂƌƚLJĞƐĐƌŽǁĐŽŵƉĂŶLJ͕/ƌŽŶDŽƵŶƚĂŝŶƐĐƌŽǁ^ĞƌǀŝĐĞƐ͕ǁŚŽ ĐĂŶƐƚŽƌĞ͕ŵĂŝŶƚĂŝŶ͕ĂŶĚƵƉĚĂƚĞƚŚĞdLJůĞƌƐŽƵƌĐĞĐŽĚĞ͘hŶĚĞƌƐƉĞĐŝĨŝĐĐŽŶĚŝƚŝŽŶƐŽƌƚƌŝŐŐĞƌƐƐƉĞůůĞĚŽƵƚŝŶƚŚĞ ƐŽƵƌĐĞͲĐŽĚĞĂŐƌĞĞŵĞŶƚ͕ƚŚĞĞƐĐƌŽǁĐŽŵƉĂŶLJĐĂŶƉƌŽǀŝĚĞƚŚĞdLJůĞƌƐŽƵƌĐĞͲĐŽĚĞĚŝƌĞĐƚůLJƚŽƚŚĞŝƚLJŽĨ ŽƌĐŽƌĂŶ͘dŚĞĐŽƐƚĨŽƌƚŚŝƐŽƉƚŝŽŶĂůƐĞƌǀŝĐĞŝƐĂΨϭϱϬϬĨĞĞ͕ƉůƵƐΨϭϱϬϬĂŶŶƵĂůŵĂŝŶƚĞŶĂŶĐĞ͘ KE&/Ed/>ΘWZKWZ/dZz WƌŝĐĞWƌŽƉŽƐĂů ŝƚLJŽĨŽƌĐŽƌĂŶdLJůĞƌdĞĐŚŶŽůŽŐŝĞƐ͕/ŶĐ͘ ŶƚĞƌƉƌŝƐĞZĞƐŽƵƌĐĞWůĂŶŶŝŶŐ;ZWͿ^LJƐƚĞŵWƌŝĐĞWƌŽƉŽƐĂůWĂŐĞϴ ůŝĞŶƚƐŚĂǀĞƚŚĞĂďŝůŝƚLJƚŽĞŶƌŽůůŝŶƚŚŝƐƉƌŽŐƌĂŵĂƚĂŶLJƚŝŵĞ;dŚŝƐŝƐĂŶŽƉƚŝŽŶĂůƐĞƌǀŝĐĞĂŶĚŝƐŶŶŽƚŝŶĐůƵĚĞĚŝŶ ŽƵƌ/ŶǀĞƐƚŵĞŶƚ^ƵŵŵĂƌLJ͘Ϳ ͘ϭϰWƌŝĐŝŶŐ^ƵŵŵĂƌLJʹĞƚĂŝůƐ͘ůůŽƐƚƐʹZĞƋƵŝƌĞĚDŽĚƵůĞƐ͘ xZĞƋƵŝƌĞĚDŽĚƵůĞxEŽƚĞƐ x ŽŵŵĞŶƚƐ xŽƌĞ&ŝŶĂŶĐŝĂůƐxϯĐƵƌƌĞŶƚůLJǁŝůůǁĂŶƚ ĂĚĚŝƚŝŽŶĂůƵƐĞƌƐĨŽƌŐƌŽǁƚŚ xZĞŵŽƚĞĂĐĐĞƐƐƌĞƋƵŝƌĞĚ /ŶĐůƵĚĞĚŝŶƉƌŽƉŽƐĞĚ ƉƌŝĐŝŶŐ͘ x,ƵŵĂŶZĞƐŽƵƌĐĞƐxϯϬ&d xϭϱƚĞŵƉͬƐĞĂƐŽŶĂů xxϯϲtͲϮ͛Ɛ /ŶĐůƵĚĞĚŝŶƉƌŽƉŽƐĞĚ ƉƌŝĐŝŶŐ͘ xWĂLJƌŽůůxϮϲWĂLJƉĞƌŝŽĚƐ xϯϬ&d xϭϱƚĞŵƉͬƐĞĂƐŽŶĂů /ŶĐůƵĚĞĚŝŶƉƌŽƉŽƐĞĚ ƉƌŝĐŝŶŐ͘ xdŝŵĞŬĞĞƉŝŶŐͬ,ZxϰϱŶĂŵĞĚƵƐĞƌƐ/ŶĐůƵĚĞĚŝŶƉƌŽƉŽƐĞĚ ƉƌŝĐŝŶŐ͘ xĂƐŚƌĞĐĞŝƉƚŝŶŐxϮŶĂŵĞĚƵƐĞƌƐ xϮĐŽůůĞĐƚŝŽŶƉŽŝŶƚƐ /ŶĐůƵĚĞĚŝŶƉƌŽƉŽƐĞĚ ƉƌŝĐŝŶŐ͘ xhƚŝůŝƚLJŝůůŝŶŐxϲϬϬŶĂŵĞĚĂĐĐŽƵŶƚƐ xϭϮďŝůůŝŶŐĐLJĐůĞƐ /ŶĐůƵĚĞĚŝŶƉƌŽƉŽƐĞĚ ƉƌŝĐŝŶŐ͘ xWƌŽũĞĐƚͬ'ƌĂŶƚĐĐŽƵŶƚŝŶŐxϲŶĂŵĞĚƉƌŽũĞĐƚƐ xϰŶĂŵĞĚŐƌĂŶƚƐ xϮŶĂŵĞĚƵƐĞƌƐ /ŶĐůƵĚĞĚŝŶƉƌŽƉŽƐĞĚ ƉƌŝĐŝŶŐ͘ x&ŝdžĞĚƐƐĞƚƐxϮϭϮŶĂŵĞĚĂƐƐĞƚƐ xΨϮϳ͕ϱϯϳ͕ϲϭϴƚŽƚĂůĂŵŽƵŶƚŽĨĂƐƐĞƚƐ /ŶĐůƵĚĞĚŝŶƉƌŽƉŽƐĞĚ ƉƌŝĐŝŶŐ͘ x/ŵƉůĞŵĞŶƚĂƚŝŽŶ͗dŽƚĂů ĐŽƐƚĨŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ͕ĚĂƚĂ ĐŽŶǀĞƌƐŝŽŶ͕ƚƌĂŝŶŝŶŐ͕ƌĞƉŽƌƚ ĚĞǀĞůŽƉŵĞŶƚ͕ŝŶƚĞŐƌĂƚŝŽŶ͕ ƚƌĂǀĞů͕ĞƚĐ͘ĨŽƌƌĞƋƵŝƌĞĚ ŵŽĚƵůĞƐ͘ ΨϴϮ͕ϳϯϬ xDĂŝŶƚĞŶĂŶĐĞ͗dŽƚĂů ĐŽƐƚLJĞĂƌƐϭͲϭϬ ΨϯϮϵ͕ϮϰϬ xKƚŚĞƌŽƐƚƐ ΨϴϮ͕ϳϯϬ;ƐĞƌǀŝĐĞƐͿ xdŽƚĂů&ŝƌƐƚzĞĂƌŽƐƚʹ ƌĞƋƵŝƌĞĚŵŽĚƵůĞƐ ΨϯϮ͕ϵϮϰн^ĞƌǀŝĐĞƐďŝůůĞĚ ĂƐŝŶĐƵƌƌĞĚͬǁĞĚĞůŝǀĞƌ xdŽƚĂůdĞŶͲzĞĂƌŽƐƚʹ ƌĞƋƵŝƌĞĚŵŽĚƵůĞƐ ΨϯϮϵ͕ϮϰϬ Quoted By: Cody Gunstenson Quote Expiration: 8/14/2021Quote Name: City of Corcoran - RFP - Financials, Personnel Mgmt, Quote Number: 2021-123285Quote Description: SaaSSales Quotation ForCity of Corcoran 8200 County Road 116 Corcoran , MN 55340-2100 Tyler Software and Related Services - SaaS One Time FeesDescriptionImpl. HoursImpl. Cost#YrsAnnual FeeDiscountNet Annual FeeFinancial Management Suite Core Financials116 $12,180 $10,285 $3,908 $6,377Purchasing20$2,100$3,076$1,169$1,907Fixed Assets 12 $1,260 $1,077 $409 $668Inventory Control 32$3,360$1,945$739$1,206Project Accounting 12 $1,260 $2,312 $879 $1,433Grants Management 8$840$1,029$391$638Personnel Management Suite Personnel Management (Includes Position Budgeting) 92 $9,660 $7,070 $2,687 $4,383Employee Self Service (Employee Portal) 16$1,680$0$0$0ESS Time & Attendance 28 $2,940 $1,243 $622 $621Benefits Enrollment12$1,260$1,650$627$1,023Customer Relationship Management Suite Accounts Receivable 12 $1,260 $1,945 $739 $1,206Utility CIS System120$12,600$6,427$2,442$3,985Cashiering 28 $2,940 $1,929 $733 $1,196EasyPay Online Payment Component 0$0$0$0$0Content/Document Management Suite Laserfiche Output Channel 4 $420 $1,769 $672 $1,097Laserfiche Interface - Financial/Personnel Management 4$420$1,833$697$1,136Laserfiche Interface - CRM 4 $420 $1,833 $697 $1,136Community Development Mobile Inspections0 $0 $1,000 $0 $1,000Permitting 40$4,200$2,894$1,100$1,794Tyler Hosted Applications Utility Billing Online Component 0 $0 $288 $0 $288Notifications for Utility Billing 0$0$0$0$0IVR Solution for Utility Billing 0 $0 $0 $0 $02021-123285 -SaaS CONFIDENTIAL1 of 5 Tyler U 0$0$1,830$0$1,830Incode 10 Contracts Management 20 $2,100 $0 $0 $0Sub-Total: $60,900 $51,435 $18,511 $32,924TOTAL: 580 $60,9005$51,435 $18,511$32,924Other ServicesDescriptionQuantityUnit PriceExtended PriceMaintenanceOnline Application -Set up fee 1 $800 $800 $0Project Management 1$5,000$5,000$0TOTAL: $5,800 $0Conversion ServicesDescriptionHoursUnit PriceProgramming FeeExtended PriceFinancial Management Suite General Ledger Master $1,000$1,000General Ledger History 4$105$500$920Accounts Payable Master 4$105$1,250$1,670Accounts Payable History 4$105$500$920Personnel Management Suite Personnel Management -Payroll Master 4$105$2,000$2,420Personnel Management -Payroll History 4$105$1,000$1,420Customer Relationship Management Suite Utility Billing History 4$105$1,000$1,420Utility Billing Master 12$105$5,000$6,260Total:$16,030Summary One Time Fees Recurring FeesTotal Tyler SaaS $0 $32,924Total Tyler Services $82,730 $0Total Third Party Hardware, Software and Services $0 $0Summary Total $82,730 $32,924 Optional Tyler Software and Related Services - SaaS One Time FeesDescriptionImpl. HoursImpl. Cost#YrsAnnual FeeDiscountNet Annual FeeCustomer Relationship Management Suite Mobile Service Orders 8$840$322 $122$200Smart Meter Portal ( 600 ) 0$0$1,560$0$1,560Tyler Content Manager Tyler Content Manager Standard Edition (TCM SE) 32$3,360$3,501 $1,330$2,171Community Development Permitting Online Component 0$0$1,200 $0$1,200MyCivicMyCivic Citizen Engagement 0$0$2,500 $0$2,500Sub-Total: $4,200 $7,631TOTAL: 40 $4,200 5 $7,6312021-123285 -SaaS CONFIDENTIAL2 of 5 2021-123285 -SaaS CONFIDENTIAL3 of 5 $OOVHUYLFHVTXRWHGKHUHLQDUHDVVXPHGWREHGHOLYHUHGUHPRWHXQOHVVRWKHUZLVHLQGLFDWHG&RUH)LQDQFLDOVLQFOXGHVJHQHUDOOHGJHUEXGJHWSUHSEDQNUHFRQ$3&HOO6HQVHDVWDQGDUGIRUPVSNJRXWSXWGLUHFWRUSRVLWLYHSD\VHFXUHVLJQDWXUHVTW\8WLOLW\&,66\VWHPLQFOXGHVFROOHFWLRQVWD[OLHQSURFHVVDQGLPSRUWXWLOLW\SD\PHQWLPSRUWDVWDQGDUGIRUPVSNJRXWSXWGLUHFWRUDQGRQH8WLOLW\KDQGKHOGPHWHUUHDGHULQWHUIDFH&DVKLHULQJVXSSRUWVFUHGLWGHELWFDUGVYLD(76LQFOXGHV3&,&RPSOLDQWDFDVKFROOHFWLRQLQWHUIDFHDFDVKLHULQJUHFHLSWLPSRUW,QFRGH8WLOLW\%LOOLQJ2QOLQH&RPSRQHQWGLVSOD\VWKHFXUUHQWVWDWXVODWHFXWRIIHWFWKHDFWLRQQHHGHGWRDYRLGSHQDOW\FXUUHQWEDODQFHGHSRVLWVRQILOHRSWLRQDOODVWSD\PHQWGDWHODVWSD\PHQWDPRXQWSD\PHQWDUUDQJHPHQWVRQILOHODVWELOODPRXQWODVWELOOGDWHELOOGXHGDWHFRQWUDFWVRQILOHDQGVWDWXVWUDQVDFWLRQKLVWRU\RQOLQHSD\PHQWV3D\PHQWSDFNHWLVFUHDWHGWREHLPSRUWHGWRXWLOLW\V\VWHP$GGUHVVLQIRUPDWLRQLQFOXGHVOHJDOGHVFULSWLRQSUHFLQFWVFKRROGLVWULFWDQGVHUYLFHVDWDGGUHVVVXEMHFWWRGDWDDYDLODELOLW\,QFOXGHVFRQVXPSWLRQKLVWRU\E\VHUYLFHLQFOXGLQJJUDSKVUHTXHVWIRUVHUYLFHRSWLRQDOLQIRUPDWLRQFKDQJHUHTXHVWRSWLRQDOVHFXULW\66/VHFXUHVRFNHWOD\HU1RWHWKDWWKHFXVWRPHUSD\VIHHSHUWUDQVDFWLRQIRUSD\PHQWRQOLQH1RWLILFDWLRQIRU8WLOLW\%LOOLQJSHUFDOOLQFOXGHV&XVWRPHUQRWLILFDWLRQE\SKRQHFDOOODWHQRWLFHVDQGJHQHUDOQRWLILFDWLRQV&DOOOLVWVDUHDXWRPDWLFDOO\JHQHUDWHGDQGWKHDFFRXQWLVXSGDWHGDIWHUWKHFDOO,WLQFOXGHVDFXVWRPPHVVDJHIRUHDFKFDOOW\SHDQGWKHFDOOPHVVDJHFDQEHLQ(QJOLVKRU6SDQLVK,WJHQHUDWHVUHSRUWVEDVHGRQFDOOUHVXOWV1RWH7KH8WLOLW\ZLOOEHELOOHGDWWKHUDWHVSHFLILHGDERYHIRUDOOWKHFDOOVPDGH7KH8WLOLW\ZLOOEHELOOHGTXDUWHUO\E\7\OHU7HFKQRORJLHVIRUFDOOVFRQGXFWHG*HQHUDO/HGJHUFRQYHUVLRQVLQFOXGH&KDUWRI$FFRXQWVDGGLWLRQDOIHHIRUKLVWRULFDOYLHZV$FFRXQWV3D\DEOHFRQYHUVLRQVLQFOXGH9HQGRU0DVWHU2QO\DGGLWLRQDOIHHIRUKLVWRULFDOYLHZV3HUVRQQHO0DQDJHPHQW3D\UROOFRQYHUVLRQVLQFOXGHHPSOR\HHPDVWHULQIRUPDWLRQ7KLVLQFOXGHVPDVWHUUHFRUGDGGUHVVHVFRQWDFWDQGGHSHQGHQWLQIRUPDWLRQVWDWHDQGIHGHUDOWD[VHWXSGLUHFWGHSRVLWLQIRUPDWLRQDVZHOODVVWDWHVSHFLILFUHWLUHPHQW$GGLWLRQDOIHHIRUKLVWRULFDOYLHZV8WLOLW\%LOOLQJFRQYHUVLRQVLQFOXGHFRQWDFWVSURSHUWLHVDFFRXQWVVHUYLFHPHWHULQIRPHWHULQYHQWRU\WUDQVDFWLRQFRQVXPSWLRQUHDGKLVWRU\PHWHUHGVHUYLFHVQRQPHWHUHGVHUYLFH$GGLWLRQDOIHHIRUKLVWRULFDOYLHZV,QFRGH,956ROXWLRQIRU8WLOLW\%LOOLQJ7KHSD\PHQWSDFNHWLVFUHDWHGLQFHQWUDOL]HGFDVKFROOHFWLRQV7KH,95V\VWHPJLYHVWKHFXVWRPHUDQDFFRXQWEDODQFHWKHFXVWRPHUPDNHVWKHSD\PHQWE\SKRQHDQGWKHDFFRXQWPDQDJHULVXSGDWHGZLWKWKHSD\PHQWUHFRUG127(7KHUHLVDSHUWUDQVDFWLRQIHHDVVRFLDWHGZLWKWKH,95WKDWZLOOEHSDLGE\FOLHQWXQOHVV7\OHULVLQVWUXFWHGE\WKHFOLHQWWRSDVVDORQJWRWKHXVHUDWWLPHRISD\PHQW6PDUW0HWHU3RUWDOJLYHWKHDELOLW\WRYLHZ$0,GDWDLQDFKDUWIRUPWKUX%LOOLQJRQOLQH3D\PHQWV,WSURYLGHVFLWL]HQWUDQVSDUHQF\WRWUDFNDQGSURDFWLYHO\PDQDJHFRQVXPSWLRQDQGFLWL]HQVFDQRSWLQWRUHFHLYHFRQVXPSWLRQQRWLILFDWLRQVDQGOHDNDOHUWV1RWH1RWLILFDWLRQVDUHELOOHGRXWTXDUWHUO\DVLQFXUUHGDWSHUFDOORUWH[W3HUPLWWLQJ2QOLQHGLVSOD\VSURMHFWVWDWXVSURMHFWVIRUSD\PHQWDQGVFKHGXOHUHVFKHGXOHLQVSHFWLRQV,WKDVVHFXULW\66/6HFXUHVRFNHW/D\HUSD\PHQWSURFHVVLQJFUHGLWFDUGDQGWKHSD\PHQWSDFNHWLVFUHDWHGWREHLPSRUWHGWRWKH3HUPLWWLQJ6\VWHP1RWHWKDWWKHFXVWRPHUSD\VIHHSHUWUDQVDFWLRQIRUSD\PHQWRQOLQH&RPPHQWV2021-123285 -SaaS CONFIDENTIAL4 of 5 (DV\3D\2QOLQH3D\PHQW&RPSRQHQWDOORZVFOLHQWVWRVHWXSSD\PHQWIRUPVIRUPLVFSD\PHQWVZLWKDIL[HGFDOFXODWHGRURSHQSD\PHQWDPRXQW7KHSD\PHQWVDUHVHQWIURPWKHZHEVLWHWRWKHFDVKFROOHFWLRQ&DVKLHULQJDSSOLFDWLRQDQGWKHQSRVWHGWRWKH*/DSSOLFDWLRQ127(7KHUHLVDSHUWUDQVDFWLRQIHHDVVRFLDWHGZLWKWKH(DV\3D\WKDWZLOOEHSDLGE\FOLHQWXQOHVV7\OHULVLQVWUXFWHGE\WKHFOLHQWWRSDVVDORQJWRWKHXVHUDWWLPHRISD\PHQW&RPPHQWV2021-123285 -SaaS CONFIDENTIAL5 of 5 Request for Proposal City of Corcoran Hennepin County, Minnesota Enterprise Resource Planning (ERP) System Submitted by: BS&A Software 14965 Abbey Lane Bath, MI 48808 (855) 272-7638 Dan J. Burns, CPA Account Executive dburns@bsasoftware.com Closing Date: February 18, 2021 2 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 1.0 Executive Summary and Introductory Materials February 18, 2021 City of Corcoran 8200 County Road 116 Corcoran, MN 55340 We are pleased to respond to the City’s Request For Proposal for ERP System. For nearly 25 years, BS&A Software has provided software solutions for local and county government. Governmental software is not a side-light or specialty product for us – governmental software is our sole focus. Our success is evidenced with over 15,000 installations of our various software applications for customers ranging in population from 1,000 to over 1,000,000. Currently, there are more than 1,000 installations of our Financial Management, Utility Billin g and Community Development Software Systems spread throughout 16 states. The following proposal outlines our company stability and history, technology strategy, superior products, and our unparalleled implementation and support services. We look forward to your positive consideration of our proposed solution. Please do not hesitate to contact us with any questions you may have following the review of this proposal. I will be pleased to assist you, and can be reached at 855-272-7638. Sincerely, Dan J. Burns, CPA Account Executive PH: 517.641.8900 FX: 517.641.8960 dburns@bsasoftware.com 14965 Abbey Lane Bath, MI 48808 Toll Free: (855) BSA-SOFT P: (517) 641-8900 F: (517) 641-8960 www.bsasoftware.com 3 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Table of Contents Section Number Section Title Page 1.0 Executive Summary and Introductory Materials 4 2.0 Scope of Services 8 3.0 Functional Requirements 33 4.0 Implementation Plan 39 5.0 Ongoing Support and Hosting Services 56 6.0 Exceptions to the RFP 61 7.0 Deliverables and Project Outcomes 62 8.0 Sample Documents 70 9.0 Price Proposal (Under Separate Cover) 84 10.0 Additional Information 85 4 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 1.0 Executive Summary and Introductory Materials Headquarters: Primary Contact Secondary Contact: BS&A Software, Inc. Dan J. Burns, CPA Jason Hafner, CPA 14965 Abbey Lane Account Executive Director of Project Management Bath, MI 48808 PH: 517-641-8900 PH: 517-641-8900 855-272-7638 Dburns@bsasoftware.com JHafner@bsasoftware.com Overview BS&A Software is pleased to submit our proposal for your review. We have over 1,000 customers on our Financial Management, Payroll, Utility Billing, and Community Development software. These customers range from small municipalities with hundreds of people to large municipalities that have over 100,000 residents. We obtained these customers by continually refining both our software and our processes, so that we deliver exactly what we promise, along with unparalleled support. All of our programs are built with the Microsoft .NET software development platform using the latest tools available. Our software uses Microsoft SQL as the database engine. BS&A programs currently provide all of the major functions requested. We are proposing a locally-hosted solution, with an unlimited number of concurrent users. BS&A Company Benefits For 25 years, our trademark has been to provide great software and world-class customer service. You will quickly learn why BS&A has grown so positively through the worst of economic time s; we are first and foremost concerned with long-term customer relationships. Customer Support & Satisfaction – BS&A believes that customer satisfaction is critical to the long-term success of any company. We are so confident in what our existing customers have to say that we provide a complete client list on our website. Feel free to contact any of our existing customers. If they do not say that we provide the absolute best customer support, choose another vendor. Money Back Guarantee: BS&A is so confident in our ability to provide quality software that we provide you with a guarantee. If you are not satisfied with a BS&A product at any time during the first year, simply return it and we will refund 100% of the price of the software. BS&A Software Benefits BS&A provides a completely integrated suite of Financial Management products that offer the following advantages over other solutions: Site License: As a standard process, BS&A provides each municipality with a site license, whereby they can run our software on an unlimited number of desktops or with an unlimited number of concurrent users. This makes it practical to provide access to BS&A software to as many users and departments as desired without incurring any additional license costs. Data Conversion: BS&A sets the bar in terms of data conversion efficiency, and minimizes efforts on the City’s part. We simply require you to get us data and we take over from there. We are not particular about the format. Whether you choose to convert all of your data o r just the critical components, BS&A will not produce any surprise or additional data conversion fees, unless changes to the scope of the conversions are requested. Integrations: BS&A provides out of the box and user configurable integrations for a large n umber of required systems (Banks, State Government, IRS, Benefit Providers, Purchasing Cards, etc.) We do not charge any extra fees for these integrations and, in most cases, we will create similar integrations at no cost. Project Management: BS&A representatives will deliver the implementation services for all of the proposed applications. BS&A will assume the role of primary contractor and will assume project management responsibilities. Our Project Managers, along with our Implementation & Training staff , have been involved in hundreds of successful projects similar to the City’s. 5 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 E.1 Attachment 1 (RFP Submittal Checklist) Submittal Checklist Section Ite m Submitted B.1 Executive Summary and Introductory Materials X E.1 Attachment 1 (RFP Submittal Checklist) X E.2 Attachment 2 (Signature Page) X E.3 Attachment 3 (Proposer Statement) X B.2 Scope of Services X E.4 Attachment 4 (Scope of Proposal) X E.5 Attachment 5 (Company Background) X E.6 Attachment 6 (Reference Form) X B.3 Functional Requirements X E.13 Attachment 13 (Functional Requirements) X E.7 Attachment 7 (T echnical Specifications) X B.4 Implementation Plan X E.11 Attachment 11 (Conversions) X E.12 Attachment 12 (Staffing) X B.5 Ongoing Support and Hosting Services X E.8 Attachment 8 (Software-as-a-Service/Hosting) X E.9 Attachment 9 (Proposed Service Level Agreement) X E.10 Attachment 10 (Maintenance and Support) X B.6 Exceptions to the RFP X B.7 Deliverables and Project Outcomes X B.8 Sample Documents X B.9 Price Proposal (under separate cover) X E.14 Attachment 14 (Cost) X B.1 Executive Summary and Introductory Materials X 6 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 E.2 Attachment 2 (Signature Page) The undersigned proposer having examined this RFP and having full knowledge of the condition under which the work described herein must be performed, hereby proposes that the proposer will fulfill the obligations contained herein in accordance with all instructions, terms, conditions, and specifications set forth; and that the proposer will furnish all required products/services and pay all incidental costs in strict conformity with these documents, for the stated prices as proposed. Submitting Firm: BS&A Software Address: 14965 Abbey Lane Government: Bath _State: MI Zip: 48808 Authorized Representative (print): Dan J. Burns, CPA Title: Account Executive Authorized Signature: Date: 6/20/2018 Contact Information: Name: Dan J. Burns, CPA Title: Account Executive Address: 14965 Abbey Lane Government: Bath _State: MI Zip: 48808 Email: dburns@bsasoftware.com Phone: 517-641-8900 Cell Phone: (248) 345-8026___________________________ Fax: 517-641-8960 Software Demonstrations / Implementation Interviews Software demonstrations are currently scheduled for the following dates. Please indicate your availability and date preference to provide software demonstrations in the event your proposal is elevated to software demonstrations. Elevated proposers will be notified of the scheduled a demonstrate date when elevated. Week Availability (Y/N) Preference (1,2,3,No Preference) 3/8/2021 – 3/10/2021 Y = 3/9 & 3/10 1 3/11-12 and 3/15/2021 Y = 3/12 2 3/17/2021 – 3/19/2021 Y = 3/17 & 3/18 3 7 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 E.3 Attachment 3 (Proposer Statement) By submitting a response, the respondent acknowledges that he/she has acquainted themselves with the terms, scope, and requirements of the project based on the information contained in this RFP and any addendums. Any failure by the proposer to acquaint themselves with available information will not relieve them from the responsibility for estimating properly the difficulty or cost of successf ully pe rforming the work available. The Government is not responsible for any conclusions or interpretations made by the proposer on the basis of the information made available by the Government. The following addendums have been acknowledged and are included in our response. Proposals that do not acknowledge addendums may be rejected. Addendum# Initials Dan J. Burns, CPA PRINTED NAME OF AUTHORIZED AGENT (TITLE) 2/16/2021 SIGNATURE OF AUTHORIZED AGENT DATE 8 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 2.0 Scope of Services E.4 Attachment 4 (Scope of Proposal) Identify the scope of the proposal and if the proposal contains software and services for each scope option. Scope options are defined in the RFP in section A and Section C. Software and Implementation Services: X Proposed Not Proposed Primary Software Firm BS&A Software Software Product Proposed BS&A Applications Version .NET Primary Implementation Firm BS&A Software Technology Services: Hosting Services Proposed Software as a Service Proposed X Not Proposed Hosting Provider: N/A – Proposed solution to be hosted by the City Ongoing Support X Ongoing Support Provided by Software Vendor Ongoing Support Provided by Implementation Firm Ongoing Support Provided by Third Party Third Party Products/Services Third Party Products/Services Proposed X No Third Party Products/Services Proposed Firm Purpose Firm Purpose Firm Purpose Name of Individual / Firm Submitting Proposal: Dan J. Burns, CPA / BS&A Software Signature of Proposer 9 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Company Background Mission Statement BS&A Software is driven to excellence in all areas of our business by focusing 100% of our efforts on solving our customers’ problems, creating deep customer relationships through unparalleled support, and pursuing continued improvement in our software through innovation and customer feedback. Company History Bellefeuil, Szur & Associates, Inc. was incorporated in the State of Michigan in 1991 with a vision of providing powerful public sector software to local government in Michigan. Our product line has since grown to an extensive list of 32 software products including a Financial Management Suite, a Property-Based Suite, a Community Development Suite, and companion products for local and county government. With the growth in products, our customer base has expanded to include municipalities in 16 states. We focus exclusively on municipal government – all 2,000+ of our clients are local government entities. One hundred percent of our annual revenue is from public sector customers. Currently, we have over 1,000 public sector customers using the proposed applications. BS&A employs over 170 team members involved in software development, IT, sales, implementation, training, and technical support. Over 50% of our staff is dedicated to the development and support of the proposed applications. We are a privately held company, and have never been sold since our incorporation. BS&A Software is an equal opportunity employer. BS&A Software prohibits discrimination based on a person’s race, color, creed, national origin, age, sex, height, weight, religion, marital status, disability, pregnancy, genetic information, or any other characteristic. Strategic Plan BS&A Software has grown to become a well-recognized and successful software company for government in the Midwest. Our continued growth is dependent upon implementing the following: 1) Providing best in class financial management, utility billing, and community development software using leading edge technology at a value price. Our talented software developers and financial management product specialists continuously query the needs of our customers to ascertain where we should be from a technological and feature standpoint. We are committed to accomplishing this goal from a value perspective. Our financial management, utility billing, and community development software suite has numerous high-end features at a value price. 2) Forging a company philosophy that challenges and rewards support technicians and software developers to consistently “go the extra mile” to solve customer issues. Our company culture is completely “externally driven.” Our team members are rewarded based on how well they have created satisfied customers. 3) Creating a “closed loop” feedback system between our customers, technical support, and software developers to allow for a lightning-fast problem resolution process. It is very common for our customers, tech support personnel, and software developers to be on conference calls together so we completely understand the problem at hand. This allows us to quickly and efficiently solve any problems. 4) Continued investment in the development of our financial management, utility billing, and community development products by keeping a vigilant eye on the needs of our customers. 10 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 We are adding new features to our financial management suite of software every single day. The vast majority of these features are requests from our existing customer base. We are second to none when it comes to responsiveness to our customers. 5) Expert and detailed data conversion skills to make the software transition as seamless as possible. We have successfully converted data from a wide variety of software platforms, using a similarly wide variety of databases. 6) Integrity, honesty, and a strong desire to be “extremely easy to do business with.” We pride ourselves on doing what we say we are going to do. We are straight shooters throughout the entire process. We strive to be “easy to do business with” by: a) Not charging support fees for our applications the first year of our agreement (most of our competitors do). b) Holding final invoicing for our software and training services until everything has been delivered. Many times, software implementations take several months to complete. c) Offering a one-year, money back guarantee on our software. If, up to a year after installation, you are not happy with our software and service, you can return the software for a full refund. Customer Retention Our superior software and service have not gone unnoticed in our market. Our track record speaks for itself. Over 2,000 government municipalities have successful implementations of one or more BS&A Software products. BS&A Software has enjoyed unprecedented 99% customer retention over our entire product line for 25 years. Moreover, we have never lost a Financial Management customer to any competitor. Keys to Success All of our team members are trained in providing gre at customer service. In order to ensure a successful system and implementation, we have identified the following objectives and strategies: 1. Implement Operational Improvements: Little is gained by simply purchasing new software and continuing existing practices. BS&A strongly believes that while implementing a new system, numerous opportunities will arise to eliminate operational inefficiencies. Our experienced implementation consultants will work together with your team to identify and incorporate changes within their department that will allow them to “work smarter, not harder.” 2. Focus on Training: A major contributor to the success of a new system is the need for a concerted effort towards initial and on-going training of staff. BS&A uses experienced trainers with accounting degrees, so that all parties are able to effectively utilize the system and features. 3. Fully Integrated Solution: The advantages of having a completely integrated solution are numerous. First, everyday activities like querying and reporting are consistent throughout a range of products. More importantly, though, an integrated solution eliminates manual and redundant data entry. 4. Implementation Experience: A project of this type requires a significant amount of effort to efficiently implement. BS&A has been involved in thousands of implementations, and provides highly experienced project management and technical resources. 5. Support: Delivering the highest quality customer care is essential to your success. We consider it the highest priority of our organization. Our closed-loop feedback system between customers, tech support, and developers delivers lightning-fast resolution to any issue. Continued Growth Our gross sales have increased an average of 20% per year over the last several years. We are a consistently profitable organization that averages 20+% profit margins. We are managed very conservatively and carry no long-term corporate debt. Our gross income was $27 Million in 2017, $28 Million in 2018, and nearly $32 Million in 2019. 11 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Experience Over our 25 years of data conversions and implementation projects, we have learned a number of things to make this process better. Typical examples include: 1. Data Conversion /Review: Mistakes converting data delay projects, cause rework, and negatively affect team member morale. To ensure that there are no data conversion errors, we do two things. First, we review the data with the key stakeholders very early in the process. This provides ample time to correct any data conversion issues. Second, for critical systems like Utility Billing and Payroll, we run at least one, and sometimes two, cycles in parallel. 2. Entity-Wide Buy-In: It is critical to have all parts of the City informed of the plans and get everyone involved in the solution. This can be accomplished by involving as many departments as possible in key activities, such as: Initial Demonstration, Project Kick-off, and Process Review Sessions. 3. Test Data and Environment: When problems with data or processes arise late in the project, it is much more difficult to correct them. We believe that providing access to a test system, with your test data, allows for any potential problems to be identified early enough to be corrected without impacting the project schedule. 4. Integrations: Often times it will be necessary to provide integration to another system that was not planned for. BS&A makes every effort to help identify possible integrations. BS&A also provides numerous “code-less” configurable integrations. These allow for the creation of exports or imports into a wide variety of formats, without writing any software. 5. Hardware: Delays in procuring hardware can have disastrous impacts on the project schedule. In order to head off any delays, we meet with your IT team early on in the project to review planned hardware. If new hardware must be purchased, we will work with you to outline the specifications. 6. Handle the Unexpected: BS&A prides itself on being responsive, both in terms of training and development. If an unforeseen issue arises, our “Never let a customer fail” motto guides our response. We work together to find a way to resolve the problem and keep the project on schedule. This is something that we strongly encourage you to talk about with any of our customers. 12 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 E.5 Attachment 5 (Company Background) Complete one form for each firm included in the proposal. Company Background Company Name: BS&A Software Location of corporate headquarters: Bath, MI Proposer Experience # of years in business: 29 # of years providing systems/services to public sector: 29 Customer Base: # of clients using proposed software/services >1000 # of clients using other similar software/services >1000 Market Fo cus: Identify other industries serviced (other than local government) 100% of our customers are the public sector If not Primary Proposer # of past projects partnering with primary proposer N/A Official Partnership status/certification (if applicable) N/A About the Company Number of Total Employees: 170 Number of Employees Prov iding Implementation Services (if applicable) 44 Number of Employees Supporting Product (Maintenance and Support) (if applicable) 70 Number of Employees Dedicated to Product Development (if applicable) 35 13 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 E.6 Attachment 6 (Reference Form) Please provide at least five (5) references for past projects that include products and services similar to those proposed for this RFP. Please use the following format in submitting references. GENERAL BACKGROUND Name of Client: City of Delano, Wright County MN Project Manager/Contact: Jennifer Willems Title: Finance Assistant Phone: 763.972.0569 E-mail: jwillems@delano.mn.us Software Program/Version: .NET Summary of Project: BS&A Online/Financial Services, BS&A Online/Employee Self -Service, Accounts Payable .NET, Building Department .NET, Cash Receipting .NET, Field Inspection .NET, General Ledger .NET, Human Resources .NET, Miscellaneous Receivables .NET, Payroll .NET, Timesheets .NET Number of Employees: 90 Size of Operating Budget: $16,095,170 PROJECT SCOPE Please indicate (by checking box) functionality installed: ☒ Financials ☒ Budgeting ☒ HR ☒ Payroll TECHNOLOGY INFORMATION Hosted? Yes_____ No X If yes, hosting provider _____________ IMPLEMENTATION INFORMATION Project Duration: 4 months Initial Go-Live: 1/2019 Describe Role on Project: Planned and executed implementation of BS&A Software programs. Including, conversion of existing data to BS&A format; process discovery and counsel on program configuration; performed preliminary and final conversions of data; transferred knowledge to training teams and provided excellent customer service and communication channel for the duration of the project. Project Challenges: Most of the challenges centered around coming up with ways to get their offsite locations access to TS or AP for time entry and approvals. 14 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Major Accomplishments: Accomplishment- We were able to setup the liquor store with a VPN to enter time directly into TS. Users at the Senior Center were able to enter time through BSAOnline-ESS. Accomplishment- Senior Center was previously not using any software for recording receipts. We set them up with a subsidiary database and now they are recording receipts into BS&A. Accomplishment- In PR, we setup their H.S.A. to be processed through a direct deposit NACHA upload. Previously, they manually filled out a template to route these amounts into employee accounts. This saved them a good amount of manual work. Projected was completed on time and on budget. 15 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 GENERAL BACKGROUND Name of Client: City of Brainerd, Crow Wing County MN Project Manager/Contact: Lori Turkowski Title: IT Specialist Phone: 218.828.2307 E-mail: lturkowski@ci.brainerd.mn.us Software Program/Version: .NET Summary of Project: BS&A Online/Financials, BS&A Online/Employee Self Services, BS&A Online/ Community Development, Animal License .NET, Building Department .NET, Business License .NET, General Ledger .NET, Accounts Payable .NET, Cash Receipting .NET, Fixed Assets .NET, Field Inspection .NET, Payroll .NET, Human Resources .NET, Miscellaneous Receivables .NET, Timesheets .NET, Special Assessment .NET Number of Employees: 225 Size of Operating Budget: $10,943,969 PROJECT SCOPE Please indicate (by checking box) functionality installed: ☒ Financials ☒ Budgeting ☒ HR ☒ Payroll TECHNOLOGY INFORMATION Hosted? Yes_____ No X If yes, hosting provider _____________ IMPLEMENTATION INFORMATION Project Duration: 5 months Initial Go-Live: 2/2020 Describe Role on Project: Planned and executed implementation of BS&A Software programs. Including, conversion of existing data to BS&A format; process discovery and counsel on program configuration; performed preliminary and final conversions of data; transferred knowledge to training teams and provided excellent customer service and communication channel for the duration of the project. Project Challenges: No specific challenges of note. Major Accomplishments: Project was completed on time and on budget. 16 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 GENERAL BACKGROUND Name of Client: City of Victoria, Carver County MN Project Manager/Contact: Trisha Pollock Title: Finance Director Phone: 952.443.2417 E-mail: tpollock@ci.victoria.mn.us Software Program/Version: .NET Summary of Project: BS&A Online/Community Development, BS&A Online/Employee Self Services, Accounts Payable .NET, Building Department .NET, Cash Receipting .NET, Field Inspection .NET, Fixed Assets .NET, General Ledger .NET, Payroll .NET, Miscellaneous Receivables .NET, Utility Billing .NET, Timesheets .NET Number of Employees: 150 Size of Operating Budget: $4,624,790 PROJECT SCOPE Please indicate (by checking box) functionality installed: ☒ Financials ☒ Budgeting ☐ HR ☒ Payroll TECHNOLOGY INFORMATION Hosted? Yes_____ No X If yes, hosting provider _____________ IMPLEMENTATION INFORMATION Project Duration: 4 months Initial Go-Live: 4/2016 Describe Role on Project: Planned and executed implementation of BS&A Software programs. Including, conversion of existing data to BS&A format; process discovery and counsel on program configuration; performed preliminary and final conversions of data; transferred knowledge to training teams and provided excellent customer service and communication channel for the duration of the project. Project Challenges: Our first customer requiring a GIS customer import. Major Accomplishments: The import worked really well and is now something we implement for a high percentage of customers. Projected was completed on time and on budget. 17 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 GENERAL BACKGROUND Name of Client: City of Alexandria, Douglas County MN Project Manager/Contact: Jane Blade Title: Finance Director Phone: 320.759.3625 E-mail: jblade@alexandriamn.city Software Program/Version: .NET Summary of Project: BS&A Online/Financials, BS&A Online/Employee Self Services, General Ledger .NET, Accounts Payable .NET, Cash Receipting .NET, Fixed Assets .NET, Payroll .NET, Human Resources .NET, Miscellaneous Receivables .NET, Timesheets .NET Number of Employees: 13,568 Size of Operating Budget: $27,844,275 PROJECT SCOPE Please indicate (by checking box) functionality installed: ☒ Financials ☒ Budgeting ☒ HR ☒ Payroll TECHNOLOGY INFORMATION Hosted? Yes_____ No X If yes, hosting provider _____________ IMPLEMENTATION INFORMATION Project Duration: 6 months Initial Go-Live: 5/2018 Describe Role on Project: Planned and executed implementation of BS&A Software programs. Including, conversion of existing data to BS&A format; process discovery and counsel on program configuration; performed preliminary and final conversions of data; transferred knowledge to training teams and provided excellent customer service and communication channel for the duration of the project. Project Challenges: No specific challenges of note. Major Accomplishments: Projected was completed on time and on budget. 18 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 GENERAL BACKGROUND Name of Client: City of Dayton, Hennepin County MN Project Manager/Contact: Amy Benting Title: Clerk Phone: 763.421.1891 E-mail: abenting@cityofdaytonmn.com Software Program/Version: .NET Summary of Project: BS&A Online/Employee Self Services, General Ledger .NET, Accounts Payable .NET, Cash Receipting .NET, Payroll .NET, Miscellaneous Receivables .NET, Timesheets .NET, Utility Bill ing .NET Number of Employees: 5,011 Size of Operating Budget: $4,179,952 PROJECT SCOPE Please indicate (by checking box) functionality installed: ☒ Financials ☒ Budgeting ☐ HR ☒ Payroll TECHNOLOGY INFORMATION Hosted? Yes_____ No X If yes, hosting provider _____________ IMPLEMENTATION INFORMATION Project Duration: 2 months Initial Go-Live: 6/2018 Describe Role on Project: Planned and executed implementation of BS&A Software programs. Including, conversion of existing data to BS&A format; process discovery and counsel on program configuration; performed preliminary and final conversions of data; transferred knowledge to training teams and provided excellent customer service and communication channel for the duration of the project. Project Challenges: No specific challenges of note. Major Accomplishments: Projected was completed on time and on budget. Full Client List at end of this section. Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Brewton City Escambia PO Box 368 Brewton AL 36427-0368 Tyree Newkirk (251) 809-1772 Citipak 2015 5,367 Eufaula Water Works Barbour PO Box 26 Eufaula AL 36072 Christy Mann (334) 687-1225 Sage Mas 90 2016 Bethel Heights City Benton 530 Sunrise Dr Bethel Heights AR 72764 Lisa Gibson (479) 751-7481 Quickbooks 2006 2015 2,456 Eureka Springs City Carroll 44 South Main Street Eureka Springs AR 72632 Lonnie Clark (479) 253-9703 Mainstreet 2013 2,074 Harrison City Boone PO Box 1715 Harrison AR 72602 Luke Feighert (870) 715-5008 Quickbooks 2017 13,000 Jacksonville City Pulaski #1 Municipal Drive Jacksonville AR 72076 Cheryl Erkel (501) 982-4502 Sage 2012 28,808 Lowell City Benton 216 N Lincoln Lowell AR 72745 Mary Mason (479) 770-2185 Perception 2006 2009 5,000 North Little Rock City Pulaski 120 Main Street North Litlle Rock AR 72114 Ember Strange (507) 975-8800 Harris 2016 64,633 Alachua City Houghton PO Box 9 Alachua FL 32616-0009 Rob Bonetti (386) 418-6100 ADG 2016 9,300 Belleview City Marion 5343 SE Abshier Blvd.Belleview FL 34420 Marge Strausbaugh (352) 233-2117 Asyst 2014 3,478 Biscayne Park Village Miami-Dade 640 NE 114th Street Biscayne Park FL 33161 Larry Spring (305) 899-8000 2013 3,126 Broward Metropolitan Planning Organization Broward 100 West Cypress Creek Rd; Suite 650 Fort Lauderdale FL 33309 Tracy Flavien (954) 876-0039 Tyler Eden 2017 Cape Canaveral City Brevard 100 Polk Avenue Cape Canaveral FL 32920 John DeLeo 321-868-1220 x204 Springbrook 2020 10,413 Clay County Utility Authority Clay 3176 Old Jennings Road Middleburg FL 32068-3907 Allen Boatright (906) 213-2417 2017 Cooper City Broward PO Box 290910 Cooper City FL 33329-0910 Karen Correa (954) 434-4300 x228 Harris SB Client 2013 29,076 Crystal River City Citrus 123 NW hwy 19 Crystal River FL 34428 Michelle Russell (352) 795-4216 x309 Munis 2012 3,485 EL Portal Village Miami-Dade 640 NE 114th Street Biscayne Park FL 33161 Larry Spring (305) 899-8000 2013 2,380 Flagler Beach City Flagler 105 South 2nd Street Flagler Beach FL 32136 Kathleen Doyle (386) 517-2000 x229 Mainstreet 2012 4,484 Fort Meade City Polk 8 West Broadway Street Fort Meade FL 33841 James "Mel" Parker (863) 285-1174 ADG 2016 5,691 Gulf Breeze City Santa Rosa 1070 Shoreline Drive Gulf Breeze FL 32561 Steve Milford (850) 934-5113 HTE 2013 5,763 Jupiter Island Town Martin 2 Bridge Road Hobe Sound FL 33455 Michael Ventura (772) 545-0104 Fund Balance 2017 850 Key Largo Wastewater Treatment District Monroe 98880 Oversears Hwy Key Largo FL 33037 Paul Christian (305) 451-4019 x220 Quickbooks 2013 Longboat Key Town Sarasota 501 Bay Isles Road Longboat Key FL 34228 Jason Keen (941) 316-6869 2017 7,082 Medley Town Miami-Dade 7777 NW 72nd Avenue Medley FL 33166 Roy Danzinger (305) 887-9541 x141 Great Plains/MS Dynamic 2016 842 Mount Dora City Lake 510 North Baker Street Mount Dora FL 32756-0176 Mike Sheppard (352) 735-7179 HTE 2015 12,534 Palmetto City Manatee 516 8th Ave West Palmetto FL 34221 Cheryl Miller (941) 723-4570 x7111 American Data Group 2014 14,500 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Parker City Bay 1001 West Park Street Parker FL 32404 Robin Combs 850-871-4104 Harris 2020 4,585 Rockledge City Brevard 1600 Huntington Lane Rockledge FL 32955 Matthew Trine (321) 221-7540 IMSoftech 2018 24,935 Satellite Beach City Brevard 565 Cassia Blvd Satellite Beach FL 32937 Brittany Jumper 321-773-4407 Fund Balance 2019 11,056 Tequesta Village Palm Beach 345 Tequesta Dr Tequesta FL 33469 Jody Forsythe (561) 575-6270 Fund Balance 2017 6,094 Titusville City Brevard 555 S Wahsington Ave.Titusville FL 32796 Jon Sellers 321-567-3747 HTE 2020 46,263 Titusville City Brevard 555 S Wahsington Ave.Titusville FL 32796 Jon Sellers 321-567-3747 SunGard Pentamation 2020 46,263 Village Center Community Development District Sumter 984 Old Mill Run The Villages FL 32162 Sarah Koser (352) 753-0421 JD Edwards 2020 157,000 Volusia County Clerk of Courts Volusia 101 N Alabama Avenue Deland FL 32724 Jolie Kelly 386-736-5915 x18218 Tangicloud 2019 West Melbourne City Brevard 2240 Minton Rd West Melbourne FL 32904 Tom Bradford (321) 837-7757 HTE 2016 19,500 Wilton Manors City Broward 2020 Wilton Drive Wilton Manors FL 33305 Bob Mays (954) 390-2141 Incode 2012 11,632 Sebring City Highlands 368 S. Commerce Sebring FL 33870 Penny Robinson 863-471-5100 HTE 2020 10,937 Safety Harbor City Pinellas 750 Main street Safety Harbor FL 34695 June Solanes (727)724-1555 HTE 2020 18,031 Deland Cit Volusia 120 S. Flroida Avenue DeLand FL 32720 Greg Whidden 386-626-7088 Springbrook 2021 33,532 Highland Beach Town Palm Beach 3614 South Ocean Blvd Highland Beach FL 33487 Marshall Labadie 561-278-4548 Fund Balance 2021 3,915 Adairsville City Bartow 116 Public Square Adairsville GA 30103 Nicole Scoggins (770) 773-3451 x106 Harris 2016 4,716 Commerce City Jackson PO BOX 348 Commerce GA 30530 James Wascher (706) 335-3277 Harris 2015 6,495 Covington City Newton 2194 Emory Street, N.W.Covington GA 30014 Randy Smith (678) 212-6140 SunGard Pentamation 2015 13,347 Dahlonega City Lumpkin 465 Riley Road Dahlonega GA 30533 Angi McDonald 706-864-6133 2020 6,884 Doraville City DeKalb 3725 Park Avenue Doraville GA 30340 Lisa Ferguson (770) 451-8745 Sage 2014 8,485 Douglasville City Douglas 6695 Church Street Douglasville GA 30134 Karin Callan (678) 449-3076 Sunguard Bi- Tech 2017 33,252 Hiram City Paulding 217 Main Street Hiram GA 30141 Sheila Kendall 770-943-3726 Smart Fusion 2019 3,984 Oconee County Oconee 23 N Main street Watkinsville GA 30677 Alex Newell 706-610-3520 Smart Fusion 2019 38,028 Peachtree City Fayette 151 Willowbend Rd Peachtree City GA 30269 Paul Salvatore (770) 487-7657 Tyler Incode 2015 34,675 Peachtree City Water & Sewage Authority Fayette 1127 Hwy 74 S Peachtree City GA 30269 Bo Davis 770-317-0746 Tyler Incode 2019 Suwanee City Gwinnett 330 Town Center Avenue Suwanee GA 30024 Amie Sakmar (770) 904-2797 Harris 2013 15,734 Tifton City Tift 130 1st St E Tifton GA 31794 Wayne Putnal (229) 231-3896 GEMS 2018 16,836 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Tucker City DeKalb 4119 Adrian Street Tucker GA 30084 Lewis Wilkinson (678) 597-9040 QS1 2018 35,322 Wayne County Wayne 341 E. Walnut Street Jesup GA 31546 Amanda Hannah (912) 427-5900 2017 29,949 Woodstock City Cherokee 12453 Highway 92 Woodstock GA 30188 Robert Porche (770) 592-6000 Manual System 2016 26,000 East Point City Fulton 2777 East Point Street East Point GA 30344 Farhad Islam 404-270-7073 HTE 2020 34,849 Peachtree Corners City Gwinnett 310 Technology Pkwy Peachtree Corners GA 30092 Jennifer Davis 470-395-8203 QS1 2020 31,704 Royston City Hart 684 Franklin Springs Street Royston GA 30662 Sharleen Ayers 706-245-7232 CSI 2020 2,569 Hayden City Kootenai 8930 N. Govenment Way Hayden ID 83835 Michael Drobnock 208-209-0988 Vadim 2019 14,693 Sandpoint City Bonner 1123 Lake Street Sandpoint ID 83864 Sarah Lynds 208-263-3557 2019 8,390 Moscow City Latah 206 East Third Street Moscow ID 83843 Jesse Flowers 208-883-7121 Springbrook 2021 25,766 Alton City Madison 101 East Third Street Alton IL 62002 Jeannie Cowan (618) 463-3544 Pentamation 2016 27,290 Arlington Heights Park District Cook 410 N. Arlington Heights Road Arlington Heights IL 60004 Donna Wilson (847) 506-7878 Harris 2015 75,101 Bannockburn Village Lake 2275 Telegraph Rd Bannockburn IL 60015-1533 Linda McCulloch (847) 945-6080 Fundware 2016 1,577 Bourbannais Park District Kankakee 459 N. Kennedy Drive Bourbonnais IL 60914 Paula Rogers (815) 933-9905 Quickbooks 2016 Bourbonnais Village Kankakee 600 Main Stree NW Bourbonnais IL 60914 Tara Latz 815-802-5350 ACS 2019 18,420 Burr Ridge Village DuPage 7660 County Line Rd Burr Ridge IL 60521 Jerry Sapp (630) 654-8181 ext 55 MSI 2012 10,408 Byron Park District Ogle PO Box 423 Byron IL Paul Zepezauer (815) 234-6277 2017 Champaign Park District Champaign 706 Kenwood Rd Champaign IL 61821 Andrea Wallace (217) 819-3826 MSI 2015 Channahon Village Grundy 24555 S. Navajo Drive Channahon IL 60410 Heather Morandi (815) 467-8331 Fund Balance 2015 12,600 Countryside City Cook 5550 East Avenue Countyside IL 60525 David Schutter 708-485-2464 MSI 2019 5,964 Crestwood Village Cook 13840 South Cicero Avenue Crestwood IL 60418 Malea Stubitsch 708-926-7217 Quickbooks 2020 10,846 DeKalb City DeKalb 200 South Fourth Street DeKalb IL 600115 Marc Thorson 815-762-4181 MSI 2018 43,193 Des Plaines Park District Cook 2222 Birch Steet Des Plaines IL 60018 Katie Skibbe (847) 391-5098 MSI 2015 Downers Grove Park District DuPage 2455 Warrenville Road Downers Grove IL 60515 Erik Brown 630-960-7257 MSI 2018 Dundee Park District Kane 665 Barrington Ave Carpentersville IL 60110 Greg Gannon 847-844-7085 x100 MSI 2019 DuPage Township Will 241 Canterbury Lane Bolingbrook IL 60440 Linda Youngs 630-759-1320 AMS 2019 89,381 Ela Township Lake 1155 E. Route 22 Lake Zurich IL 60047 Will Stefaniak 847-438-7823 AMS 2018 44,051 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Elburn Village Kane 301 E North Street Elburn IL 60119 Doug Elder (630) 365-5062 MSI 2016 5,661 Elmhurst Park District DuPage 375 W. First Street Elmhurst IL 60126 Christi Jacobson 630-993-8196 Eden 2018 Fox River Grove Village McHenry 305 Illinois Street Fox River Grove IL 60021 Jennifer Menz (847) 639-3170 MSI 2014 4,753 Freeport Park District Stephenson PO Box 417 Freeport IL 61032 Ron Schneider (815) 235-6114 2016 Germantown Hills Village Woodford 216 Holland Rd Germantown Hills IL 61548 Ann Sasso 309-383-2209 2020 3,430 Gilberts Village Kane 87 Galligan Road Gilberts IL 60136 Marlene Blocker (847) 428-4167 Harris 2016 7,433 Golf Maine Park District Cook 8800 W. Kathy Lane Niles IL 60714 John Jekot 847-297-6179 2019 Grayslake Village Lake 10 S Seymour Ave.Grayslake IL 60030 Bettina O'Connell (847) 223-8515 MSI 2014 21,101 Hainesville Village Lake 100 N Hainesville Rd Hainesville IL 60030 Linda Sota (847) 223-2032 Decision Systems 2015 3,597 Harvard City McHenry 201 W. Diggins Harvard IL 60033 Deb Szczap 815-943-6468 x106 MSI 2018 9,260 Harvey City Cook 15320 Broadway Ave Harvey IL 60426 Louis Williams (708) 210-5337 ACS 2016 25,000 Harwood Heights Village Cook 7300 W. Willow Harwood Heights IL 60706 Bruno Bellissimo (708) 867-7200 Fundware 2014 8,661 Hoffman Estates Park District DuPage 1685 W. Higgins Rd Hoffman Estates IL 60169 Lynne Cotshott (847) 310-3605 MSI 2016 Homewood Flossmoor Park District Cook 3301 Flossmoor Road Flossmoor IL 60422 Sharon Dangles (708) 957-0300 IDC 2018 Island Lake Village Lake 3720 Green Leaf Ave Island Lake IL 60042 Edward McGinty (847) 416-7865 AS400 2016 8,031 Itasca Park District DuPage County 350 E. Irving Park Dr Itasca IL 60143 Christine Kelly (630) 773-2257 Manual System 2015 Jackson County Jackson 1001 Walnut Street Murphysboro IL 62966 Michelle Tweedy (618) 687-7241 Harris 2017 59,677 Johnsburg Village McHenry 1515 Channel Beach Ave Johnsburg IL 60051 Kim Giovanni (815) 385-6023 MSI 2016 6,300 Kenilworth Village Cook 419 Richmond Road Kenilworth IL 60043 Christopher Strom Harris 2019 2,520 Lake Bluff Village Lake 40 E.Center Ave Lake Bluff IL 60044 Susan Griffin (847) 283-6890 MSI 2017 5,706 Lake Forest City Lake 220 E. Deerpath Lake Forest IL 60045 Diane Horn 847-810-3598 HTE 2018 19,612 Lake Villa Village Lake 65 Cedar Avenue Lake Villa IL 60046 Lori Heitman (847) 356-6100 MSI 2015 8,774 Lake Zurich Village Lake 70 East Main Street Lake Zurich IL 60047 Michael Duebner 847-540-1690 2018 19,967 Lemont Park District Cook 16028 127th Street Lemont IL 60439 Linda Straka (630) 257-6787 x3009 FinTrac 2015 Libertyville Village Lake 118 W Cook Avenue Libertyville IL 60048 Pat Wesolowski (847) 918-2102 MSI 2011 21,955 Lincolnshire Village Lake One Olde Half Day Road Lincolnshire IL 60069 Julia Gabbard (847) 913-2304 MSI 2015 7,274 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Lindenhurst Village Lake 2301 E. Sand Lake Rd.Lindenhurst IL 60046 Vicki VanSlochteren (847) 356-8252 MSI 2014 14,462 Lockport City Will 222 E. 9th Street Lockport IL 60441 Lisa Heglund (815) 835-0549 x2109 MSI 2017 25,231 Long Grove Village Lake 3110 Old McHenry Road Long Grove IL 60047 David Lothspeich (847) 634-9440 Quickbooks 2017 7,000 Maine-Niles Association of Special Recreation Cook 6820 W. Dempster Rd Morton Grove IL 60053 Tom Byczek 847-966-5522 FinTrac 2020 Mattoon Township Coles 1716 Richmond Ave Mattoon IL 61938 Amber Scoles 217-234-3877 2019 15,235 McHenry Township Fire Protection District McHenry 3610 W. Elm Street McHenry IL 60050 Marjean Diercks (815) 385-0075 AMS 2014 Medinah Park District DuPage 22 W130 Thorndale Ave Medinah IL 60157 Maria Piworski (630) 893-2560 2014 Merrionette Park Village Cook 11720 S. Keozie Ave Merrionette Park IL 60803 Kelly White 708-396-3183 Quickbooks 2018 1,882 Morton Grove Park District Cook 6834 W. Dempster Morton Grove IL 60053-1200 Martin O'Brien (847) 965-1200 AEK 2018 Morton Grove Village Cook 6101 Capulina Ave Morton Grove IL 60053 Hannah Sullivan 847-470-5243 Springbrook 2018 23,500 Mundelein Park District Lake 1401 N. Midlothian Road Mundelein IL 60060 Linda Miller (847) 388-5456 MSI 2018 New Lenox Village Will 1 Veterans Parkway New lenox IL 60451 Bob Pawlisz 815-464-6130 ACS 2019 26,575 North Riverside Village Cook 2401 S. DesPlaines Avenue North Riverside IL 60546 Sue Scarpiniti (708) 447-4211 Harris 2017 6,705 Northbrook Village Cook 1225 Cedar Lane Northbrook IL 60062 Michael Strong (847) 664-4050 GEMS 2015 33,600 Northfield Park District Cook 401 Wagner Road Northfield IL 60093 Xochitl Guillen (847) 446-4428 MSI 2017 Northlake City Cook 55 E. North ave Northlake IL 60164 Carol Lampard 703-343-8700 MSI 2020 12,235 Oak Brook Park District DuPage 1450 Forest Gate Rd Oak Brook IL 60523 Marco Salinas (630) 645-9536 MSI 2018 Oak Park Village Cook 123 Madison Street Oak Park IL 60302 Steven Drazner (708) 358-5462 Peoplesoft 2017 52,066 Oakbrook Terrace Park District DuPage 1S325 Ardmore Avenue Villa Park IL 60181 Antonio Washington 630-627-6100 Quickbooks 2019 Park Forest Village Cook 350 Victory Drive Park Forest IL 60466 Stephanie Masson (708) 283-5626 MSI 2016 22,035 Plano City Kendall 17 E. Main Street Plano IL 60545 Ron Vander Band (630) 552-8823 MSI 2018 11,097 Poplar Grove Village Boone PO Box 1 Polpar Grove IL 61065 Diana Dykstra (815) 765-3201 LOCIS 2016 5,100 Quincy Park District Adams 1231 Bonansinga Drive Quincy IL 62301 Don Hilgenbrinck (217) 919-0310 Smart Fusion 2017 Richton Park Village Cook 4455 Sauk trail Richton Park IL 60471 David Sevier 708-481-8950 MSI 2019 13,505 Riverside Village Cook 27 Riverside Road Riverside IL 60546 Karin Jones 708-447-2700 Tyler Incode 2019 8,915 Round Lake Beach Village Lake 1937 N. Municipal Way Round Lake Beach IL 60073 Brian Gosnell (847) 270-3024 MSI 2014 28,175 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Round Lake Village Lake 442 N Cedar Lake Rd Round Lake IL 60073 Brandy Schoff 847-546-5400 x3002 MSI 2019 18,563 Skokie Village Cook 5127 W. Oakton St Skokie IL 60077 Jim Shaw (847) 933-8414 HTE 2016 65,176 St Charles Park District DuPage 101 S. Second Street St Charles IL 60174 Cathy Camm (630) 336-5918 MSI 2016 Sterling Park District Whiteside PO Box 958 Sterling IL 61081 Paul Zepezauer (815) 622-6066 Sage 2015 10,000 Sugar Grove Village Kane 10 S. Municipal Drive Sugar Grove IL 60554 Pat Chamberlim (630) 466-4507 x12 MSI 2016 9,104 Urbana Park District Champaign 505 West Stoughton Street Urbana IL 61801 Caty Roland 217-367-1536 x242 2019 Vernon Hills Park District Lake 294 Evergreen Drive Vernon Hills IL 60061 Marla Pineiro (847) 996-6932 MSI 2015 Volo Village Lake 500 S. Fish Lake Road Volo IL 60073 Michael May (847) 740-6982 Quickbooks 2015 5,000 Warrenville Park District DuPage 35260 Warren Avenue Warrenville IL 60510 Linda Straka 630-393-7279 2019 Willowbrook Village DuPage County 835 Midway Drive Willowbrook IL 60527 Carrie Dittman (630) 920-2235 Decision Systems 2015 8,600 Winfield Park District DuPage 0N020 County Farm Rd Winfield IL 60190 Sue Beilech (630) 653-3811 AEK 2016 Winfield Village DuPage 27West465 Jewell Rd Winfield IL 60190 Lynn McCammon (630) 933-7109 Harris 2017 9,637 Zion Park District Lake 2400 Dowie Memorial Dr Zion IL 60099 Eric Bradley (847) 746-5500 x425 MSI 2015 Sanitary District of Decatur 501 S. Dipper Lane Decatur IL 62522 Kent Newton 217-422-6391 x213 2020 Flossmoor Village Cook 2800 Flossmoor Rd Flossmoor IL 60422 Scott Bordui 708-335-5405 Harris 2020 9,237 Pingree Grove Village Kane 555 Reinking road Pingree Grove IL 60156 Karen Plaza 847-464-5533 x1504 MSI 2020 8,976 Marengo City McHenry 132 E. Prairie St Marengo IL 60152 Megan Lopez 815-568-7112 Decision Systems 2020 7,457 El Paso City Woodford/ McLean 125 W. Front Street El Paso IL 61738 Sandee Kessinger 309-527-4005 MSI 2020 2,820 Hawthorn Woods Village Lake 2 Lagoon Drive Hawthorn Woods IL 60047 Jennifer Paulus 847-438-5222 MSI 2021 8,552 Bradley Village Kanakee 147 S. Michigan Ave Bradley IL 60915 Rob Romo 815-936-5107 MSI 2021 15,277 Angola City Steuben 210 N Public Square Angola IN 46703 Deb Twitchell (260) 665-2514 x7552 Komputrol 2012 8,500 Cedar Lake Town Lake 7408 Constitution Ave Cedar Lake IN 46303 Amy Sund (219) 374-7000 Keystone 2012 10,981 Ellettsville Town Monroe 221 N Sale Street Ellettsville IN 47429 Sandra Hash (812) 876-3860 Komputrol 2013 6,078 Highland Town Lake 3333 Ridge Road Highland IN 46322-2089 Michael Griffin (218) 838-1080 Regional Data Systems 2013 22,641 Huntingburg City Dubois 508 E. 4th Street Huntingburg IN 47542 Thomas Dippel (812) 683-2211 AS400 2013 6,100 Jeffersonville City Clark 500 Quatermaster Court Suite 300 Jeffersonville IN 47130 Amy Deering (812) 285-6429 Keystone 2013 44,900 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Kokomo City Howard 100 S. Union Street Kokomo IN 46901 Thu Caven 765-456-7574 2020 57,836 New Haven City Allen 815 Lincoln Hwy E.New Haven IN 46774 Renee Lyons (260) 748-7057 Komputrol 2016 15,474 Richmond City Wayne 50 North 5th Street Richmond IN 47374 Beth Fields 765-983-7211 GEMS 2018 35,455 Rochester City Fulton 320 Main Street Rochester IN 46975 Shoda Beehler (574) 223-2510 MegaSystems 2013 6,404 Southport City Marion 6901 Derbyshire Rd Southport IN 46227 Diana Bossingham (317) 786-3585 Excel 2012 1,752 Whiting City Lake 1443 119th St.Whiting IN 46394 Mark Adam (219) 659-3100 Keystone 2011 5,000 Argos Town Marshall 201 W. Walnut Street Argos IN 46501 Lisa Mullaney 574-892-5717 x222 Banyon 2020 1,625 Basehor City Leavenworth 2620 N. 155th Street Basehor KS 66007-0406 Katherine Renn (913) 724-1370 x28 Fund Balance 2015 23,754 41-B District Court Macomb 22380 Starks Dr Clinton Twp MI 48036 Lynn Gustafson (586) 569-7811 Munis 2006 2010 48th-District Court Oakland 4280 Telegraph Rd Bloomfield Hills MI 48302 Nicole O'dea (248) 647-1141 Fund Balance 2009 Acme Township Grand Traverse 6042 Acme Rd Williamsburg MI 49690 Cathy Dye (231) 938-1350 Fund Balance 2015 4,332 Ada Township Kent 7330 Thornapple River Dr Ada MI 49301 George Haga (616) 676-9191 ext 50 Fund Balance 2005 2009 9,882 Addison Township Oakland 1440 Rochester Rd Leonard MI 48367 Lori Fisher (248) 628-5409 Manual System 2002 2011 6,439 Addison Village Lenawee 103 1/2 W Main St Addison MI 49220 John Decker (517) 547-3135 Manual System 2009 627 Adrian City Lenawee 100 E Church St Adrian MI 49221 Jeffery Pardee (517) 264-4824 First Computer 2005 2012 21,574 Alaiedon Township Ingham 2021 W Holt Rd Mason MI 48854-9451 Sandy Shier (517) 676-9277 Fund Balance 2002 2013 3,498 Alamo Township Kalamazoo 7901 Nth 6th Street Kalamazoo MI Eric Cornell Peachtree 2019 3,820 Albion City Calhoun 112 W. Cass St Albion MI 49224 Tom Mead (517) 629-5535 Caselle 2014 9,144 Alcona County Alcona 106 5th Street Harrisville MI 48740 Cheryl Franks (989) 724-9420 Pontem 2017 10,349 Alger County Alger 101 Court Street Munising MI 49862 Pam Johnson (906) 387-4535 Harris 2018 9,383 Algoma Township Kent 10531 Algoma Ave NE Rockford MI 49341 Judy Bigney (616) 866-1583 Springbrook 2010 7,596 Algonac City St Clair 805 St. Clair River Dr.Algonac MI 48001 Linda Mackie (810) 794-9361 x220 Fund Balance 2007 2009 4,613 Allegan City Allegan 112 Locust St Allegan MI 49010 Tracy Stull (269) 686-1112 Springbrook 2008 2009 4,838 Allegan Township Allegan 3037 118th Ave Allegan MI 49010 Linda Evans (269) 673-5051 Our Town 2013 4,050 Allen Park City Wayne 16850 Southfield Rd Allen Park MI 48101 Kris Barann (313) 928-4396 Versys 2007 2015 29,376 Allendale Charter Township Ottawa 6676 Lake Michigan Dr Allendale MI 49401 Jack Hagedorn (616) 895-6295 Fund Balance 2005 2012 13,042 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Alma City Gratiot 525 E. Superior Street Alma MI 48801 Cynthia Michels (989) 463-8346 New World 2018 9,275 Almena Township Van Buren 27625 County Rd 375 Paw Paw MI 49079 Sandra Rickli (269) 668-6910 ForFund 2006 2009 4,226 Almont Village Lapeer 817 N. Main St Almont MI 48003 Kim Keesler (810) 798-8528 Pontem 2012 2,803 Alpena City Alpena 208 N First Ave Alpena MI 49707-2885 Karen Hebert (989) 354-2196 New World 2012 11,304 Alpena County Alpena 720 W. Chisholm St. Ste #2 Alpena MI 49707 Bonnie Friedrichs (989) 354-9220 Pontem 2017 28,988 Alpena Township Alpena 4385 US 23 North Alpena MI 49707 Karie Bleau (989) 356-0297 Fund Balance 2017 9,788 Alpine Township Kent 5255 Alpine Ave NW Comstock Park MI 49231 Jean Wahlfield (616) 784-1262 Springbrook 2010 13,976 Ann Arbor Charter Township Washtenaw 3792 Pontiac Trl Ann Arbor MI 48105 Marcy Scaturo (734) 663-3418 Fund Balance 2006 2012 4,720 Ann Arbor Downtown Development Authority Washtenaw 150 S. 5th Ave Ann Arbor MI 48104 Sarah McCallum 734-997-1309 2019 Antrim County Antrim 203 East Cayuga Street Belaire MI 49615 Debra Haydell (231) 533-3635 Bellaire 2011 23,267 Antwerp Township Van Buren 24821 Front Ave Mattawan MI 49071 Bonnie Osborne (269) 668-2615 ext 211 ForFund 2007 2012 10,813 Argentine Township Genesee 9048 Silver Lake Rd Linden MI 48451 Jane Leftler (810) 735-5050 Fund Balance 2015 6,521 Armada Township Macomb 23121 E Main Armada MI 48005 Mary Swiacki (586) 784-5200 Quickbooks 2017 5,246 Ash Township Monroe P O Box 387 Carleton MI 48117 Rob Schock (734) 654-6992 ext 25 Versys 2005 2014 7,610 Ashley Village Gratiot 114 W. Oak St Ashley MI 48806 Shelly Moffit (989) 847-3050 Quickbooks 2009 563 Atlas Township Genesee PO Box 277 Goodrich MI 48438 Tere Onica (810) 636-2548 Fund Balance 2015 7,257 Au Gres City Arenac 124 W. US 23 Au Gres MI 48703 LaVonne Pritchard (989) 876-8811 Northern Data Systems 2014 1,028 Au Sable Charter Township Iosco 311 5th St N Au Sable MI 48750 Sandra Wilson (989) 739-9169 Quickbooks 2007 2009 2,230 Auburn City Bay 113 E. Elm St Auburn MI 48611 Karen Bellor (989) 662-6761 Fund Balance 2013 2,011 Auburn Hills City Oakland 1827 N Squirrel Rd Auburn Hills MI 48326 Will Cagle (248) 364-6828 Munis 2012 19,837 Augusta Charter Township Washtenaw 8021 Talladay Rd Whittaker MI 48190 Kathy Giszczak (734) 461-6117 x201 Fund Balance 2002 2014 4,813 Augusta Village Kalamazoo PO Box 216 Augusta MI 49012 Julie Glenn (269) 731-5517 Excel 2008 899 Aurelius Township Ingham 1939 S Aurelius Rd Mason MI 48854 Tracy Ayres (517) 628-2093 Versys 2002 2012 3,318 Bad Axe City Huron 300 E Huron Ave Bad Axe MI 48413 Kay Goebel (989) 269-7681 First Computer 2004 2012 3,462 Baldwin Township Iosco 1119 Monument Rd Tawas City MI 48763 Cathy Pittsley 989-362-3742 Cogitate 2018 1,726 Bangor Charter Township Bay 180 State Park Dr Bay City MI 48706 Donna Leitermann (989) 684-8531 New World 2007 2009 15,547 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Bangor City Van Buren 257 W Monroe St Bangor MI 49013 Peter Stanislawski (269) 427-5831 ForFund 2007 2010 1,933 Baraga County Baraga 16 N 3rd St L'Anse MI 49946 Anne Koski (906) 524-7773 Harris 2014 8,654 Baraga Township Baraga 14574 Sturgeon Rd Baraga Mi 49908 Amy Isaacson (906) 201-2380 Our Town 2014 3,542 Baraga Village Baraga 100 Hemlock St.Baraga MI 49908 Cherie Koski (906) 353-6237 Fund Balance 2016 1,285 Baroda Village Berrien 9091 First Street Baroda MI 49101 Amy Hemphill (269) 422-1779 Church Windows 2010 873 Barry Township Barry PO Box 705 Delton MI 49046 Deb Dewey-Perry (269) 623-5171 Munis 2004 2013 3,489 Barryton Village Mecosta PO Box 31 Barryton MI 49305 Jen Trelfa (989) 382-7822 Quickbooks 2014 381 Barton Hills Village Washtenaw 199 Barton Shore Drive Ann Arbor MI 48105 Priya King (734) 222-5209 Quickbooks 2008 2009 335 Bath Charter Township Clinton 14480 Webster Rd Bath MI 48808 Jeff Garrity (517) 641-6728 Fund Balance 2007 2009 7,541 Bay Metropolitan Transportation Authority Bay 1510 N. Johnson Street Bay City MI 48708 Eric Sprague 989-922-3717 Macola 2020 Bear Creek Township Emmet 373 N Division Rd Petoskey MI 49770 Connie Golding (231) 347-3204 Quickbooks 2016 5,269 Beaver Creek Township Crawford 8888 South Grayling Road Grayling MI 49738 Max Meisner (989) 275-8878 Cogitate 2019 1,486 Beaverton City Gladwin PO Box 477 Beaverton MI 48612 Beverly Miller (989) 435-3511 Resource 2005 2017 1,106 Bedford Charter Township Calhoun 115 S. Uldriks Drive Battle Creek MI 49037 Joyce Feraco (269) 965-1999 Fund Balance 2015 9,517 Bedford Township Monroe 8100 Jackman Rd Temperance MI 48182-0607 David Manning (734) 847-6791 Fund Balance 2008 2012 28,606 Beecher Metropolitan District Genesee G-1057 W Louis Ave Flint MI 48505 Jacqueline Huddleston (810) 787-6526 Manual System 2006 2013 Belknap Township Presque Isle 5101 Petersville Rd Rogers City MI 49779 Terri Koss (989) 619-1619 Pontem 2018 854 Bellaire Village Antrim PO Box 557 Bellaire MI 49615 Cathy Odom (231) 533-8213 Peachtree 2013 1,086 Belleville City Wayne 6 Main St Belleville MI 48111 Lisa Long (734) 697-9577 Fund Balance 2014 3,997 Benton Charter Township Berrien 1725 Territorial Dr Benton Harbor MI 49022 Kelli Nelson (269) 925-0616 Microfund (Harris) 2010 16,404 Benton Harbor City Berrien 200 E Wall St Benton Harbor MI 49022 Debra Popp (269) 927-8400 Fund Balance 2012 11,182 Benton Township Cheboygan 5012 Orchard Beach Rd Cheboygan MI 49721 Maureen Engle (231) 625-9176 Quickbooks 2005 2009 3,080 Benton Township Eaton 5136 Windsor Hwy Potterville MI 48876 Jeana Bohrs 517-645-7880 Pontem 2019 2,712 Benzie County Benzie 448 Court Pl Beulah MI 49617 Charles Clarke (231) 882-0035 Accucomp 2004 2013 17,519 Berkley City Oakland 3338 Coolidge Hwy Berkley MI 48072 Brenda Cole (248) 549-1624 ext 473 New World 2004 2012 15,531 Berlin CHarter Township Monroe 8000 Swan View Rd Newport MI 48166 Judy Lindquist (734) 586-2187 ext 4 Fund Balance 2003 2013 6,924 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Bessemer City Gogebic 411 S Sophie St Bessemer MI 49911 Jim Trudgeon (906) 663-4311 Apollo 2005 2014 2,148 Beverly Hills Village Oakland 18500 W.13 Mile Rd Beverly Hills MI 48025 Chris Wilson (248) 676-6406 x228 Fund Balance 2015 10,437 Big Rapids Charter Township Mecosta 14212 Northland Dr Big Rapids MI 49307 Sherri Gilbert (231) 796-3603 Resource 2002 2014 4,208 Big Rapids City Mecosta 226 N Michigan Ave Big Rapids MI 49307 Tim Moslener (231) 592-4033 Eden 2009 10,849 Bingham Township Clinton 1637 S Dewitt Rd St Johns MI 48879 Helen Kus (989) 225-2394 Manual System 2006 2014 2,776 Birch Run Township Saginaw 8425 Main Street Birch Run MI 48415 Kurt Kiessling (989) 624-9773 Asyst 2013 6,191 Birch Run Village Saginaw 12060 Heath Street Birch Run MI 48415 Alyssa Barto (989) 624-5711 Civic Systems 2011 1,653 Birmingham City Oakland 151 Martin St Birmingham MI 48009 Judy Rumps (248) 530-1884 HTE 2011 19,291 Blackman Charter Township Jackson 1990 W Parnall Rd Jackson MI 49201 Ray Snell (517) 788-4345 Resource 2002 2015 22,800 Blair Township Grand Traverse 2121 County Road 633 Grown MI 49637 Lynette Wolfgang (231) 276-9263 Quickbooks 2017 6,448 Blendon Township Ottawa 7161 72nd Ave Hudsonville MI 49426 Don Vanderkuyl (616) 875-7707 x 23 Our Town 2008 2009 5,721 Blissfield Village Lenawee 408 E Adrian St Blissfield MI 49228 Peggy Nieman (517) 486-4347 Versys 2009 3,223 Bloomfield Hills City Oakland 45 E Long Lake Rd Bloomfield Hills MI 48304 Karen Ruddy (248) 530-1402 Fund Balance 2013 3,940 Blue Lake Township Kalkaska 10599 Twin Lk Rd NE Mancelona MI 49659 Tracy Nichol 231-587-8354 Quickbooks 2020 428 Blue Lake Township Muskegon 1491 Owasippe rd Twin Lake MI 49457 Jeff Abram 231-894-6335 Pontem 2020 1,990 Blue Water Transportation Authority St Clair 100 McMorran Blvd Port Huron MI 48062 James Brennan (810) 984-9729 Port Huron System 2020 Blumfield Township Saginaw 1175 W. Vassar Rd Reese MI 48757 Lisa Roethlisberger (989) 868-9512 Pontem 2010 2,014 Bois Blanc Township Mackinac PO Box 898 Pointe Aux Pins MI 49775 Joan Schroka (231) 634-7275 Cogitate 2003 2010 71 Boyne City Charlevoix 319 N Lake St Boyne City MI 49712 Cindy Grice (231) 582-0334 Fundware 2009 3,503 Branch County Branch 31 Division Street Coldwater MI 49036 Ann Vrablic (517) 279-6447 Harris 2016 43,545 Brandon Charter Township Oakland PO Box 929 Ortonville MI 48462-0929 Candee Allen (248) 627-2851 Civic Systems 2015 14,765 Breckenridge Village Gratiot 104 E Saginaw St Breckenridge MI 48615 Bridget Suhr (989) 842-3109 Fund Balance 2009 1,328 Breckenridge-Wheeler Township Fire Rescue Gratiot 104 E Saginaw St Breckenridge MI 48615 Bridget McPherson (989) 842-3109 Quickbooks 2019 Breitung Charter Township Dickinson PO Box 160 Quinnesec MI 49876 John Gaudette (906) 779-2060 Fund Balance 2013 5,930 Bridgeport Charter Township Saginaw 6206 Dixie Hwy Bridgeport MI 48722 Tammy McIntyre (989) 777-0940 x209 Fund Balance 2012 11,709 Bridgman City Berrien 9765 Maple Street Bridgman MI 49106 Debbie Lambrix (269) 465-5144 Fund Balance 2016 2,428 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Brighton City Livingston 200 N. First St.Brighton MI 48116 Kelly Hanna (810) 225-9283 Springbrook 2012 6,701 Bronson City Branch 141 S Matteson St Bronson MI 49028 Karen Smith (517) 369-7334 Harris 2003 2015 2,421 Brooklyn Village Jackson 121 N Main St Brooklyn MI 49230 Victor Cardenas (517) 592-2591 Peachtree 2010 1,206 Brownstown Charter Township Wayne 21313 Telegraph Rd Brownstown MI 48183 Donna Hall (734) 675-9960 ACS 2010 22,989 Bruce Township Macomb 223 East Gates Street Romeo MI 48065 Susan Brockmann 586-752-4585 Fund Balance 2019 8,158 Buchanan Township Berrien 15235 N Main St Buchanan MI 49107 Cathy Ganus (269) 695-6442 Manual System 2005 2013 3,510 Buena Vista Charter Township Saginaw 1160 S Outer Dr Saginaw MI 48601 Rene Fulgencio (989) 754-6536 ext 2319 ACS 2006 2010 10,318 Bunker Hill Township Ingham 871 Decamp Rd Stockbridge MI 49285 Carrie Zeitz (517) 204-1336 Quickbooks 2012 1,979 Burns Township Shiawassee PO Box 397 Bryon MI 48418 Shirley Riley (810) 444-3972 2017 3,500 Burt Township Alger E21837 Grand Marais Ave Grand Marais MI 49839 Kay Wampler (906) 494-2381 Quickbooks 2011 480 Burtchville Township St Clair 4000 Burtch Rd Lakeport MI 48059 Jessica Lize (810) 385-5577 Resource 2003 2014 3,956 Burton City Genesee 4303 S Center Rd Burton MI 48519 Ginger Burke-Miller (810) 743-1500 ext 1201 Fundware 2007 2011 30,308 Byron Township Kent 8085 Byron Center Ave SW Byron Center MI 49315 Julie Meza (616) 878-0660 Fund Balance 2007 2009 17,553 Byron Village Shiawassee PO Box 4 Byron MI 48418 Brian Boggs (810) 266-6160 Manual (pencil)2010 565 Cadillac City Wexford 200 N. Lake Street Cadillac MI 49601 Carol Pacella (231) 779-7380 New World 2016 10,000 Caledonia Charter Township Kent 8196 Broadmoor Ave SE Caledonia MI 49316 Jennifer Christian (616) 891-0070 x208 Fund Balance 2008 2009 8,964 Cambridge Township Lenawee 9990 W. M-50 Onsted MI 49265 Rick Richardson (517) 467-2104 Fund Balance 2012 5,299 Cannon Township Kent 6878 Belding Rd NE Rockford MI 49341 Bonnie Shupe (616) 874-6966 Versys 2006 2010 12,075 Capac Village St Clair 131 N Main Capac MI 48014 Crystal Potter (810) 395-4355 Fund Balance 2016 1,775 Carleton Village Monroe PO Box 376 Carleton MI 48117 Nancy Mell (734) 654-6255 Cogitate 2003 2011 2,562 Carmel Township Eaton 661 Beech Highway Charlotte MI 48813 Laura Goostrey 888-805-6182 Quickbooks 2019 2,626 Carrollton Township Saginaw 1645 Mapleridge Rd Saginaw MI 48604 Megan King (989) 754-4611 ext 29 New World 2007 2010 6,602 Carson City Montcalm PO Box 340 Carson City MI 48811 Cindy Schafer (989) 584-3515 Fund Balance 2010 1,190 Carsonville Village Sanilac 3912 W Sheldon St Carsonville MI 48419 Diane Schneider (810) 657-9400 Quickbooks 2008 2010 514 Cascade Charter Township Kent 2865 Thornhills Ave SE Grand Rapids MI 49546 Mildred Pinder (616) 949-1500 ext 208 Versys 2007 2009 15,107 Casco Township Allegan 7104 107th Ave South Haven MI 49090 Cheryl Brenner (269) 637-4441 Sage 2019 3,019 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Caseville Township Huron 6767 Main St Caseville MI 48725 Michelle Stirrett (989) 856-3053 Pontem 2012 2,723 Casnovia Township Muskegon 245 S Canada Rd Casnovia MI 49318 John Gort (616) 675-4064 Cogitate 2011 2,652 Caspian City Iron PO Box 273 Caspian MI 49915 Gina Kosmopoulos 906-265-2514 Fund Balance 2018 997 Cass City Village Tuscola 6506 Main St Cass City MI 48726 Nanette Walsh (989) 872-2911 Harris 2011 2,643 Cass County Cass 120 N. Broadway St, Suite 116 Cassopolis MI 49031 Angie Steinman (269) 445-4269 Harris 2015 51,608 Cassopolis Village Cass 117 S. Broadway St. Suite 100 Cassopolis MI 49031 Tonia Betty (269) 445-5645 Fund Balance 2016 1,749 Castleton Township Barry 915 Reed St Nashville MI 49073 Lorna Wilson (517) 852-9479 Resource 2004 2015 3,475 Cedar Creek Township Muskegon 6556 Sweeter Rd Twin Lake MI 49457 Heather Jarvis 231-821-0014 Quickbooks 2019 3,109 Cedar Springs City Kent PO Box 310 Cedar Springs MI 49319 Karen Mushong (616) 696-1330 x101 Fund Balance 2005 2012 3,112 Center Line City Macomb 7070 E 10 Mile Rd Center Line MI 48015 Steve Adair (586) 758-8270 Fund Balance 2012 8,531 Centreville Village St Joseph PO Box 399 Centreville MI 49032 Marty Chiddister (269) 467-4855 Fund Balance 2016 1,425 Charlevoix County Charlevoix 203 Antrim Street Charlevoix MI 49720 Cherie Browe (231) 547-7200 Advantage Systems 2015 23,121 Charlotte City Eaton MI Gregg Guetschow Fund Balance 2019 8,389 Chassell Township Houghton PO Box 438 Chassell MI 49916 June Michaelson (906) 523-4000 Cogitate 2005 2015 1,822 Cheboygan City Cheboygan PO Box 39 Cheboygan MI 49721 Kenneth Kwiatkowski (231) 627-9931 Versys 2005 2016 5,295 Cheboygan County Cheboygan PO Box 70 Cheboygan MI 49721 Kari Kortz (231) 627-8430 AS400 2002 2009 25,675 Chelsea City Washtenaw 305 S Main St Ste 100 Chelsea MI 48118 Kim Garland (734) 475-1771 CMI 2010 4,398 Cherry Grove Township Wexford 4830 E M-55 Cadillac MI 49601 Jim Barton (231) 775-0958 Accucomp 2007 2009 2,328 Chesaning Village Saginaw 1100 W Broad St Chesaning MI 48616 Lisa Hitchcock (989) 845-3800 Fund Balance 2013 2,338 Chester Township Ottawa 3509 Sehler St Conklin MI 49403 Jan Redding (616) 899-5544 Manual System 2003 2010 2,315 Chesterfield Charter Township Macomb 47275 Sugarbush Chesterfield Township MI 48047 Vicki Bauer (586) 949-0400 x1153 Fund Balance 2013 37,405 Chikaming Township Berrien PO Box 40 Harbert MI 49116 Julie Schroeder (269) 469-1676 Fund Balance 2015 3,678 China Charter Township St Clair 4560 Indian Trl China MI 48054 Kristi Donaldson (810) 765-1145 x207 Fund Balance 2005 2009 3,340 Chocolay Charter Township Marquette 5010 US 41 South Marquette MI 49822 Suzanne Sundell 906.249.1448 x207 Fund Balance 2019 7,148 Clam Lake Township Wexford 8809 E M-115 Cadillac MI 49601 Larry Payne (231) 775-5401 Quickbooks 2012 2,238 Clare City Clare 202 W 5th St Clare MI 48617 Ken Hibl (989) 386-7541 ext 102 Fund Balance 2005 2010 3,173 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Clare County Clare 225 W Main Harrison MI 48625 Jenny Beemer- Fritzinger (989) 539-7801 Harris 2018 30,553 Clark Township Mackinac PO Box 367 Cedarville MI 49719 Mike Miller (906) 484-2672 Harris 2003 2017 2,200 Clarkston City Oakland 375 Depot Clarkston MI 48346-1418 Sandra Barlass (248) 625-1559 Peachtree 2012 962 Clawson City Oakland 425 N. Main Street Clawson MI 48017 Mark Pollock (248) 435-4500 x111 Fund Balance 2016 12,732 Clay Township St Clair PO Box 429 Algonac MI 48001 Connie Turner (810) 794-9303 Port Huron System 2005 2009 9,822 Clayton Charter Township Genesee 2011 S. Morrish Road Swartz Creek MI 48473 Dennis Milem 810-635-4435 Fund Balance 2018 7,546 Climax Village Kalamazoo 114 E Maple Climax MI 49034 Scott Torrance (269) 746-4174 ForFund 2011 791 Clinton Charter Township Macomb 40700 Romeo Plank Rd Clinton Township MI 48038 Donna Lauretti (586) 723-8002 Munis 2012 95,648 Clinton Transit Clinton 215 N. Scott Rd St Johns MI 48879 Susan Gly 989-534-2704 Quickbooks 2019 Clio City Genesee 505 W. Vienna Street Clio MI 48420 Linda Kingston 810-686-5850 x205 Fund Balance 2018 2,483 Clyde Township St Clair 3350 Vincent Rd Clyde MI 48049 Stacey Smith (810) 985-7258 Fund Balance 2014 5,523 Coloma Charter Township Berrien 4919 Paw Paw Lake Rd Coloma MI 49038 Laura Baumeister 269-468-7212 Fund Balance 2019 5,217 Colon Township St Joseph PO Box 608 Colon MI 49040 Diane McKelvey (269) 432-3371 Quickbooks 2006 2014 3,405 Colon Village St Joseph 110 N. Blackstone Ave Colon MI 49040 Tammy Fredenburg (269) 432-2532 Sage 2017 1,227 Columbia Township Jackson 8500 Jefferson Rd Brooklyn MI 49230 Ruth Scott (517) 592-2000 Fund Balance 2004 2009 7,234 Columbiaville Village Lapeer PO Box 100 Columbiaville MI 48421 Denise Dupack (810) 793-4411 Cogitate 2006 2009 815 Commerce Charter Township Oakland 2009 Township Dr Commerce Twp MI 48390 Janet Bushey (248) 960-7069 Versys 2003 2012 34,764 Comstock Charter Township Kalamazoo PO Box 449 Comstock MI 49041 Anna (269) 381-2360 Springbrook 2005 2010 13,851 Concord Township Jackson 110 Hanover St Concord MI 49237 Judy Clark (517) 524-8604 2018 2,692 Concord Village Jackson PO Box 306 Concord MI 49237 Nancy Salvatore (517) 524-8534 Harris 2003 2009 1,101 Convis Township Calhoun 19500 15 Mile Rd Marshall MI 49068 Debra Wilson (269) 789-0654 ext 123 Peachtree 2013 1,666 Cooper Charter Township Kalamazoo 1590 W D Ave Kalamazoo MI 49009 Bonnie Sytsma (269) 382-0223 ForFund 2008 2010 8,754 Coopersville City Ottawa 289 Danforth St Coopersville MI 49404 Keri Rogers (616) 997-9731 Fund Balance 2008 2010 3,910 Corunna City Shiawassee 402 N Shiawassee St Corunna MI 48817 Nichole Cowdrey (989) 743-3650 Fund Balance 2009 3,381 Cottrellville Township St Clair 7008 Marsh Rd Marine City MI 48039 Violet Pfaff (810) 765-4730 Quickbooks 2005 2012 3,814 Courtland Township Kent 7450 14 Mile Rd Rockford MI 49341 Marilynn Crosby (616) 866-0622 Our Town 2005 2011 5,817 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Covert Township Van Buren PO Box 35 Covert MI 49043 Marilyn Rendell (269) 764-8986 x3 ForFund 2013 3,141 Crawford County Crawford 200 W Michigan Ave Grayling MI 49738 Joe Wakeley (989) 344-3231 New World 2002 2010 13,745 Crockery Township Ottawa PO Box 186 Nunica MI 49448 Judy Van Bemmelen (616) 837-6868 Manual System 2004 2013 3,782 Croswell City Sanilac 100 N. Howard Croswell MI 48422 Sam Moore (810) 679-2299 Fund Balance 2016 2,467 Croton Township Newaygo 5833 E. Division Street Newaygo MI 49337 Kim Edwards (231) 652-2388 Pontem 2017 3,042 Crystal Falls City Iron 401 Superior Avenue Crystal Falls MI 49920 Tara Peltoma (906) 875-3212 x103 Excel 2013 1,791 Crystal Falls Township Iron PO Box 329 Crystal Falls MI 49920 Donna Gustafson (906) 875-3062 Cogitate 2003 2013 1,722 Crystal Township Montcalm 217 Park Street Crystal MI 48818 Scott Brundage 989-287-1225 Pontem 2018 2,824 Dallas Township Clinton 11245 W 1st St Fowler MI 48835 Therese Koenigsknecht (989) 593-2542 Quickbooks 2006 2017 2,323 Dalton Township Muskegon 1616 E Riley Thompson Rd Muskegon MI 49445 Tracy DeMarse (231) 766-3043 x402 Resource 2005 2015 8,047 Davison City Genesee 200 E Flint St Ste 2 Davison MI 48423 Cindy VanMegroet (810) 653-2191 New World 2006 2010 5,536 Davison Township Genesee 1280 N Irish Rd Davison MI 48423 Alma Gay (810) 653-4156 Open Windows (Harris) 2008 2009 17,722 Dearborn Heights City Wayne 6045 Fenton St Dearborn Heights MI 48127 John Riley II (313) 791-3417 New World 2012 58,264 Decatur Village Van Buren 114 N Phelps St Decatur MI 49045 Louann Conklin (269) 423-6114 ForFund 2006 2009 1,838 Delhi Charter Township Ingham 2074 Aurelius Rd Holt MI 48842 Delhi Charter Township-Accounting (517) 699-3858 First Computer 2003 2010 22,569 Delta Charter Township Eaton 7710 W Saginaw Hwy Lansing MI 48917 Jeff Anderson (517) 323-8510 Fund Balance 2006 2010 29,682 Delta County Delta 310 Ludington St Escanaba MI 49829 Nora Viau (906) 789-5100 Harris 2013 36,559 Detroit Wayne County Health Authority Wayne 3031 W Grand Blvd Suite 450 Detroit MI 48226 Janette Davis (313) 871-3751 Fundware 2014 DeWitt Area Recreation Authority Clinton 1401 W. Herbison Rd Dewitt MI 48820 Clay Summers (517) 482-5117 Peachtree 2009 2012 DeWitt Charter Township Clinton 1401 W Herbison Rd DeWitt MI 48820 Diane Mosier (517) 668-0270 Versys 2006 2012 12,143 DeWitt City Clinton 414 E Main St DeWitt MI 48820 Lisa Grysen (517) 669-2441 Fund Balance 2002 2010 4,702 Dexter City Washtenaw 8140 Main St Dexter MI 48130 Marie Sherry (734) 426-8303 ext 14 Fund Balance 2012 2,338 Dexter Township Washtenaw 6880 Dexter-Pinckney Rd Dexter MI 48130 Harley Rider (734) 426-3767 Quickbooks 2005 2013 5,248 Dickinson County Dickinson PO Box 609 Iron Mountian MI 49801 Brian Bousley (906) 774-2573 Harris 2017 17,111 Dorr Township Allegan 4196 18th St Dorr MI 49323 Jane Rens (616) 681-9874 Peachtree 2012 6,579 Dorr-Leighton Waste Water Authority Allegan 4475 Kalamazoo Dr Caledonia MI 49316 Char Troost (616) 891-8238 2018 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Douglas Village City Allegan 86 W Center St Douglas MI 49406 Bob Drexler (269) 857-1438 Fund Balance 2008 2016 1,214 Dowagiac City Cass 241 S Front Street Dowagiac MI 49047 Mitch Billingham (269) 462-2816 CMI 2006 2009 6,147 Downriver Utility Wastewater Authority Wayne 15310 Cameron Southgate MI 48195 Doug Drysdale (734) 522-6711 2018 Dryden Village Lapeer 5602 Main Street Dryden MI 48412 Holly Shroyer 810-796-2291 Quickbooks 2018 936 Dundee Township Monroe 179 Main St Dundee MI 48131 Antoinette Carder (734) 529-2650 Cogitate 2002 2015 6,341 Dundee Village Monroe 350 W. Monroe Street Dundee MI 48131 David Uhl (734) 529-3430 x1032 Fund Balance 2016 3,522 Durand City Shiawassee 215 W Clinton St Durand MI 48429 Amy Roddy (989) 288-3113 Fund Balance 2006 2011 3,933 East Bay Charter Township Grand Traverse 1965 N. Three Mile Road Traverse City MI 49696 Glen Lile (231) 947-8647 Fund Balance 2014 9,919 East China Charter Township St Clair 5111 River Rd.East China MI 48054 Sandy Smith (810) 765-8879 x119 Fund Balance 2007 2011 3,630 East Grand Rapids City Kent 750 Lakeside Dr SE East Grand Rapids MI 49506 Karen Mushong (616) 949-2110 DataWest 2003 2009 10,764 East Tawas City Iosco PO Box 672 East Tawas MI 48730 Blinda Baker (989) 362-6161 Versys 2006 2010 2,951 Eastpointe City Macomb 23200 Gratiot Avenue Eastpointe MI 48021 Randy Altimus (586) 445-5026 Pentamation 2010 34,077 Eaton Rapids City Eaton 200 S. Main Street Eaton Rapids MI 48827 Marrie Jo Carr (517) 663-8118 x8107 CMI 2015 5,330 Eaton Township Eaton 3981 E Clinton Trl Charlotte MI 48813 Becky Dolman (517) 543-3308 Quickbooks 2007 2009 4,278 Eau Claire Village Berrien 6625 E Main St Eau Claire MI 49111 Lisa Borkowski (269) 461-6173 Quickbooks 2010 625 Ecorse City Wayne 3869 West Jefferson Ecorse MI 48229 Sarah Laird (313) 294-3740 New World 2010 11,229 Egelston Township Muskegon 5428 Apple Ave Muskegon MI 49442 Joan Rapp (231) 788-2308 ext 221 Versys 2005 2016 9,537 Elba Township Lapeer MI Rena Fountain Cogitate 2006 2014 5,462 Elk Rapids Village Antrim PO Box 398 Elk Rapids MI 49629 Marcia Price (231) 264-9274 Northern Data Systems 2014 1,700 Elkton Village Huron PO Box 516 Elkton MI 48731 Lonna Fisher (989) 375-2270 Mas 90 2011 863 Elm River Township Houghton 33607 Lake Gerald Rd Toivola MI 49965 Debbie Maki (906) 288-3355 Manual System 2007 2012 169 Elsie Village Clinton PO Box 408 Elsie MI 48831 Sue Bensinger (989) 862-4273 Fund Balance 2007 2010 1,055 Emmet County Emmet 200 Division Street Petoskey MI 49770 Matt Hellens (231) 348-1705 Grand Traverse System 2018 33,565 Emmett Charter Township Calhoun 621 Cliff St Battle Creek MI 49014 Teresa Myers (269) 968-0241 Pontem 2012 11,979 Empire Village Leelanau PO Box 253 Empire MI 49630 Derith Smith 231-326-5466 Quickbooks 2019 378 Erie Township Monroe PO Box 187 Erie MI 48133 Jolene Upchurch (734) 848-5915 Fund Balance 2002 2012 4,850 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Essexville City Bay 1107 Woodside Ave Essexville MI 48732 Fran DeWyse (989) 893-2441 Civic Systems 2016 3,766 Evart City Osceola 200 S Main St Evart MI 49631 Sarah DVoracek (231) 734-2181 Fund Balance 2015 1,738 Exeter Township Monroe 6158 Scofield Rd Maybee MI 48159 Billie Iott (734) 587-2100 Resource 2004 2015 3,727 Fairfield Township Lenawee 8391 Jefferson St Jasper MI 49248 Carol DeLong (517) 436-3004 Harris 2007 2018 1,756 Fairfield Township Shiawassee 6500 Henderson Drive Elsie MI 48831 Richard Zemla 989-666-2159 2019 745 Fairhaven Township Huron 9811 Main St Bay Port MI 48720 Ellen McGathy (989) 656-9901 Custom 2009 1,259 Farmington City Oakland 23600 Liberty St Farmington MI 48335 Chris Weber (248) 474-5500 ext 2247 First Computer 2006 2009 10,423 Farwell Village Clare 109 S Hall St Farwell MI 48622 Diane Maki (989) 588-9926 ICommander 2007 2016 855 Fennville City Allegan 222 S Maple Fennville MI 49408 Julie Wright (269) 561-8321 Springbrook 2005 2015 1,459 Fenton City Genesee 301 S Leroy St Fenton MI 48430 Cindy Shane (810) 629-2261 New World 2009 10,582 Ferndale City Oakland 300 E. 9 Mile Rd Ferndale MI 48220 Joseph Gacioch (248) 546-2300 New World 2015 22,105 Ferrysburg City Ottawa 17290 Roosevelt Rd Ferrysburg MI 49409 Debbie Wierenga (616) 842-5803 Fund Balance 2013 3,040 Fillmore Township Allegan A-4987 140th Ave Holland MI 49423 Janella Hop (269) 751-8303 Fund Balance 2006 2015 2,756 Flat Rock City Wayne 25500 Gibraltar Rd Flat Rock MI 48134 Debbie Lambrix (734) 782-2463 Fund Balance 2004 2013 8,488 Flint City Genesee 1101 S Saginaw St Flint MI 48502 Tom O'Brien (810) 766-7255 ext 2205 Peoplesoft 2004 2013 124,943 Flint Public Library Genesee 1026 E Kearsley St Flint MI 48502 Connie Palmer (810) 249-2043 Creative Solutions 2009 Flushing Charter Township Genesee 6524 N Seymour Rd Flushing MI 48433 Karla Carpenter (810) 659-0800 Resource 2007 2010 10,230 Flushing City Genesee 725 E Main St Flushing MI 48433 Nancy Parks (810) 659-5665 Harris 2011 8,348 Forestville Village Sanilac PO Box 36 Forestville MI 48434 Tammy Kolomac (989) 864-3447 Quickbooks 2017 127 Fort Gratiot Charter Township St Clair 3720 Keewahdin Rd Fort Gratiot MI 48059 David Jewell (810) 385-4489 Versys 2005 2011 10,691 Fowlerville Village Livingston 213 South Grand Ave Fowlerville MI 48836 Sherry Prevo (517) 223-3771 ext 15 Resource 2007 2009 2,972 Frankenlust Township Bay 2401 Delta Road Bay City MI 48706-9340 Donna Reichard (989) 686-5300 Quicken 2015 2,530 Frankenmuth Township Saginaw 240 W. Genesee Frankenmuth MI 48734 Kathy Marshall (989) 652-3430 x183 Fund Balance 2016 2,049 Frankfort City Benzie PO Box 351 Frankfort MI 49635 Kimberly Kidder (231) 352-7117 Caselle 2019 1,513 Franklin Village Oakland 32325 Franklin Rd Franklin MI 48025 James Creech (248) 626-9666 Quickbooks 2017 2,937 Fraser City Macomb 33000 Garfield Rd Fraser MI 48026 Tim McCulloch (586) 294-8908 Versys 2010 15,297 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Frederic Township Crawford 7564 CR 612 Frederic MI 49733 Sandy Barber (989) 348-8778 Manual System 2004 2013 1,401 Fredonia Township Calhoun PO Box 271 Marshall MI 49068 Ruth Albaugh (269) 781-8115 Quicken 2005 2017 1,723 Fremont City Newaygo 101 E Main St Fremont MI 49412 Todd Blake (231) 924-2101 Fund Balance 2011 4,224 Frenchtown Charter Township Monroe 2744 Vivian Rd Monroe MI 48162 Mark J. Baker (734) 242-5800 Fund Balance 2002 2020 20,777 Frost Township Clare 3741 Ash Rd Harrison MI 48625 Emerson Davis (989) 539-2494 ICommander 2014 1,159 Fruitland Township Muskegon 4545 Nestrom Rd Whitehall MI 49461 Janell Beard (231) 766-2027 2002 2012 5,235 Fruitport Charter Township Muskegon 6543 Airline Rd Fruitport MI 49415 Rose Dillon (231) 865-3151 Resource 2005 2012 12,533 Gaines Charter Township Kent 8555 Kalamazoo Ave SE Caledonia MI 49316 Jan Boone (616) 698-6640 Fund Balance 2008 2009 20,112 Gaines Township Genesee 9255 Grand Blanc Rd Gaines MI 48436 Michael Dowler (810) 635-3200 MS Money 2017 6,491 Galesburg City Kalamazoo 200 E Michigan Ave Galesburg MI 49053 Diana Skidmore (269) 665-7000 Resource 2005 2014 1,988 Garden City Wayne 6000 Middlebelt Road Garden City MI 48135 Allyson Bettis (734) 793-1616 New World 2013 30,047 Garfield Charter Township Grand Traverse 3848 Veteran Dr Traverse City MI 49684 Kay Schumacher (231) 941-1620 Fund Balance 2013 13,840 Garfield Township Bay 1138 W. Erickson Linwood MI 48634 Connie Fantozzi (989) 313-0071 Quickbooks 2018 1,775 Gaylord City Otsego 305 E Main St Gaylord MI 49735 Dave Duffield (989) 732-4060 Fund Balance 2003 2010 3,681 Genesee County Land Bank Genesee G-2302 Stonebridge Dr Bldg D Flint MI 48532 Mia Chapman (810) 230-8200 NO CONVERSION 2005 2016 Genoa Charter Township Livingston 2911 Dorr Rd Brighton MI 48116 Adam Van Tassell (810) 227-5225 ext 14 Springbrook 2016 15,901 Georgetown Charter Township Ottawa PO Box 769 Jenison MI 49429 Dan Carleton (616) 457-2340 x225 New World 2002 2009 41,658 Gibraltar City Wayne 29450 Munro St Gibraltar MI 48173 Linda Sucharski (734) 676-8982 Fund Balance 2002 2015 4,264 Gilford Township Tuscola 6230 Gilford Rd Fairgrove MI Bob Hains 989-693-6394 2018 833 Gladstone City Delta PO Box 32 Gladstone MI 49837 Darla Falcon (906) 428-3636 Harris 2003 2012 5,032 Gladwin City Gladwin 1000 W Cedar Ave Gladwin MI 48624 Shannon Greaves (989) 426-9231 ext 101 Springbrook 2006 2012 3,001 Gladwin County Gladwin 401 W Cedar Ave Gladwin MI 48624 Laura Brandon (989) 426-7351 AS400 2011 25,411 Gobles City Van Buren PO Box 38 Gobles MI 49055 Paula Sipes (269) 628-2246 Manual System 2005 815 Gogebic County Gogebic 200 N Moore St Bessemer MI 49911 Mary Jendrusina (906) 663-4517 AS400 2002 2010 15,737 Golden Township Oceana PO Box 26 Mears MI 49436 Rachel Iteen (231) 873-4413 Quickbooks 2008 2010 1,810 Goodrich Village Genesee 7338 S State Rd Goodrich MI 48438 Jeanie Bradley (810) 636-2570 Cogitate 2002 2016 1,353 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Grand Blanc Charter Township Genesee PO Box 1833 Grand Blanc MI 48480 Debra Barriger (810) 424-2654 New World 2006 2009 29,827 Grand Blanc City Genesee 203 E Grand Blanc Rd Grand Blanc MI 48439 Bethany Smith (810) 694-1118 New World 2007 2010 8,242 Grand Haven Charter Township Ottawa 13300 168th Ave Grand Haven MI 49417 Mark Verberkmoes (616) 842-5988 Fund Balance 2002 2010 13,278 Grand Haven City Ottawa 519 Washington Ave Grand Haven MI 49417 Jim Bonamy (616) 935-3214 AS400 2013 11,168 Grand Ledge City Eaton 310 Greenwood Street Grand Ledge MI 48837 Adam Smith (517) 627-2149 Fund Balance 2016 7,813 Grand Rapids Charter Township Kent 1836 E Beltline Ave NE Grand Rapids MI 49525 Janice Hulbert (616) 361-7391 ForFund 2008 2009 14,056 Grand Rapids City Kent 300 Monroe Ave NW Room 220 Grand Rapids MI 49503 John Globensky (616) 456-3285 2016 197,800 Grandville City Kent 3195 Wilson Ave SW Grandville MI 49418 Tammy Aue (616) 530-4970 Springbrook 2004 2010 16,263 Grant City Newaygo 280 S Maple St Grant MI 49327 Lori Gardner (231) 834-7904 Quickbooks 2010 881 Grant Township Iosco 4049 W. Indian Lake Rd National City MI 48748 Alysha Burgess 989-469-3177 Pontem 2020 1,560 Grass Lake Charter Township Jackson PO Box 216 Grass Lake MI 49240 Cathy Zenz (517) 522-8464 x121 Fund Balance 2017 4,586 Grass Lake Village Jackson 119 N lake street Grass Lake MI 49240 Trudi Whitley 517-522-4550 Fund Balance 2019 1,082 Gratiot County Gratiot 214 E Center St Ithaca MI 48847 Mary Sullivan (989) 875-5220 Resource 2006 2010 41,665 Grattan Township Kent 12050 Old Belding Road Belding MI 48809 Monica Burtt (616) 691-8450 Peachtree 2011 3,551 Great Lakes Water Authority Wayne 735 Randolph Detroit MI 48226 Cindy Cezat (313) 964-9243 2016 Green Lake Township Grand Traverse PO Box 157 Interlochen MI 49643 Judith Kramer (231) 276-9329 Fund Balance 2015 5,009 Green Oak Charter Township Livingston 10001 Silver Lake Rd Brighton MI 48116 Michael Sedlak (810) 231-1333 Resource 2002 2010 15,618 Greenville City Montcalm 411 S Lafayette Greenville MI 48838 Norice Rasmussen (616) 754-5645 Fund Balance 2018 7,935 Grosse Ile Township Wayne 9601 Groh Rd Grosse Ile MI 48138 Ann Darzniek (734) 676-4422 ext 224 Pentamation 2009 10,894 Grosse Pointe City Wayne 17147 Maumee Ave Grosse Pointe MI 48230 Lois Zaremski (313) 885-5800 Fund Balance 2011 5,670 Grosse Pointe Farms City Wayne 90 Kerby Rd Grosse Pointe Farms MI 48236 John Lamerato (313) 640-1602 Fund Balance 2016 9,764 Grosse Pointe Park City Wayne 15115 E. Jefferson Grosse Pointe Park MI 48230 Jane Blahut (313) 822-4375 Fund Balance 2014 12,443 Grosse Pointe Shores Village Macomb 795 Lake Shore Rd Grosse Pointe Shores MI 48236 Rhonda Ricketts (313) 881-6565 Fund Balance 2019 2,957 Grosse Pointe Woods City Wayne 20025 Mack Grosse Pointe Woods MI 48236 Deeann Irby (313) 343-2604 Civic Systems 2011 17,080 Groveland Township Oakland 4695 Grange Hall Rd Holly MI 48442 Pam Mazich (248) 634-4152 Versys 2005 2009 6,150 GRSD Sewer Authority Berrien 10831 Kruger Road New Buffalo MI 49117 Warren Histed 269-469-3434 Quickbooks 2020 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Gull Lake Sewer & Water Authority Kalamazoo 7722 North 37th Street Richland MI 49083 Anne Richmond (269) 731-4680 Peachtree 2015 Gun Plain Charter Township Allegan 381 8th St Plainwell MI 49080 Michael VandenBerg (269) 685-9471 ForFund 2009 5,637 Hamburg Township Livingston 10405 Merrill Rd Hamburg MI 48139 Angela Rabb (810) 231-1000 x205 Fund Balance 2010 20,627 Hamilton Fire Department Allegan PO Box 241 Hamilton MI 49419 Sheila Meiste (269) 806-8013 Our Town 2013 Hamilton Township Clare 8996 E. Townline Lk Rd.Harrison MI 48625 Finotte Laboda (989) 539-6975 Cogitate 2011 1,988 Hampton Charter Township Bay 801 W. Center Rd Essexville MI 48732 Terri Close 989-893-7541 Pontem 2019 9,902 Hamtramck City Wayne 3401 Evaline St Hamtramck MI 48212 Michael Wilk (313) 870-0322 New World 2007 2012 22,976 Hancock City Houghton 399 Quincy Street Hancock MI 49930 Karen Haischer (906) 482-2720 Vadim 2015 4,323 Handy Township Livingston PO Box 189 Fowlerville MI 48836 Laura Eisele (517) 223-3228 Resource 2005 2013 7,004 Hanover Township Jackson PO Box 40 Horton MI 49246 Mary Ann Greiner (517) 563-2791 Resource 2005 2015 3,792 Harbor Beach City Huron 766 State St Harbor Beach MI 48441 Jennifer Capling (989) 479-3363 Fund Balance 2009 1,837 Harbor Springs Sewage Authority Emmet 709 E Hathaway Rd Harbor Springs MI 49740 Robert Morris (231) 526-6682 Peachtree 2006 2017 Harbor Transit Authority Ottawa 440 N Ferry Street Grand Haven MI 49417 Dana Appel (616) 842-3200 2019 Haring Charter Township Wexford 515 Bell Ave Cadillac MI 49601 Lynn Nixon (231) 775-8822 Peachtree 2012 3,900 Harper Woods City Wayne 19617 Harper Harper Woods MI 48225 Laura Stowell (313) 343-2518 Northern Data Systems 2015 14,254 Harrison Charter Township Macomb 38151 L'Anse Creuse St Harrison Township MI 48045 Glen Spencer (586) 466-1438 Fund Balance 2004 2012 24,461 Hart City Oceana 407 State Street Hart MI 49420 Cheryl Abson (231) 873-2488 Fund Balance 2017 2,111 Hartford Township Van Buren 61310 CR 687 Hartford MI 49057 Julie Sweet (269) 621-4658 Cougar Mountain 2004 2016 3,159 Hartland Township Livingston 2655 Clark Rd Hartland MI 48353 Susan Dryden (810) 632-7498 Fund Balance 2008 2010 10,996 Hayes Township Clare PO Box 310 Harrison MI 48625 Maye Rood (989) 539-7130 x3 Harris 2014 4,916 Hazel Park City Oakland 111 E Nine Mile Rd Hazel Park MI 48030 Joann Bowling (248) 546-4062 x317 Civic Systems 2012 18,963 Heath Township Allegan PO Box 241 Hamilton MI 49419 Sheila Meiste (269) 806-8013 Our Town 2013 3,100 Hematite Township Iron PO Box 67 Amasa MI 49903 Tonya Hiltonen (906) 822-7349 Manual System 2004 2014 352 Henrietta Township Jackson 11120 Musbach Rd Munith MI 49259 Sally Keene (517) 596-3374 Resource 2004 2012 4,483 Hersey Township Osceola PO Boc 46 Hersey MI 49639 Tracey Cochran 231-920-1790 Quicken 2020 1,846 Hesperia Village Newaygo 33 E Michigan Ave Hesperia MI 49421 Scott Kaopel (231) 854-5915 Manual System 2008 2010 954 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Higgins Township Roscommon PO Box 576 Roscommon MI 48653 Cheri Sullivan 989-275-8112 Pontem 2020 2,061 Highland Park City Wayne 12050 Woodward Ave Highland Park MI 48203 Earnestine Willams (313) 252-0050 x211 Fund Balance 2015 16,746 Hillsdale City Hillsdale 97 N. Broad Street Hillsdale MI 49242 Bonnie Tew (517) 437-6446 Fund Balance 2014 8,233 Hillsdale County Hillsdale 29 N Howell St Rm 15 Hillsdale MI 49242 David Holcomb (517) 437-3158 Resource 2007 2011 45,830 Holland Charter Township Ottawa 353 N 120th Ave Holland MI 49422 Susan Dalman (616) 396-2345 Harris 2009 28,911 Holly Township Oakland 102 Civic Dr Holly MI 48442 Karen Winchester (248) 634-9331 ext 301 Versys 2006 2010 10,037 Holly Village Oakland 202 S. Saginaw Holly MI 48442 Cathrene Behrens (248) 634-9571 Fund Balance 2011 6,135 Homer Township Calhoun 386 Grandview Ave Homer MI 49245 Jennifer Johnson (517) 568-4786 Quicken 2012 3,010 Hope Township Barry 5463 S. M-43 Hwy Hastings MI 49058 Debra Jackson (269) 948-2464 Harris 2005 2013 3,283 Hopkins Township Allegan 1975 126th Ave Hopkins MI 49328 Dawn Arndt (616) 896-8315 x109 Creative Solutions 2008 2012 2,671 Houghton City Houghton PO Box 606 Houghton MI 49931 Kurt Kuure (906) 483-4645 Resource 2002 2009 7,010 Houghton County Houghton 401 E. Houghton Ave Houghton MI 49913 Eric Forsberg (906) 482-8307 Harris 2015 36,495 Houghton Lake Sewer Authority Roscommon 1250 South Harrison Rd Houghton Lake MI 48629 Renee Nichols (989) 422-5811 Manual System 2006 2018 Howard City Village Montcalm PO Box 510 Howard City MI 49329 Kim Alexander (231) 937-4311 ICommander 2011 1,585 Howell Area Fire Authority Livingston 1211 W Grand River Ave Howell MI 48843 Chief Jim Reed (517) 546-0560 2004 2019 Howell City Livingston 611 E Grand River Ave Howell MI 48843 Catherine Stanislawski (517) 546-3500 Munis 2004 2010 9,232 Howell Township Livingston 3525 Byron Rd Howell MI 48855 Carolyn Eaton (517) 546-2817 ext 106 Cogitate 2004 2010 5,679 Hubbardston Village Ionia 401 S Washington Hubbardston MI 48845 Robert Fahey (989) 981-6141 MS Money 2007 2009 394 Hudsonville City Ottawa 3275 Central Blvd Hudsonville MI 49426 Janice Sal (616) 669-0200 ext 413 Fund Balance 2008 2009 7,160 Huntington Woods City Oakland 26815 Scotia Huntington Woods MI 48070 Tony Lehmann (248) 541-4300 New World 2009 6,151 Huron Charter Township Wayne 22950 Huron River Drive New Boston MI 48164 Glenn Suemnick (734) 753-4466 Fund Balance 2013 13,737 Huron County Huron 250 E Huron Avenue Room 302 Bad Axe MI 48413 Chris Prill (989) 269-6459 AS400 2012 32,065 Imlay City Lapeer 150 N. Main Street Imlay City MI 48444 Tim Sadowski (810) 724-2135 Fund Balance 2013 3,869 Independence Charter Township Oakland 6483 Waldon Center Dr.Clarkston MI 48346 Susan Hendricks (248) 625-8114 Vadim 2011 32,581 Ingham County Land Bank Ingham PO Box 215 Mason MI 48854 Eric Schertzing (517) 676-7220 Manual System 2007 2011 Inkster City Wayne 26215 Trowbridge Ave Inkster MI 48141 Lynn Ellyn (313) 563-4266 New World 2009 30,115 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Inverness Township Cheboygan PO Box 6009 Cheboygan, MI MI 49721 Lisa Porter 231-627-2939 Pontem 2020 2,278 Ionia City Ionia 114 N Kidd St Ionia MI 48846 Robin Marhoffer (616) 527-4170 ext 120 Fund Balance 2007 2009 10,569 Ionia County Ionia 100 W Main St Ionia MI 48846 Stephanie Hurlbut (616) 527-5300 Resource 2003 2011 64,294 Iosco County Iosco PO Box 778 Tawas City MI 48764 Elite Shellenbarger (989) 362-4409 ACS 2013 25,420 Ira Township St Clair 7085 Meldrum Rd Fair Haven MI 48023 Crystal Sovey (586) 725-0263 Fund Balance 2004 2010 6,966 Iron County Iron 2 S. Sixth Street Crystal Falls MI 49920 Sue Clisch (906) 875-0652 Open Windows (Harris) 2013 11,387 Iron Mountain City Dickinson 501 S. Stephenson Ave Iron Mountain MI 49801 Carol Bartolameolli (906) 774-8530 Great Plains 2011 8,154 Iron River City Iron 106 W. Genesee St Iron River MI 49935 David Thayer (906) .26-5.47 x100 Fund Balance 2016 3,386 Ironwood City Gogebic 213 S. Marquette St Ironwood MI 49938 Paul Linn (906) 932-5050 x113 Fund Balance 2015 6,293 Isabella County Isabella 200 N. Main Street, Suite 205 Mt Pleasant MI 48858 Margaret McAvoy (989) 317-4058 ACS 2017 70,698 Ishpeming City Marquette 100 E Division St Ishpeming MI 49849 Jim Lampman (906) 485-1091 Ext 210 Incode 2020 6,686 Ishpeming Township Marquette 1575 US 41 W Ishpeming MI 49849 Kristin Thornton (906) 485-1210 x220 Fund Balance 2014 3,522 Ithaca City Gratiot 129 W Emerson St Ithaca MI 48847 Barbara Fandell (989) 875-3200 Fund Balance 2012 3,098 Jackson City Jackson 161 W Michigan Ave Jackson MI 49201 Steve Maga (517) 768-6387 New World 2009 36,316 Jackson County Jackson 120 W. Michigan Ave Jackson MI 49201 James Latham (517) 768-6614 IFAS 2014 159,741 James Township Saginaw 6060 Swan Creek Rd Saginaw MI 48609 Thomas Dierich (989) 781-1353 Quickbooks 2012 1,930 Jamestown Charter Township Ottawa PO Box 88 Jamestown MI 49427 Ruth Pruis (616) 896-8376 ext 12 Fund Balance 2004 2013 5,062 Jerome Township Midland 737 W. Beamish Sanford MI 48657 Angela Martin (989) 488-4578 x3 Fund Balance 2016 4,888 Johnstown Township Barry PO Box 157 Bedford MI 49020 Sheri Babcock (269) 721-3710 Peachtree 2016 3,067 Jonesville City Hillsdale 265 E Chicago St.Jonesville MI 49250 Lenore Spahr (517) 849-2104 Resource 2009 2,337 Kalamazoo Charter Township Kalamazoo 1720 Riverview Drive Kalamazoo MI 49004 Don Thall (269) 381-8080 Springbrook 2012 21,675 Kalamazoo City Kalamazoo 241 W South St Kalamazoo MI 49007 Sue Hoch 269 337-8840 2017 77,145 Kalamazoo County Land Bank Kalamazoo 229 E. Michigan Ave Suite 340 Kalamazoo MI 49007 Kelly Clarke (269) 216-9681 Excel 2010 Kalamazoo Lake Sewer & Water Authority Allegan 6449 Old Allegan Rd Saugatuck MI 49453 Daryl VanDyke (269) 857-2709 Fund Balance 2015 Kalkaska County Kalkaska 605 N. Birch St Kalkaska MI 49646 Valerie Thornburg (231) 258-3311 Pontem 2015 17,394 Kalkaska Village Kalkaska 200 Hyde St Kalkaska MI 49646 Jennifer Standerfer (231) 258-9191 Civic Systems 2015 2,226 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Kawkawlin Township Bay 1836 E Parish Rd Kawkawlin MI 48631 Greg Petrimoulx (989) 686-8710 Pontem 2013 5,104 Keego Harbor City Oakland 2025 Beechmont St Keego Harbor MI 48320 Linda Voll (248) 682-1930 Fund Balance 2003 2016 2,769 Kentwood City Kent PO Box 8848 Kentwood MI 49518 Tom Chase (616) 554-0766 New World 2007 2009 45,255 Kimball Township St Clair 2160 Wadhams Rd Kimball MI 48074 Joyce Shaffer (810) 987-9797 Port Huron System 2006 2012 8,628 Kingsford City Dickinson 305 S. Carpenter Ave Kingsford MI 49802 Holly Palmer (906) 774-3526 Fund Balance 2016 5,549 Kochville Township Saginaw 5851 Mackinaw Rd Saginaw MI 48604 Lyle Brewster (989) 792-7596 ext. 114 Resource 2005 2010 3,241 Lake Area Sewer Authority Van Buren 32593 Dugin Covet Lawton MI 49065 Chris Oxley (269) 370-1190 NO CONVERSION 2010 Lake Charter Township Berrien 3220 Shawnee Bridgman MI 49106 Gloria Payne (269) 465-6601 Quickbooks 2013 3,148 Lake County Lake 800 10th St Ste 200 Baldwin MI 49304 Brenda Kutchinski (231) 745-2725 First Computer 2008 2009 11,341 Lake Mitchell Sewer Authority Wexford 150 Pine Knoll Drive Cadillac MI 49601 Sheila Hill 231-775-0155 2020 Lake Odessa Village Ionia 839 4th Ave Lake Odessa MI 48849 Pearl Goodemoot (616) 374-7110 Quickbooks 2013 2,272 Lake Orion Village Oakland 21 E. Church Street Lake Orion MI 48362 Darwin McClary (248) 693-8391 Northern Data Systems 2016 2,715 Lake Township Benzie 5153 Scenic Hwy Honor MI 49640 Anne Grobe (231) 325-5202 Quickbooks 2015 635 Lake Township Missaukee 8105 W. Kelly Rd Lake City MI 49651 Kay Ouwinga (231) 839-7655 Peachtree 2016 2,468 Lake Township Roscommon PO Box 536 Houghton Lake MI 48629 Richard Brandt (989) 202-4684 Harris 2016 1,351 Laketon Township Muskegon 2735 N. Giles Rd Muskegon MI 49445 Christina Achterhoff (231) 744-2454 Quickbooks 2010 7,363 Laketown Township Allegan 4338 Beeline Rd Holland Mi 49423 Al Meshkin (616) 335-3050 Fund Balance 2002 2010 5,561 Lakeview Village Montcalm PO Box 30 Lakeview MI 48850 Pam Main (989) 352-6322 ICommander 2012 1,112 Lakewood Club Village Muskegon 6681 N Automobile Rd Twin Lake MI 49457 Wendy Bloem (231) 894-9008 Manual System 2007 2016 1,006 Lakewood Wastewater Authority Ionia 839 4th Ave Lake Odessa MI 48849 Pearl Goodemoot (616) 374-7110 Fund Balance 2013 Lapeer Township Lapeer 1500 Morris Rd Lapeer MI 48446 Dawn Walker 810-664-3700 Quickbooks 2018 5,078 Lathrup Village City Oakland 27400 Southfield Road Lathrup Village MI 48076 Pamela Bratschi (248) 557-2600 x227 Fund Balance 2010 4,075 Lawrence Village Van Buren 157 N Paw Paw St Lawrence MI 49064 Ken Schaut (269) 674-8161 Quickbooks 2008 2009 996 Lawton Village Van Buren PO Box 367 Lawton MI 49065 Andreia Gailhouse (269) 624-6407 Springbrook 2007 2017 1,859 Lee Township Midland 1485 W. Olson Rd Midland MI 48647 Ron Rippee (989) 832-2874 ICommander 2014 4,411 Leighton Township Allegan 4475 Kalamazoo Dr Caledonia MI 49316 Char Troost (616) 891-8238 Quickbooks 2008 2009 3,652 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Lenox Township Macomb 63775 Gratiot Lenox MI 48050 Jodi Kethe (586) 727-2085 x 116 2010 8,433 Leoni Township Jackson 913 5th St Michigan Center MI 49254 Sandi Bird (517) 764-4694 Versys 2003 2015 13,459 Leroy Township Calhoun 8156 4 Mile Rd East Leroy MI 49051 Sharon Gasser (269) 979-9421 Munis 2003 2015 3,240 Leroy Township Ingham 1685 N. M 52 Webberville MI 48892 Roberta Hamlin (517) 521-3729 Excel 2007 2009 3,653 Leroy Township Osceola 15210 200th Ave Leroy MI 49655 Heather Marks (231) 768-5798 2010 1,159 Leslie City Ingham PO Box 496 Leslie MI 49251 Cheryl Neu (517) 589-8236 Fund Balance 2003 2009 2,044 Lexington Township Sanilac 7227 Huron Avenue Suite 200 Lexington MI 48450 Kathryn Calmita (810) 359-5500 Cogitate 2015 3,688 Lexington Village Sanilac 7227 Huron Ave Lexington MI 48450 Shelly McCoy (810) 359-8631 Fund Balance 2015 1,104 Lima Township Washtenaw PO Box 59 Chelsea MI 48118 Arlene Bareis (734) 475-2202 Fund Balance 2003 2015 3,224 Lincoln Charter Township Berrien PO Box 279 Stevensville MI 49127 Stacy Loar-Porter (269) 429-1589 x20 Fund Balance 2014 13,952 Lincoln Park City Wayne 1355 Southfield Rd Lincoln Park MI 48146 Lisa Griggs (313) 386-1800 x 231 Munis 2010 40,008 Linden City Genesee 132 E. Broard Street Linden MI 48451 Lynn Henry (810) 735-7980 Fund Balance 2014 2,861 Litchfield City Hillsdale PO Box 236 Litchfield MI 49252 Jill Howard (517) 542-2921 Versys 2003 2010 1,458 Little Traverse Township Emmet 8288 S Pleasantview Rd Harbor Springs MI 49740 Jane Taylor (231) 526-0351 Resource 2004 2011 2,426 Loch Alpine Sanitary Authority Washtenaw 827 N Zeeb Rd Ann Arbor MI 48103 Sandy Egeler (734) 433-0835 Fund Balance 2003 2014 Locke Township Ingham 3805 Bell Oak Rd Williamston MI 48895 Dorothy Hart (517) 468-3405 Quicken 2007 2009 1,671 Long Lake Township Grand Traverse 8870 N Long Lake Rd Traverse City MI 49684 Trish Mehney (231) 946-2249 ext 16 Fund Balance 2015 7,648 Lowell Charter Township Kent 2910 Alder Nash SE Lowell MI 49331 Linda Regan (616) 897-7600 Our Town 2014 5,219 Lowell City Kent 301 E Main St Lowell MI 49331 Suzanne Olin (616) 897-8457 CMI 2009 4,013 Ludington City Mason 400 S Harrison St Ludington MI 49431 Deborah Luskin (231) 845-6237 Versys 2007 2009 8,357 Luna Pier City Monroe PO Box 375 Luna Pier MI 48157 Michelle Cureton (734) 848-8120 ext 200 Fund Balance 2002 2013 1,483 Lyons Township Ionia PO Box 187 Lyons MI 48851 Edith Lincoln (989) 855-2016 Resource 2003 2015 3,446 Lyons Village Ionia PO Box 175 Lyons MI 48851 Paul Tunell (989) 855-2125 Quickbooks 2005 2012 339 Mackinac County Mackinac 100 Marley Street St. Ignace MI 49781 Nora Massey (906) 643-7318 Harris 2014 11,042 Mackinaw City Village Emmet 102 S Huron Ave Mackinaw City MI 49701 Patti Peppler (231) 436-5351 Fundware 2012 809 Macomb Township Macomb 54111 Broughton Rd Macomb MI 48042 Karen Goodhue (586) 992-0710 x2262 Munis 2016 50,478 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Madison Charter Township Lenawee 4008 S Adrian Hwy Adrian MI 49221 Janet Bovee (517) 263-9313 Fund Balance 2012 8,200 Madison Heights City Oakland 300 W 13 Mile Rd Madison Heights MI 48071 Gary Fiscus (248) 837-2680 Sunguard Bi- Tech 2004 2011 31,101 Mancelona Area Sewer & Water Antrim PO Box 940 Mancelona MI 49659 Penny Dupuie (231) 587-0744 Quickbooks 2013 Manchester Township Washtenaw 275 S Macomb St Manchester MI 48158 Ann Becktel (734) 428-7090 Quicken 2008 2013 4,102 Manchester Village Washtenaw 912 City Manchester MI 48158 Julie Schaible (734) 428-7877 Fund Balance 2015 2,160 Manistee City Manistee PO Box 358 Manistee MI 49660 Edward Bradford (231) 723-2558 x 7 Fund Balance 2017 6,586 Manistee County Manistee 415 3rd Street, Admin Office Steele MI 49660 Roger J. Elbers (231) 398-3529 Accucomp 2005 2010 24,420 Manistique City Schoolcraft 300 N Maple St Manistique MI 49854 Sheila Aldrich (906) 341-2090 Open Windows (Harris) 2013 3,583 Manlius Township Allegan 3134 57th St Fennville MI 49408 Kathy Lubbers (269) 561-8855 Quickbooks 2012 2,634 Manton City Wexford PO Box 100 Manton MI 49663 Teresa Loving (231) 824-3572 Northern Data Systems 2014 1,221 Maple Rapids Village Clinton PO Box 200 Maple Rapids MI 48853 Mindy Thomas (989) 682-9227 Quickbooks 2018 643 Marcellus Village Cass Po Box 429 Marcellus MI 49067 Jacqveline La Budie 269-646-5485 Peachtree 2019 6,113 Marine City St Clair 303 S Water St Marine City MI 48039 Mary Ellen McDonald (810) 765-8847 Fund Balance 2008 2010 4,652 Marlette City Sanilac 6436 Morris St Marlette MI 48453 Sarah Kady (989) 635-7433 Fund Balance 2016 2,104 Marquette Charter Township Marquette 1000 Commerce Drive Marquette MI 49855 Dulcee Storch (906) 228-6220 Fund Balance 2014 3,286 Marquette City Marquette 300 W. Baraga Ave Marquette MI 49855 Daniel Frederickson (906) 225-4356 GEMS 2012 20,714 Marquette County Marquette 234 W. Baraga Ave Marquette MI 49855 Paul Carley (906) 225-8472 Harris 2014 67,676 Marquette County Health Department Marquette 234 W. Baraga Ave Marquette MI 49855 Paul Carley (906) 225-8472 Harris 2014 Marshall Area Firefighters Assoc Calhoun 323 W Michigan Ave Marshall MI 49068 Mark Burk (269) 781-9819 Quickbooks 2004 2008 Marshall City Calhoun 323 W Michigan Ave Marshall MI 49068 Sandy Bird (269) 781-5183 Fund Balance 2012 7,459 Marshall Township Calhoun 13551 Myron Avery Dr Marshall MI 49068 Cynthia Sink (616) 781-7976 Resource 2002 2014 2,922 Martin Township Allegan PO Box 27 Martin MI 49070 Carrie Coburn (269) 672-7663 Peachtree 2006 2009 2,514 Martin Village Allegan 1609 N Main St Martin MI 49070 Joyce Merrill (269) 672-7777 CPW 2013 435 Marysville City St Clair 1111 Delaware Ave Marysville MI 48040 Carolyn East (810) 364-6613 Port Huron System 2006 2010 9,684 Mason City Ingham PO Box 370 Mason MI 48854 Eric Smith (517) 676-9155 First Computer 2004 2010 6,714 Mason County Mason 304 E Ludington Ave Ludington MI 49431 Timothy Hansen (231) 843-8411 Harris 2003 2009 28,000 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Mason Oceana 911 Oceana 9160 N. Oceana Dr Pentwater MI 49449 Catherine Walker (231) 869-7911 Harris 2010 Mastodon Township Iron 1371 S US 2 Alpha MI 49920 Judith Anne Hines (906) 875-6232 Fund Balance 2004 2011 668 Mattawan Village Van Buren 24221 Front Avenue Mattawan MI 49071 Ruth Goheen (269) 668-2128 Springbrook 2012 1,997 Mayville Village Tuscola 5950 Fox St Mayville MI 48744 Wendy McKenney (989) 843-6621 Cogitate 2011 930 Mecosta County Mecosta 400 Elm St Big Rapids MI 49307 Sherry Earnest (231) 592-0786 Resource 2004 2012 43,186 Mecosta Township Mecosta 19729 11 Mile Rd Big Rapids MI 49307 Mary Quinlan (231) 796-8935 Peachtree 2003 2012 2,435 Melvindale City Wayne 3100 Oakwood Blvd Melvindale MI 48122 Bryan C. Smith (313) 429-1065 New World 2012 10,735 Memphis City Macomb 35095 Potter Street Memphis MI 48041 Jennifer Baranowski (810) 392-2385 Fund Balance 2011 1,129 Menominee City Menominee 2511 10th St Menominee MI 49858 Kathy Brofka (906) 863-1740 Fund Balance 2005 2012 9,131 Menominee County Menominee 839 10th Ave Menominee MI 49858 Brian Bousley (906) 863-7779 Pontem 2016 23,791 Meridian Charter Township Ingham 5151 Marsh Rd Okemos MI 48864 Diana Hasse (517) 349-1200 ext 4104 Fund Balance 2002 2008 39,116 Merritt Township Bay 48 E Munger Rd Munger MI 48747 Kathy Bremer (989) 659-2136 EZ Entry 2012 1,510 Metamora Township Lapeer 730 W. Dryden Rd Metamora MI 48455 Suzanne Clark 810-678-3345 Quickbooks 2018 4,184 Metamora Village Lapeer PO Box 117 Metamora MI 48455 Tina Sauve 810-678-2932 Quickbooks 2019 564 Michiana Village Berrien 4000 Cherokee Dr Michiana MI 49117-9187 Anne Heywood (269) 469-4600 Quickbooks 2009 182 Middle Branch Township Osceola 16692 20th Ave Marion MI 49665 Peggy Hoard (231) 743-6342 Manual System 2005 2016 858 Middlebury Township Shiawassee PO Box 622 Ovid MI 48866 Susan Tomasek-Swan (989) 834-5842 Manual System 2011 1,491 Middleville Village Barry PO Box 69 Middleville mi 49333 Chris Mugriage (269) 795-3385 ForFund 2009 2,721 Midland Charter Township Midland 1030 S. Poseyville Rd Midland MI 48640 Shelly Armstrong- Miller (989) 835-8866 Fund Balance 2017 2,297 Midland County Midland 220 W Ellsworth Street Midland MI 48640 Tori Meyer (989) 832-6786 Fund Balance 2018 84,063 Milan City Washtenaw 147 Wabash St Milan MI 48160 Sherry Steinwedel (734) 439-1501 Fund Balance 2002 2014 4,775 Milan Township Monroe 16444 Cone Rd Milan MI 48160 Marg Rock (734) 529-5136 Manual System 2003 2015 1,670 Milford Charter Township Oakland 1100 Atlantic St Milford MI 48381 Cynthia Dagenhardtd (248) 685-8731 Northern Data Systems 2007 2009 15,271 Milford Village Oakland 1100 Atlantic St Milford MI 48381 Penny Ray (248) 684-1515 Fund Balance 2002 2010 6,272 Millington Township Tuscola 8553 State Rd Millington MI 48746 Carrie Petzold (989) 871-4418 EZ Entry 2012 4,459 Millington Village Tuscola 8569 State St Millington MI 48746 Kaylene Long (989) 871-2702 Fund Balance 2018 1,009 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Milton Township Antrim PO Box 309 Kewadin MI 49648 Liz Atkinson (231) 264-6693 Quickbooks 2017 2,072 Missaukee County Missaukee 111 South Canal Lake City MI 49651 Susan Rogers (231) 839-4961 x 242 Accucomp 2012 15,051 Monroe City Monroe 120 E 1st St Monroe MI 48161 Edward Sell (734) 384-9133 Munis 2005 2010 22,076 Monroe County Drain Office Monroe 1005 S Raisinville Rd Monroe MI 48161 Carlene Kostoff (734) 240-3106 Mas 90 2007 2013 Monroe County Land Bank Monroe 51 S Macomb St Monroe MI 48161 Kay Sisung (734) 240-7371 2012 Montague City Muskegon 8778 Ferry St Montague MI 49437 Susanne McGee (231) 893-1155 Fund Balance 2003 2009 2,407 Montague Fire District Authority Muskegon 8778 Ferry St Montague MI 49437 Susanne McGee (231) 893-1155 2013 Montcalm County Montcalm 211 W Main Street Stanton MI 48888 JoAnne Vukin (989) 831-7470 Munis 2017 62,893 Monterey Township Allegan 2888 130th Ave Allegan MI 49010 Jennifer Frank (269) 793-7919 Our Town 2014 2,065 Montmorency County Montmorency 12265 M-32 Atlanta MI 49709 Cherly Neilsen (989) 785-8022 Pontem 2018 9,259 Montrose Charter Township Genesee 139 S Saginaw St Montrose MI 48457 Fred Domine (810) 639-2021 Fund Balance 2008 2009 6,336 Montrose City Genesee 141 Parkway Drive Montrose MI 48457 Dana Hultz (810) 639-6168 Fund Balance 2012 1,619 Morenci City Lenawee 118 Orchard St Morenci MI 49256 Crystal White (517) 458-6828 Fundware 2012 2,398 Mt Clemens City Macomb 1 Crocker Blvd Mt Clemens MI 48043 Linda Kunath (586) 469-6838 Munis 2018 17,312 Mt Morris Charter Township Genesee 5447 Bicentennial Dr Mt Morris MI 48458 Sonya Burns (810) 820-9148 New World 2018 23,725 Mt Morris City Genesee 11649 N Saginaw St Mt Morris MI 48458 Vicki Fishell (810) 686-2160 Fund Balance 2016 3,194 Mt Pleasant City Isabella 320 W Broadway Mt Pleasant MI 48858 Mary Ann Kornexl (989) 779-5381 Versys 2008 2009 25,946 Muir Village Ionia 122 Superior Street Muir MI 48860 Jacklyn Laske (989) 855-2144 Fund Balance 2015 634 Mundy Charter Township Genesee 3478 Mundy Ave Swartz Creek MI 48473 David Guigear (810) 655-4631 Versys 2007 2009 12,191 Munising City Alger 301 E. Superior Street Munising MI 49862 Devin Olson (906) 387-2095 Pontem 2015 2,539 Muskegon Central Dispatch Muskegon 770 Terrace street Muskegon MI 49440 Bill Rensberger 231-332-6600 2019 Muskegon Charter Township Muskegon 1990 Apple Ave Muskegon MI 49442 Erik Joslyn (231) 777-2555 x305 Resource 2003 2012 17,737 Muskegon City Muskegon 933 Terrace Street Muskegon MI 49443 Tim Paul (231) 724-6709 GEMS 2012 40,105 Muskegon County Muskegon 990 Terrace St.Muskegon MI 49442 Dwight Avery (231) 724-6205 Banner 2012 172,344 Muskegon Heights City Muskegon 2724 Peck St Muskegon Heights MI 49444 Lori Doody (231) 733-8851 Fund Balance 2012 12,049 Napoleon Township Jackson PO Box 385 Napoleon MI 49261 Lawrence Kujawa (517) 536-8694 Resource 2002 2015 6,962 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Nashville Village Barry 203 N Main Street Nashville MI 49073 Lynette Adgate 517-852-9544 Fund Balance 2019 1,655 Negaunee Township Marquette 42 East State Hwy M-35 Negaunee MI 49866 Tiffany Filbrandt 906-475-7460 Quickbooks 2019 2,707 New Baltimore City Macomb 36535 Green St New Baltimore MI 48047 Marcia Shinska (586) 725-2151 x108 Fund Balance 2009 7,405 New Buffalo City Berrien 224 W Buffalo New Buffalo MI 49117 Rusty Geisler (269) 469-1500 Fund Balance 2013 2,200 New Buffalo Township Berrien 17425 Red Arrow Highway New Buffalo MI 49117 Jack Rogers (269) 469-1011 Quickbooks 2011 2,468 New Haven Village Macomb 57775 Main St New Haven MI 48048 Greta Jackson (586) 749-5301 x 215 Fund Balance 2011 3,071 New Lothrop Village Shiawassee PO Box 313 New Lothrop MI 48460 Karen Maksimchuk (810) 638-5600 Quickbooks 2005 2014 603 Newaygo City Newaygo 28 State Rd Newaygo MI 49337 Jon Schneider (231) 652-1657 x211 Banyon 2013 1,670 Newfield Township Oceana 3890 S. 198th Ave Hesperia MI 49421 Nancy Conley (231) 854-1635 NO CONVERSION 2009 2,483 Newton Township Calhoun 7988 G Dr S.Ceresco MI 49033 Mary Aldrich (269) 979-3212 Peachtree 2014 2,493 Niles Charter Township Berrien 320 Bell Road Niles MI 49120 Becky Hulett (269) 684-0870 x10 Fund Balance 2014 13,325 North Kent Sewer Authority Kent 7 S Monroe St Rockford MI 49341 Jeff Dood (616) 766-1537 Quicken 2008 2016 North Muskegon City Muskegon 1502 Ruddiman Dr North Muskegon MI 49445 Kristy Mattson (231) 744-1621 Fund Balance 2004 2013 4,031 North Plains Township Ionia 401 S Washington Hubbardston MI 48845 Robert Fahey (989) 981-6141 MS Money 2007 2009 1,366 North Star Township Gratiot 2228 E Hayes Rd Ithaca MI 48847 Cheryl Richmond (989) 875-8933 Quickbooks 2012 996 Northfield Township Washtenaw PO Box 576 Whitmore Lake MI 48189 Cindy Wilson (734) 449-2880 ext 11 Fund Balance 2006 2014 8,252 Northville Charter Township Wayne 44405 6 Mile Rd Northville MI 48167 Marina Neumaier (248) 348-5810 Fund Balance 2002 2010 21,036 Northville City Wayne 215 W Main St Northville MI 48167 Sandi Wiktorowski (248) 449-9912 Fund Balance 2003 2010 6,459 Norton Shores City Muskegon 4814 Henry St Norton Shores MI 49441 Mike Houston (231) 332-2031 Fund Balance 2011 22,527 Norvell Township Jackson 106 E Commercial Street Norvell MI 49263 Andrea Barnett (517) 536-4370 x224 Fund Balance 2018 2,922 Norway City Dickinson PO Box 99 Norway MI 49870 Mary Pollard (906) 563-9961 Fund Balance 2002 2015 2,959 Novi City Oakland 45175 W 10 Mile Rd Novi MI 48375 Carl Johnson (248) 347-0470 First Computer 2006 2009 47,386 Oak Park City Oakland 14000 Oak Park Boulevard Oak Park MI 48237 Jeff Schefke (248) 691-7591 New World 2014 29,793 Oakland Charter Township Oakland 4393 Collins Rd Rochester MI 48306 Kay Smith (248) 651-4440 ext 210 Versys 2003 2009 13,071 Oceana County Oceana 100 State St., STE M-4 Hart MI 49420 Sue Johnson (231) 873-6701 Harris 2014 26,221 Oceola Township Livingston 1577 N Latson Rd Howell MI 48844 Kathy McLean (517) 546-3259 ext 224 Versys 2005 2010 8,362 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Olive Township Ottawa 6480 136th Ave Holland MI 49424 Lona Bronkema (616) 786-9996 Fund Balance 2008 2010 4,691 Olivet City Eaton PO Box 367 Olivet MI 49076 Erin Bierly (269) 749-4961 Quickbooks 2016 1,758 Onekama Township Manistee 5435 Main Street Onekama MI 49675 Michelle Johnson (231) 889-3308 Quickbooks 2017 1,514 Onsted Village Lenawee PO Box 420 Onsted MI 49265 Thanna Oechsle (517) 467-4618 Quickbooks 2010 813 Ontonagon Village Ontonagon 315 Quartz St Ontonagon MI 49953 Penny Hill (906) 884-2305 Fund Balance 2003 2013 1,769 Orangeville Township Barry 8810 Lindsey Rd Plainwell MI 49080 Jennifer Goy (269) 664-4522 Manual System 2005 2017 3,321 Orchard Lake village City Oakland 3955 Orchard Lake road Orchard Lake MI 48323 Rhonda McClellan (248) 682-2400 Fund Balance 2016 2,215 Orion Charter Township Oakland 2525 Joslyn Road Lake Orion MI 48360 Penny Shults (248) 391-0304 x1047 Fund Balance 2017 33,463 Oronoko Charter Township Berrien 4583 E Snow Rd Berrien Springs MI 49103 Suzanne Renton (269) 471-2824 Fund Balance 2016 9,843 Ortonville Village Oakland 476 Mill St Ortonville MI 48462 Mary Clark (248) 627-4976 Versys 2017 1,535 Osceola County Osceola 301 W Upton Ave Reed City MI 49677 Jon-Thomas Burgess (231) 832-5572 Accucomp 2006 2010 23,169 Oscoda Charter Township Iosco 110 S State St Oscoda MI 48750 Jaimie McGuire (989) 739-7532 Versys 2006 2010 7,248 Oshtemo Charter Township Kalamazoo 7275 W Main St Kalamazoo MI 49009 Nancy Culp (269) 375-4260 ForFund 2003 2009 17,003 Otisco Township Ionia 9663 Button Rd Belding MI 48809 Kim Pennock (616) 794-3506 Manual System 2010 2,243 Otisville Village Genesee 300 East St Otisville MI 48463 Lisa Adolph (810) 631-4680 Pontem 2018 882 Otsego City Allegan 117 E Orleans St Otsego MI 49078 Matt Storbeck (269) 692-2741 Munis 2002 2010 3,933 Otsego County Otsego 225 W Main St Ste 203 Gaylord MI 49735 Rachel Frisch (269) 692-2741 Munis 2008 2009 24,158 Otsego Lake Township Otsego PO Box 99 Waters MI 49797 Jerry Brown (989) 732-6923 ext 1 Sage 2015 2,532 Otsego Township Allegan 400 N 16th St Otsego MI 49078 Cindy Hunt (269) 694-9434 Peachtree 2008 2009 4,854 Ottawa Co Public Utility Ottawa 14110 Lakeshore Dr Grand Haven MI 49417 Chris Binker (616) 850-7232 Fund Balance 2007 2010 Ottawa County Central Dispatch Authority Ottawa 519 Washington Ave Grand Haven MI 49417 Jim Bonamy (616) 935-3214 New World 2013 Overisel Township Allegan A-4307 144th Ave Holland MI 49423 Renee Hop (269) 751-7030 Our Town 2013 2,594 Ovid Township Clinton 1015 Baese Ct Ovid MI 48866 Claudia Pluger (989) 834-2838 Quickbooks 2017 3,490 Owosso Charter Township Shiawassee 2998 W M-21 Owosso MI 48867 Pat Skvarenina (989) 723-2187 Peachtree 2005 2013 4,670 Owosso City Shiawassee 301 W Main St Owosso MI 48867 Richard Williams (989) 725-0570 GEMS 2008 2009 15,713 Oxford Charter Township Oakland 300 Dunlap Rd Oxford MI 48371 Joseph Ferrari (248) 628-9787 ext. 105 New World 2014 16,025 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Oxford Village Oakland 22 W Burdick Oxford MI 48371 Susan Nassar (248) 628-2543 Fund Balance 2014 3,540 Paradise Township Grand Traverse 2300 E-M 113 Kingsley MI 49649 Lisa Gulliva (231) 263-5251 Quickbooks 2019 4,191 Park Township Ottawa 52 152nd Ave Holland MI 49424 Jan Steggerda (616) 738-4236 Peachtree 2009 17,579 Parma Township Jackson 2388 Eaton Rapids Rd Albion MI 49224 Don Spangler (517) 829-8277 Pontem 2007 2016 2,696 Pavilion Township Kalamazoo 7510 East Q Avenue Scotts MI 49088 Karen Siegwart (269) 327-0462 ForFund 2011 5,829 Paw Paw Township Van Buren 114 N. Gremps St.Paw Paw MI 49079 David Richardson 269-657-4340 ForFund 2005 2010 7,091 Paw Paw Village Van Buren 111 East Michigan Ave Paw Paw MI 49079 Christopher Tapper (269) 657-3145 CMI 2010 3,534 Pellston Village Emmet 125 N. Milton Street Pellston MI 49769 Lisa Fought (231) 539-7355 Peachtree 2011 771 Peninsula Township Grand Traverse 13235 Center Road Traverse City MI 49686 Monica Hoffman (231) 223-7117 Fund Balance 2014 5,265 Pennfield Charter Township Calhoun 20260 Capital Ave NE Battle Creek MI 49017 Karen Kooi (616) 968-8549 Fund Balance 2002 2014 8,913 Pentland Township Luce PO Box 412 Newberry MI 49868 David Carmody (906) 293-9936 Cogitate 2003 2019 1,788 Pentwater Village Oceana 327 S Hancock St Pentwater MI 49449 Colleen Moser (231) 869-8301 Fund Balance 2013 968 Pere Marquette Charter Township Mason 1699 S Pere Marquette Hwy Ludington MI 49431 Joanne Kelley (231) 845-1277 Harris 2005 2009 2,228 Perrinton Village Gratiot 118 S. Robinson Street Perrinton MI 48871 Julie Henry (989) 236-5161 Quickbooks 2018 397 Perry City Shiawassee 203 W Polly St Perry MI 48872 Joann Velting (517) 625-6155 ext 225 Fund Balance 2014 2,065 Pewamo Village Ionia PO Box 385 Pewamo MI 48873 Sandy Wolniakowski (989) 593-2553 Quickbooks 2006 2009 560 Pierson Township Montcalm 21156 Cannonsville Rd Pierson MI 49339 Kathy Hyrns (616) 636-4911 2017 2,866 Pinckney Village Livingston 220 S Howell St Pinckney MI 48169 Judi Paul (734) 878-6206 Fund Balance 2002 2010 2,141 Pinconning City Bay PO Box 628 Pinconning MI 48650 Terri Hribek (989) 879-2360 Fund Balance 2015 1,386 Pinconning Township Bay 1751 Cody Estey Rd Pinconning MI 48650 Joanne Moody (989) 879-4018 Quickbooks 2010 2,608 Pine River Township Gratiot 1495 W Monroe Rd St Louis MI 48880 Kevin Beeson/Nancy (989) 681-5523 Resource 2006 2008 2,451 Pittsfield Charter Township Washtenaw 6201 N Michigan Ave Ann Arbor MI 48108 Tracy Watkins (734) 822-3110 Fund Balance 2012 30,167 Plainfield Charter Township Kent 6161 Belmont Ave NE Belmont MI 49306 Warren Smith 616-726-8886 Springbrook 2018 30,195 Plainwell City Allegan 141 N Main St Plainwell MI 49080 Sandra Lamorandier (269) 685-6821 Munis 2004 2009 3,933 Pleasant Plains Township Lake PO BOX 239 Baldwin MI 49304 Kellie Allen (231) 745-4851 Manual System 2013 1,535 Pleasant Ridge City Oakland 23925 Woodward Avenue Pleasant Ridge MI 48069 Amy Drealan (248) 541-2900 Fund Balance 2009 2,594 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Plymouth Charter Township Wayne 9955 N. Haggerty Rd Plymouth MI 48170 Ron Edwards (734) 354-3214 AS400 2015 27,798 Plymouth City Wayne 201 S Main St Plymouth MI 48170 Tom Alexandris (734) 453-1234 ext 201 Fund Balance 2007 2010 9,022 Polkton Charter Township Ottawa 6900 Arthur Street Coopersville MI 49404 William Sahlberg (616) 837-6876 Quicken 2016 2,335 Pontiac City Oakland 47450 Woodward Pontiac MI 48342 Joseph Sobota (248) 758-3129 Banner 2012 66,337 Port Austin Area Water & Sewer Huron PO Box 367 Port Austin MI 48467 Ken Rutkowski (989) 738-8366 NO CONVERSION 2002 2013 Port Austin Village Huron PO Box 336 Port Austin MI 48467 Judith Binbly (989) 738-5199 Manual System 2007 2018 737 Port Huron City St Clair 100 McMorran Blvd Port Huron MI 48062 James Brennan (810) 984-9729 Port Huron System 2020 32,338 Port Sheldon Township Ottawa 16201 Port Sheldon St West Olive MI 49460 Kathy Van Voorst (616) 399-6121 Custom 2004 2013 4,503 Portage City Kalamazoo 7900 S. Westnedge Ave Portage MI 49002 Devin Mackinder (269) 324-9217 HTE 2014 44,897 Portage Sewer Authority Livingston PO BOX 726 WHITEMORE LAKE MI 48189 Tony Randazzo (810) 231-5600 Quickbooks 2010 Portland City Ionia 259 Kent St Portland MI 48875 Kristina Kinde (517) 647-2933 CMT 2008 2010 3,789 Potterville City Eaton PO Box 488 Potterville MI 48876 Aaron Sheridan 517-645-7641 Fund Balance 2019 2,168 Powell Township Marquette PO Box 39 Big Bay MI 49808 Sara Drury Quickbooks 2008 2009 724 Prairieville Township Barry 10115 S. Norris Rd.Delton MI 49046 Ted DeVries (269) 623-2664 Pontem 2010 3,175 Presque Isle County Presque Isle 151 Huron Ave Rogers City MI 49779 Bridget LaLonda (989) 734-4075 Pontem 2018 12,841 Presque Isle Township Presque Isle 12653 E. Grand Lake Rd Presque Isle MI 49774 Cynthia Paavola 589-595-2752 Pontem 2018 1,691 Pulaski Township Jackson 12363 Folks Rd Hanover MI 49241 Kathy Petrakovitz (517) 524-6061 NO CONVERSION 2007 2015 1,931 Quincy Village Branch 47 Cole St Quincy MI 49082 Eric Zuzga (517) 639-9065 Peachtree 2004 2011 1,701 Raisin Charter Township Lenawee 5525 Occidental Hwy Tecumseh MI 49286 Betty Holdridge (517) 423-3162 ext 1002 Quickbooks 2006 2014 6,507 Raisinville Township Monroe 96 Ida-Maybee Rd Monroe MI 48161 Janet Kuehnlein (734) 269-2506 Fund Balance 2004 2015 4,896 Ravenna Village Muskegon 12090 Crockery Creek Drive Ravenna MI 49451 Sandy Rollenhagen (231) 853-2360 Fund Balance 2010 1,206 Redford Charter Township Wayne 15145 Beech Daly Redford Township MI 48239 Suzanne Moreno (313) 387-2769 Pentamation 2013 51,622 Region 2 Planning Commission Jackson 120 W Michigan Ave Jackson MI 49201 Julie Hill (517) 788-4426 GSS 2006 2017 Reno Township Iosco 6672 Miller Rd Whittemore MI 48770 Cheryl Hottois (989) 756-3475 Manual System 2005 656 Resort Township Emmet PO Box 848 Petoskey MI 49770 Susan Coveyou (231) 347-7915 Quickbooks 2018 2,479 Richfield Township Genesee 5381 N State Rd Davison MI 48423-8595 Joseph Madore (810) 653-3564 Fundware 2014 8,170 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Richland Township Kalamazoo 7401 N 32nd St Richland MI 49083 Jackie Light (269) 629-4921 ForFund 2008 2012 6,491 Richmond City Macomb 68225 Main St Richmond MI 48062 Angel Hatfield (586) 727-7571 Fund Balance 2018 4,897 Riley Township St Clair 13042 Belle River Rd Riley MI 48041 Dawn Franz (810) 392-3585 2013 3,046 River Rouge City Wayne 10600 W Jefferson Ave River Rouge MI 48218 Susan Joseph (313) 842-5604 Versys 2008 2010 9,917 Riverview City Wayne 14100 Civic Park Dr Riverview MI 48192 Denise Kuch (734) 281-4200 New World 2008 2009 13,272 Rives Township Jackson 8427 Rives Jct. Rd.Rives Jct.MI 49277 Stacy Stoner (517) 569-2288 Manual System 2013 4,725 Robinson Township Ottawa 12010 120th Ave Grand Haven MI 49417 Christine Saddler (616) 846-2210 Our Town 2017 5,588 Rochester City Oakland 400 Sixth Street Rochester MI 48307 Anthony Moggio (248) 651-9061 Fund Balance 2017 10,467 Rochester Hills City Oakland 1000 Rochester Hills Dr Rochester MI 48307 Joe Snyder (248) 656-4664 2017 68,825 Rockford City Kent 7 South Monroe Street Rockford MI 49341 Linda Lehman (616) 866-1537 Springbrook 2006 2011 4,626 Rockwood City Wayne 32409 Fort St Rockwood MI 48173 Cindy Trombley (734) 379-9496 Caselle 2016 3,442 Rogers City Presque Isle 193 E Michigan Ave Rogers City MI 49779 Theresa Heinzel (989) 734-2191 ACS 2005 2014 3,322 Rollin Township Lenawee PO Box 296 Manitow Beach MI 49253 Irma David (513) 218-1628 Pontem 2015 3,176 Romeo Village Macomb 121 W. St. Clair Romeo MI 48065 Sherri Maddox 586-752-3565 Fund Balance 2020 3,721 Romulus City Wayne 11111 Wayne Rd Romulus MI 48174 Suzanne Moreno (734) 955-4566 HTE 2015 22,979 Roosevelt Park City Muskegon 900 Oak Ridge Road Roosevelt Park MI 49441 Anthony Chandler (231) 755-3721 Fund Balance 2013 3,890 Roscommon County Roscommon 500 Lake Street Roscommon MI 48653 Jodi Valentino (989) 275-7134 Pontem 2016 23,955 Roscommon Village Roscommon PO Box 236 Roscommon MI 48653 Nicole Crespo (989) 275-5743 Fund Balance 2012 1,133 Rose Township Oakland 9080 Mason St Holly MI 48442 Debbie Miller (248) 634-8701 Vadim 2010 6,210 Roseville City Macomb 29777 Gratiot Ave Roseville MI 48066 Phil Longueuil (586) 447-4675 Munis 2008 2010 48,129 Ross Township Kalamazoo 12086 M-89 Richland MI 49083 Monica Markillie (269) 731-4888 Peachtree 2017 5,047 Rothbury Village Oceana 7804 S. Michigan Ave Rothbury MI 49452 Deb Murphy (231) 301-5162 2017 426 Royal Oak City Oakland 211 Williams St Royal Oak MI 48067 Melanie Halas (248) 246-3055 GEMS 2011 60,062 Royalton Township Berrien 980 Miners Road St Joseph MI 49085 Patti Knight (269) 429-2501 Pontem 2015 3,888 Rutland Charter Township Barry 2461 Heath Rd Hastings MI 49058 Robin Hawthorne (269) 948-2194 Resource 2003 2015 3,646 Saginaw Charter Township Saginaw 4980 Shattuck Rd Saginaw MI 48603 Michele Gadd (989) 791-9820 AS400 2007 2009 39,657 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Saginaw City Saginaw 1315 S. Washington Ave Saginaw MI 48601 Jeff Klopcic (989) 759-1414 HTE 2013 61,799 Salem Township Allegan 3003 142nd Ave Dorr MI 49323 Betty Brower (616) 896-9857 Our Town 2013 3,486 Salem Township Washtenaw 9600 6 Mile Rd Salem MI 48175 David Trent (248) 349-1690 ext 19 Fund Balance 2007 2013 5,562 Saline City Washtenaw 100 N Harris St Saline MI 48176 Mickey Jo Bennett (734) 429-4907 ext 2203 Northern Data Systems 2018 8,034 Sand Lake Village Kent 2 Maple St.Sand Lake MI 49343 Judy Howard (616) 636-8854 Asyst 2011 492 Sandusky City Sanilac 26 W Speaker St Sandusky MI 48471 Laurie Thompson (810) 648-4444 Fund Balance 2016 2,745 Sanilac County Sanilac 60 West Sanilac Ave Sandusky MI 48471 Meagan Green 8106482933 x8205 Harris 2018 42,605 Sanilac Township Sanilac 20 North ridge Street Port Sanilac MI 48469 Suzanne Shagenn 810-662-8178 Cogitate 2020 2,609 Saugatuck City Allegan 102 Butler St Saugatuck MI 49453 Kirk Harrier (269) 857-2603 Fund Balance 2007 2010 1,065 Saugatuck Township Allegan 3461 Blue Star Highway Saugatuck MI 49453 Aaron Sheridan (269) 857-7721 Fund Balance 2012 3,590 Schoolcraft County Schoolcraft 300 Walnut Street Rm 164 Manistique MI 49854 Beth Edwards (906) 341-3618 Fund Balance 2017 8,173 Schoolcraft Township Kalamazoo 50 E VW Ave Vicksburg MI 49097 Teresa Scott (269) 649-1276 2015 7,260 Schoolcraft Village Kalamazoo 442 N. Grand St Schoolcraft MI 49087 Faith Akert (269) 679-4304 Fund Balance 2003 2011 1,587 Scio Township Washtenaw 827 N Zeeb Rd Ann Arbor MI 48103 Jim Merte (734) 665-2123 Fund Balance 2003 2009 15,759 Scottville City Mason 105 N. Main Street Scottville MI 49454 Amy Williams (231) 757-4729 Fund Balance 2018 1,266 Sebewaing Light & Water Department Huron 110 W Main Sebewaing MI 48759 Melanie McCoy (989) 883-2700 Quickbooks 2013 Sebewaing Village Huron 110 W Main Sebewaing MI 48759 Melanie McCoy (989) 883-2700 Pontem 2013 1,974 Selma Township Wexford 5262 E 32 Rd Cadillac MI 49601 Vicki Flory (231) 775-5071 Accucomp 2007 2009 1,915 Shelby Village Oceana 189 Maple St Ste B Shelby MI 49455 Peggy Miller (231) 861-4400 Fund Balance 2010 2015 1,914 Shepherd Village Isabella 251 W Wright Shepherd MI 48883 Gina Gross (989) 828-5278 ICommander 2010 1,536 Sheridan Township Calhoun 13355 29 Mile Rd Albion MI 49224 Ken Laur (517) 629-2604 x103 EZ Entry 2009 2,116 Sheridan Village Montcalm PO Box 179 Sheridan MI 48884 Marilyn Klemm (989) 291-3485 Quickbooks 2014 705 Sherman Township Mason 3566 N. Custer Rd Scottville MI 49454 Kurt Lubben 231-462-3205 Our Town 2018 1,090 Shiawassee County Shiawassee 208 N. Shiawassee St Corunna MI 48817 Cindy Richmond 517-886-9536 Harris 2019 68,446 Shiawassee District Library Shiawassee 301 W Main St Owosso MI 48867 Jodi Fox (989) 725-0504 GEMS 2008 2010 Sims Township Arenac 4489 E. Huron Rd Au Gres MI 48703 Judy Mackie (989) 876-8631 Quickbooks 2017 1,091 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Sodus Township Berrien 4056 King Drive Sodus MI 49126 Cheryl Andres (269) 926-6285 Quickbooks 2015 2,139 Solon Township Kent 2305 19 Mile Rd NE Cedar Springs MI 49319 John Rideout (616) 696-1718 Our Town 2005 2017 4,662 South Haven City Van Buren 539 Phoenix St.South Haven MI 49090 Wendy Hochstedler (269) 637-0714 Caselle 2013 5,021 South Lyon City Oakland 335 S Warren South Lyon MI 48178 Lynne Ladner (248) 437-1735 Fund Balance 2015 10,036 South Macomb Disposal Authority Macomb 23200 Gratiot Ave Eastpointe MI 48021 Randall Blum (586) 445-5034 2013 South Rockwood Village Monroe PO Box 85 South Rockwood MI 48179 Willene Harold (734) 379-3683 Manual System 2005 2014 1,284 Southeast Macomb Sanitary District Macomb 23200 Gratiot Ave Eastpointe MI 48021 Randall Blum (586) 445-5034 2013 Southern Clinton County Muncipal Utilities Authority Clinton 3671 W Herbison Rd Dewitt MI 48820 Lisa Mead (517) 669-8311 Fund Balance 2009 Southfield City Oakland 26000 Evergreen Rd Southfield MI 48076 LaVern Laury 248-796-4962 2018 78,296 Southgate City Wayne 14400 Dix-Toledo Rd Southgate MI 48195 David Angileri (734) 258-3017 Versys 2007 2009 30,136 Southwest Barry County Sewer & Water Authority Barry 11191 S M-43 Hwy Delton MI 49046 Karen Wilson (269) 623-3401 Peachtree 2008 2015 Southwest Michigan Building Authority Kalamazoo 7275 W Main St Kalamazoo MI 49009 Nancy Culp (269) 375-4260 2016 Southwest Michigan Regional Sanitary Sewer & Water Authority Berrien 980 Miners Road St Joseph MI 49085 Audrey Skamer 269-429-2501 Fund Balance 2018 Spalding Township Menominee PO Box 161 Powers MI 49874 Jerry Bartnicki (906) 497-5850 Cogitate 2014 1,761 Sparta Township Kent 160 E Division Street Sparta MI 49345 Marcy Savage (616) 887-8863 Fund Balance 2015 8,938 Sparta Village Kent 156 E Division St Sparta MI 49345 Sharon DeLange (616) 887-8251 Fund Balance 2010 4,159 Spaulding Township Saginaw 5025 East Rd Saginaw MI 48601 Tara Stinson (989) 777-0950 Fund Balance 2010 2,399 Spring Arbor Township Jackson PO Box 250 Spring Arbor MI 49283 Julia Stonestreet (517) 750-2800 x210 Fund Balance 2002 2009 7,577 Spring Lake Township Ottawa 106 S Buchanan St Spring Lake MI 49456 Carolyn Boersma (616) 844-2101 New World 2002 2010 13,140 Spring Lake Village Ottawa 102 W Savidge St Spring Lake MI 49456 Maribeth Lawrence (616) 842-1393 Fund Balance 2004 2010 2,514 Springfield Charter Township Oakland 12000 Davisburg Rd Davisburg MI 48350 Laura Moreau (248) 846-6510 Versys 2005 2011 13,338 Springfield City Calhoun 601 Avenue A Springfield MI 49037-7774 Jeannine Turner (269) 965-8014 Fund Balance 2003 2012 5,189 Springport Township Jackson PO Box 174 Springport MI 49284 Becky Wilson (517) 857-2030 Manual System 2005 2016 2,182 Springport Village Jackson PO BOX 128 Springport MI MI 49284 Jennifer Naylor Civic Systems 2019 704 St Charles Village Saginaw 110 W Spruce St St Charles MI 48655 Deanna Koehler (989) 866-8257 Fund Balance 2016 2,002 St Clair City St Clair 547 N. Carney Dr St Clair MI 48079 Mike Booth (810) 329-7876 Springbrook 2016 5,802 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population St Clair Township St Clair 1539 S Bartlett Rd St Clair MI 48079 Debbie Rickert (810) 329-9042 Fund Balance 2003 2009 6,423 St Ignace City Mackinac 396 N State St St Ignace MI 49781 Renee Vonderwerth (906) 643-8545 Harris 2011 2,678 St Johns City Clinton PO Box 477 St Johns MI 48879 Greg Teichman (989) 224-8944 ext 225 Fund Balance 2011 7,485 St Joseph Charter Township Berrien PO Box 147 St Joseph MI 49085 Audrey Skamer (269) 932-0273 Fund Balance 2015 9,963 St Joseph City Berrien 700 Broad St St Joseph MI 49085 Deb Koroch (269) 983-4731 Fund Balance 2007 2009 8,789 St Joseph County St Joseph 125 W Main St Centreville MI 49032 Joni Smith (269) 467-5631 AS400 2013 60,946 St Louis City Gratiot 108 W Saginaw St.St Louis MI 48880 Bobbie Marr (989) 681-6024 CMI 2013 4,494 Stanton City Montcalm 225 S. Camburn Street Stanton MI 48888 Elizabeth Pynaert (989) 831-4440 Fund Balance 2017 1,504 Stephenson City Menominee W628 Samuel St Stephenson MI 49887 Judy St. Juliana (906) 753-6228 CYMS 2008 2010 875 Stockbridge Village Ingham PO Box 155 Stockbridge MI 49285-0155 Timothy Sadowski (517) 851-7435 Resource 2003 2009 1,260 Sullivan Township Muskegon 8138 Heights Ravenna Rd Ravenna MI 49451 Beth Sims (231) 853-6900 Quickbooks 2006 2016 2,477 Summerfield Township Clare 9971 N. Finley Lk Ave.Harrison MI 48625 Aloma Joslin (989) 539-2501 Excel 2011 453 Summit Township Jackson 2121 Ferguson Rd Jackson MI 49203 Dave McCumber (517) 788-4113 ext 231 Pontem 2016 21,534 Sumpter Township Wayne 23480 Sumpter Road Belleville MI 48111 Karen Armatis (734) 461-6201 x2239 Fund Balance 2016 11,856 Superior Charter Township Washtenaw 3040 N Prospect Rd Ypsilanti MI 48198 Susan Mumm (734) 482-6099 Fund Balance 2003 2012 10,740 Superior Township Chippewa PO Box 366 Brimley MI MI 49715 William Beaune 906-248-3219 Fund Balance 2019 1,329 Suttons Bay Village Leelanau Po box 395 Suttons Bay MI 49682 Shar Fay 231-271-3051 Fund Balance 2018 589 Swan Creek Township Saginaw 11415 Lakefield Rd St Charles MI 48655 Aimee Glazier 989-865-6251 Asyst 2019 2,536 Swartz Creek City Genesee 8083 Civic Dr Swartz Creek MI 48473 Juanita Aguilar (810) 635-4464 Fund Balance 2008 2010 5,102 Sylvan Lake City Oakland 1820 Inverness St Sylvan Lake MI 48320 Dennise Dryden (248) 682-1440 Fund Balance 2007 2010 1,735 Sylvan Township Washtenaw 18027 Old US 12 Chelsea MI 48118 Rodney Branham (734) 475-8890 Fund Balance 2013 6,425 Tallmadge Charter Township Ottawa 0-1451 Leonard St NW Grand Rapids MI 49534 Brenda Martin (616) 677-1248 Versys 2006 2015 6,881 Tawas City Iosco PO Box 568 Tawas City MI 48764 Annette Corey (989) 362-8688 Fund Balance 2009 2,005 Tecumseh City Lenawee 309 E Chicago Blvd Tecumseh MI 49286 Leisa Still (517) 424-6549 Fund Balance 2013 8,574 Tekonsha Village Calhoun 537 Church St Tekonsha MI 49092 Bob Main (517) 767-4204 Fund Balance 2009 717 Texas Charter Township Kalamazoo 7110 W Q Ave Kalamazoo MI 49009 Linda Kerr (269) 375-1591 ForFund 2005 2012 10,919 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Thomas Township Saginaw 249 N Miller Rd Saginaw MI 48609 Deidre Frollo (989) 781-0150 Fund Balance 2016 11,877 Thompsonville Village Benzie 14714 Lincoln Ave Thompsonville MI 49683 Tim Windrim (231) 378-2521 Peachtree 2014 457 Thornapple Township Barry PO Box 459 Middleville MI 49333 Susan Vlietstra (269) 795-7202 ForFund 2003 2010 6,685 Three Oaks Village Berrien 14 Maple St Three Oaks MI 49128 David Grosse (269) 756-9221 Quickbooks 2007 2010 1,622 Three Rivers City St Joseph 333 West Michigan Three Rivers MI 49093 Catherine Lawson (269) 273-1075 x109 Fund Balance 2012 7,328 Torch Lake Township Antrim 2355 N US 31 Eastport MI 49627-0663 Sharon Schultz (231) 599-2036 Our Town 2012 1,159 Traverse City Grand Traverse 400 Boardman ave Traverse City MI 49684 Penny Hill 231-922-444 AS400 2018 14,532 Trenton City Wayne 2800 3rd St Trenton MI 48183 Theresa Monthei (734) 675-7200 Pentamation 2005 2009 19,584 Tuscarora Township Cheboygan PO Boc 220 Indian River MI 49749 Sue Fisher Cogitate 2018 3,091 Tuscola County Tuscola 440 N State St Caro MI 48723 Clayette Zechmeister 989-672-3710 Harris 2019 52,764 Tyrone Township Livingston 10408 Center Rd Fenton MI 48430 Vicki Butler (810) 629-8631 ext 206 Fund Balance 2008 2009 8,459 Ubly Village Huron 2241 Pierce Street Ubly MI 48475 Jason Nicol 989-553-0240 Quickbooks 2019 873 Union Charter Township Isabella 2010 S Lincoln Rd Mt Pleasant MI 48858 Mike Kantner (989) 772-4600 ext. 240 Resource 2009 7,615 Union City Village Branch 208 N. Broadway St.Union City MI 49094 James Campfield (517) 741-8591 CMI 2011 1,804 Utica City Macomb 7550 Auburn Rd Utica MI 48317 Catherine McGrail (586) 739-1600 Northern Data Systems 2010 4,577 Valley Township Allegan 2054 N M-40 Allegan MI 49010-9417 Brandee Ellis (269) 673-5962 Quicken 2008 2012 1,831 Van Buren Charter Township Wayne 45425 Tyler Rd Belleville MI 48111 Vern Morse (734) 699-8909 x9206 Springbrook 2015 23,559 Van Buren County Van Buren 219 E. Paw Paw St. Suite 303 Paw Paw MI 49079-1429 Stephen Vicenzi (269) 657-8200 Pontem 2015 75,199 Vandalia Village Cass PO Box 57 Vandalia MI 49095 Beth James (269) 476-2344 Manual System 2003 2019 429 Vassar City Tuscola 287 E. Huron Vassar MI 48768 Merri Lemcke (989) 823-8517 Fund Balance 2017 2,823 Vergennes Township Kent 10381 Bailey Dr Lowell MI 49331 Mari Stone (616) 897-5671 Our Town 2012 3,611 Vermontville Village Eaton 121 Eastside Dr Vermontville MI 49096 Nathan Derusha (517) 726-1429 Quickbooks 2011 759 Vernon Township Shiawassee PO Box 354 Durand MI 48429 Charlotte Clark 586-915-1149 Pontem 2020 4,980 Vernon Village Shiawassee PO Box 175 Vernon MI 48476 Ellen Glass (989) 288-2300 Fund Balance 2018 785 Vevay Township Ingham 780 S Eden Rd Mason MI 48854 JoAnne Keane (517) 676-9523 Pontem 2011 3,614 Vicksburg Village Kalamazoo 126 N Kalamazoo Ave Vicksburg MI 49097 Matt Crawford (269) 649-1919 Springbrook 2005 2014 2,320 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Victor Township Clinton 6843 Alward Rd Laingsburg MI 48848 Mike Wall (517) 651-2094 Cogitate 2012 3,275 Vienna Charter Township Genesee 505 W Vienna St Clio MI 48420 Stacey \ Sherrie (810) 686-7580 Fundware 2015 13,108 Wales Township St Clair 1372 Wales Center Rd Wales MI 48027 Cynthia Bobcean (810) 325-1517 Manual System 2005 2013 2,986 Walker City Kent 4243 Remembrance Rd NW Walker MI 49534 Cindy Mielke (616) 791-6799 Versys 2009 21,842 Walled Lake City Oakland 1499 E West Maple Walled Lake MI 48390 Colleen Coogan (248) 624-4847 Springbrook 2011 6,713 Warren City Macomb One City Square Suite 420 Warren MI 48093 Tom Pawelkowski (586) 759-9220 IDC 2017 138,247 Warren Police & Fire Pension Macomb One City Square Suite 415 Warren MI 48093 Gregory Suma (586) 574-4568 Excel 2012 Washington Charter Township Macomb 57900 Van Dyke Washington MI 48094 Kathy Bosheers (586) 786-0010 x2 Fund Balance 2012 19,080 Water District No. 1 Midland PO Box 320 Sanford MI 48657 David Rothman (989) 513-8491 Quickbooks 2017 Waterloo Township Jackson 11120 Musbach Rd Munith MI 49259 Janice Kitley (517) 596-8400 Fund Balance 2010 3,069 Watertown Charter Township Clinton 12803 S. Wacousta Rd Grand Ledge MI 48837 Angie Baum (517) 626-6593 x212 Fund Balance 2014 4,162 Watervliet Charter Township Berrien 4959 N. M-140 Waterviet MI 49098 Patt Bambrick (269) 463-5113 Fund Balance 2016 2,964 Watervliet City Berrien PO Box 86 Watervliet MI 49098 David Brinker (269) 463-6769 Fund Balance 2010 1,843 Waverly Township Van Buren 42114 M-43 Paw Paw MI 49079 Sandy Oakleaf (269) 657-1776 ForFund 2009 2,467 Wayland City Allegan 103 S Main Street Wayland MI 49348 Cheri Parrish (269) 792-2265 Versys 2007 2010 3,939 Wayland Township Allegan 1060 129th Street Bradley MI 49311 Ann Mclnerney (269) 792-6394 Peachtree 2013 3,013 Wayne City Wayne 3355 S Wayne Rd Wayne MI 48184 Tim McCurley (734) 722-2000 First Computer 2005 2013 19,051 Webberville Village Ingham PO Box 389 Webberville MI 48892 Rachel Howd (517) 521-3984 Harris 2006 2010 1,503 Webster Township Washtenaw 5665 Webster Church Rd Dexter MI 48130 Bill Sinkule (734) 426-5103 Fund Balance 2002 2012 6,784 West Bloomfield Charter Township Oakland PO Box 250130 West Bloomfield MI 48325 Mark Osinski (248) 451-4802 Sunguard Bi- Tech 2009 64,860 West Bloomfield Parks & Recreation Oakland 4640 Walnut Lake Rd West Bloomfield MI 48323 Jennifer Tucker 248-451-1906 Manual System 2018 West Branch City Ogemaw 121 N. Fourth Street West Branch MI 48661 John Dantzer (989) 345-0500 Fund Balance 2016 1,926 West Traverse Township Emmet PO Box 353 Harbor Springs MI 49740 Bob Sanford (231) 526-7361 Peachtree 2005 2012 1,448 Westland City Wayne 36601 Ford Rd Westland MI 48185 Dan Bouredeau (734) 467-7952 HTE 2013 86,602 Wexford County Wexford 437 E Division St Cadillac MI 49601 Elaine Richardson 231 779-9452 Accucomp 2007 2010 32,886 Wheatfield Township Ingham 985 Holt Rd Williamston MI 48895 Holly Miller (517) 655-4161 Quickbooks 2019 1,641 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Wheeler Township Gratiot 8510 E Monroe Wheeler MI 48662 Kelly Bushre (989) 842-3428 Quickbooks 2010 2,785 White Lake Charter Township Oakland 7525 Highland Rd White Lake Township MI 48383 Mike Roman (248) 698-3300 x120 Vadim 2015 28,219 Whiteford Township Monroe 8000 Yankee Spring Rd Suite 100 Ottawa Lake MI 49267 Angela Christensen (734) 854-2416 Manual (pencil)2011 4,420 Whitehall City Muskegon 405 E Colby St Whitehall MI 49461 Laurie Audo (231) 894-4048 Fund Balance 2004 2009 2,884 Williams Charter Township Bay 1080 W. Midland Rd Auburn MI 48611 Amy Charney (989) 662-4408 EZ Entry 2012 4,492 Williamston City Ingham 161 E Grand River Ave Williamston MI 48895 Alan Dolley (517) 655-2774 Fund Balance 2002 2013 3,441 Williamstown Township Ingham 4990 N Zimmer Rd Williamston MI 48895 Mickey Martin (517) 655-3193 Quickbooks 2007 2011 4,834 Wixom City Oakland 49045 Pontiac Trl Wixom MI 48393 Marilyn Stamper (248) 624-0885 Fundware 2015 13,263 Woodhaven City Wayne 21869 West Rd Woodhaven MI 48183 Katherine Oehring (734) 675-4913 Fund Balance 2003 2010 12,530 Woodhull Township Shiawassee 7315 Beard Rd Shaftsburg MI 48882 Carol Maize (517) 675-4342 Resource 2009 2015 3,850 Worth Township Sanilac PO Box 248 Lexington MI 48450 Marcella Bartniczak (810) 359-8852 Cogitate 2006 2010 4,021 Wright Township Ottawa PO Box 255 Marne MI 49435 Linda Way (616) 677-3048 Versys 2005 2014 3,286 Wyandotte City Wayne 3200 Biddle Ave., Suite 200 Wyandotte MI 48192 David Fuller (734) 324-7106 HTE 2014 28,006 Wyoming City Kent PO Box 905 Wyoming MI 49509 Andrea Boot (616) 530-7282 New World 2012 69,368 Yale City St Clair 111 W. Mechanic St Yale MI 48097 John Osborn (810) 387-3311 Fund Balance 2014 2,063 Yankee Springs Township Barry 284 N Briggs Rd Middleville MI 49333 Janice Lippert (269) 795-9091 ForFund 2011 4,219 York Charter Township Washtenaw 11560 Stony Creek Rd Milan MI 48160 Helen Neill (734) 439-0587 NO CONVERSION 2003 2014 7,392 Ypsilanti Charter Township Washtenaw 7200 S Huron River Dr Ypsilanti MI 48197 Javonna Neel (734) 544-3601 Fund Balance 2012 49,182 Zeeland Charter Township Ottawa 6582 Bryon Rd Zeeland MI 49464 Tami Koomen (616) 772-6701 Fund Balance 2009 5,805 Zeeland City Ottawa 21 S Elm St Zeeland MI 49464 Rose Borst (616) 772-0871 Versys 2004 2009 5,805 Zilwaukee City Saginaw 319 Tittabawassee Rd Saginaw MI 48604 Jeff Zittel (989) 755-0931 Pontem 2012 1,799 Standish Township Arenac PO Box 944 Standish MI MI 48658 Sue Kohn 989-718-3213 Quickbooks 2020 2,026 Escanaba City Delta 410 Ludington Street Escanabe MI 49829 Kim Gustafson 906-786-0240 Caselle 2020 13,140 Sterling Heights City Macomb 40555 Utica Road Sterling Heights MI 48313 Jennifer Varney 586-446-2302 Munis 2020 124,471 Wolverine Lake Village Oakland 425 Glenway Wolverine Lake MI 48390 Michael Smith 248-624-6434 Fund Balance 2020 4,783 Ironwood Charter Township Gogebic N10892 Lake Rd Ironwood MI 49938 Mary Segalin (906) 932-8446 Quickbooks 2020 2,330 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Sault Ste Marie City Chippewa 225 E. Portage Ave Sault Ste Marie MI 49783 Kristen Collins 906-635-5261 2020 16,542 Tawas Township Iosco 993 N. Plank Rd Tawas City MI 48763 Melissa Stewart 989-254-7759 Cogitate 2020 1,684 Bellevue Village Eaton 201 N. Main Street Bellevue MI 49021 Jessica Tirrell 269-763-9571 Quickbooks 2020 1,365 Richmond Township Osceola 3371 220th Ave Reed City MI 49677 Linda Stieg 231-832-2880 2020 1,695 Laingsburg City Shiawassee 114 N. Woodhull Laingsburg MI 48848 Paula Willoughby 517-651-5566 Pontem 2020 1,223 Sanilac County Health Dept Sanilac 171 Dawson Street, Ste 123 Sandusky MI 48471 Shane Welch 810-648-4098 2020 Ovid City Clinton PO Box 138 Ovid MI 48866 Josy Medina 989-834-5550 Pontem 2020 1,514 Genesee County Genesee 1101 Beach Street Flint MI 48502 Chrystal Simpson 810-257-3092 GEMS 2020 405,815 Beulah Village Benzie 7228 Commercial St Beulah MI 49617 Dan Hook 248-496-5003 Quickbooks 2020 341 North Branch Township Lapeer 6771 Elm Street North Branch MI 48461 Amy Bridger-Snoblen (810) 688-2785 Pontem 2020 3,595 Ray Township Macomb 64255 Wolcott Rd Ray MI 48096 Doug Stier (586) 749-5171 x205 Pontem 2020 3,740 Nottawa Township Isabella PO Box 189 Weidman MI 48893 Judy Schumacher 989-289-9078 Pontem 2020 2,278 Inland Township Benzie 19668 Honor Hwy Interlochen MI 49643 Linda Wilson 231-275-6568 Pontem 2020 1,587 Klacking Township Ogemaw MI Ellen Rush 989-685-9093 Pontem 2020 617 Wheatland Township Mecosta 201 S. Sheridan Remus MI 49340 Mary Karcher 989-967-8252 Sage 2020 1,474 Brown City Sanilac PO Box 99 Brown City MI 48416 David Van Cura 810-346-2325 Pontem 2020 1,334 Almont Township Lapeer 819 N Main St Almont MI 48003 Roberta Kudsin (810) 798-8521 x2003 Pontem 2020 6,041 Westphalia Village Clinton PO Box 8 Westphalia MI 48894 Sandy Smith (989) 587-4434 Quickbooks 2020 876 Columbia Township Van Buren PO Box 323 Grand Junction MI 49056 Christy Case 269-434-6227 x1 Peachtree 2020 2,714 Whitefish Township Chippewa PO Box 350 Paradise MI 49768 Karen Bender 574-529-0009 Quickbooks 2020 588 Reese Village Tuscola PO Box 369 Reese MI 48757 Bonnie Gray 989-868-4503 Pontem 2020 1,374 Forest Township Genesee 130 E. Main Street Otisville MI 48463 Linda Smoke 810-631-6645 Quickbooks 2020 4,738 Lyon Township Roscommon PO Box 48 Higgins Lake MI 48627 Doug Schnell 989-821-9694 x201 Pontem 2020 1,462 Ogemaw County Ogemaw 806 W. Houghton Ave West Branch MI 48661 Caren Piglowski 989-345-0215 Pontem 2020 20,952 Tittabawassee Township Saginaw Po Box 158 Freeland MI 48623- 0158 Mary Edgington 989-692-7935 Fund Balance 2020 7,706 Oregon Township Lapeer 2525 Marathon Rd Lapeer MI 48446 H. Paul Spencer 810-664-5971 Pontem 2020 6,166 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Windsor Charter Township Eaton 405 W Jeffersin St Diamondale MI 48821 Lisa Rumsey 517-646-0772 Pontem 2020 7,340 Lapeer City Lapeer 576 Liberty Park Lapeer MI 48446 Kelly Hannah 810-664-2902 Caselle 2020 9,072 Springvale Township Emmet 8198 East Mitchell Road Petoskey MI 49770 Patricia McCune 231-347-3077 Pontem 2020 1,727 Monitor Charter Township Bay 2483 Midland Rd Bay City MI 48706 Linda Ferguson 989-684-7203 Pontem 2020 10,037 Forsyth Township Marquette 186 W Flint Street Gwinn MI 49841- 1360 Lynn Rodgers (906) 346-9217 2021 4,824 Marion Village Osceola W1362 US Hwy St Ignance MI 49781 Susan Dionne (906) 643-8027 Pontem 2021 872 Bates Township Iron 3070 US 2 East Iron River MI 49935 Bee Benson-Stafford 906-265-2787 x1 Pontem 2021 1,021 Standish City Arenac 399 E. Beaver St. Standish MI 48658 Jerry Nelson 989-846-9588 Fund Balance 2021 1,581 Luce County Luce PO Box 116 Seney MI MI 49883 Janice Bonifield 906-293-5544 Pontem 2021 6,283 Wise Township Isabella 7160 N. Wise Rd Clare MI 48617 Doris Methner 989-339-0546 Pontem 2021 1,301 Alexandria City Douglas 704 Broadway Alexandria MN 56308 Jane Blade (320) 759-3625 Banyon 2018 11,121 Brainerd City Crow Wing 501 Laurel Street Brainerd MN 56401 Connie Hillman 218-454-3401 Tyler Incode 2020 13,428 Dayton City Hennepin 12260 S. Diamond Lake Rd Dayton MN 55327 Amy Benting 763-421-1791 Banyon 2018 5,011 Delano City Wright Po Box 108 Delano MN 55328 Jennifer Williams 763-972-0569 Banyon 2019 6,059 Hutchinson City McLeod 111 Hassan St. SE Hutchinson MN 55350 Tom Kloss (320) 234-4245 Civic SQL 2015 13,929 Hutchinson Utilities McLeod 111 Hassan St. SE Hutchinson MN 55350 Tom Kloss (320) 234-4245 LOGIS 2017 New Brighton City Ramsey 803 Old Highway 8 NW New Brighton MN 55112 Brenda Davitt (651) 638-2101 Legacy Borrough AS400 2016 22,073 Prior Lake City Scott 4646 Dakota St. SE Prior Lake MN 55372 Jerilyn Erickson (952) 447-9841 United Software Technology 2014 23,754 Shoreview City Ramsey 4600 North Victoria St Shoreview MN 55126 Fred Espe (651) 490-4622 Legacy Borrough AS400 2017 25,931 Three Rivers Park District Hennepin 3000 Xenium Lane North Plymouth MN 55441 Howard Koolick (763) 559-6734 HTE 2018 Victoria City Carver 1670 Stieger Lake Lane Victoria MN 55386 Kelly Grinnell (952) 443-2417 Banyon 2016 8,030 Forest Lake City Washington 1408 Lake Street South Forest Lake MN 55025 Daniel Undem 651-209-9727 Springbrook 2020 1,659 Robbinsdale City Hennepin 4100 Lakeview Ave N Robbinsdale MN MN 55422 Jeff Zuba 763-531-1215 LOGIS 2020 14,534 Berkeley City St. Louis 8425 Airport Rd Berkeley MO 63134 Debby Stein (314) 524-3313 x3722 Interfund 2013 8,976 Camden County Camden 1 Court Circle NW, Suite 1 Camdenton MO 65020 Jimmy Laughlin 573-317-3868 AS400 2019 45,632 Cassville City Barry 300 Main Street Cassville MO 62625 Steve Walensky 417-847-4441 Banyon 2018 3,340 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Cole County Cole 301 S. High Street Jefferson City MO 65101 Kristen Berhorst (573) 634-9122 New World 2015 76,699 Festus City Jefferson 711 W. Main Street Festus MO 63028 Pat Parsons (636) 937-4694 Interfund 2013 11,602 Herculaneum City Jefferson 1 Parkwood Court Herculaneum MO 63048 Ronna Alaniz (636) 475-4447 Interfund 2014 3,468 Overland City St. Louis 9119 Lackland Road Overland MO 63114 Melissa Burton (314) 227-2912 GovernMENTOR 2015 16,000 Columbus City Platte 2424 14th Street Columbus NE 68602 Heather Lindsley 402-562-4229 AS400 2019 23,128 Gretna City Sarpy PO Box 69 Gretna NE 68028 Tammy Tisdall (402) 332-3336 x210 Summit 2017 5,584 La Vista City Sarpy 8116 Park View Blvd La Vista NE 68128 Pam Buethe (402) 331-4343 Summit 2016 17,562 Norfolk City Madison 309 N. 5th Street Norfolk NE 68701 Leon Gentrup (402) 844-2000 x2121 AS400 2014 23,516 Hooksett Town Merrimack 35 Main Street Hooksett NH 03106 Christine Soucie (603) 485-2712 BMSI 2013 13,451 North Conway Water Precinct Carroll PO Box 630 North Conway NH 3860 Jason Gagnon 603-356-5382 BMSI 2019 Chester Town Rockingham 84 Chester Street Chester NH 03036 Joanne Smith 603-887-3636 x103 BMSI 2020 4,768 Canal Winchester City Fairfield 36 S. High St Canal Winchester OH 43110 Amanda Jackson (614) 837-6937 Ohio Software Services 2015 7,393 Clark County Clark 31 N. Limestone St Springfield OH 45502 Robert Vanderhorst (937) 521-1871 ISSG 2015 142,376 Columbus & Franklin County Metropolitan Parks District Franklin 1069 Main Street Westerville OH 43081 Rick McGivern 614-895-6204 2019 Muskingum County Muskingum 401 Main Street Zanesville OH 43701 Debra Nye 740-455-7129 ISSG 2019 86,149 Oxford City Butler 101 E. High Street Oxford OH 45056 Joe Newlin (513) 524-5228 CMI 2014 21,444 Preble County Preble 101 East Main Street Eaton OH 45320 Lavon Wright (937) 456-8148 ISSG 2018 42,083 Shaker Heights Public Library Cuyahoga 16500 Van Arken Blvd Shaker Heights OH 44120 Susan Ritchey 216-367-3007 CMI 2019 Warrensville Heights City Cuyahoga 4301 Warrensville Center Road Warrensville Heights OH 44128 Karen Howse 516-587-1043 2020 13,216 Altoona City Blair 1301 Twlefth St. Suite 100 Altoona PA 16601 Victor Curfman (814) 949-2538 UBS 2017 44,589 Dormont Borough Allegheny 1444 Hillsdale Avenue Dormont PA 15216 Jeffrey Naftal (412) 561-8900 x228 Freedom Systems 2014 8,600 Montgomery Township Montgomery 1001 Stump Rd Montgomeryville PA 18936 Shannon Drosnock (215) 393-6933 SunGard Pentamation 2015 25,000 Silver Spring Township Cumberland 8 Flowers Drive Mechanicsburg PA 17050 Raymond Palmer (717) 766-0178 x3320 Freedom Systems 2017 17,469 Bennettsville City Marlboro 501 E. Main Street Bennettsville SC 29512 Rebekah Hayes (843) 479-9001 Harris 2017 8,833 Conway City Horry 1000 Second Ave Conway SC 29526 Allison Williams 843-488-7632 Nicholson Business Systems 2020 23,714 Easley City Pickens 205 North First Street Easley SC 29640 Joni Smith 864-810-0966 Smart Fusion 2018 20,953 Customer County Address City State Zip Contact Phone Converted From Pervasive Since .NET Since Population Isle of Palms City Charleston PO Box 508 Isle of Palms SC 29451 Debbie Suggs (843) 256-5708 Harris 2017 4,340 James Island Public Service District Charleston 1739 Signal Point Road Charleston SC 29412 James Game 943-998-6175 Fund Balance 2019 North Charleston Sewer District Charleston PO Box 63009 North Charleston SC 29419 Matt Clark (843) 764-2658 HTE 2016 Sullivan's Island Town Charleston 2050 B Middle Street Sullivan's Island SC 29482 Jason Blanton (843) 883-5751 Smart Fusion 2017 1,791 Brown Deer Village Milwaukee 4800 W Green Brook Drive Brown Deer WI 53223 Bridget Souffrant (414) 371-3040 Caselle 2012 11,715 Butler Village Waukesha 12621 W. Hampton ave Butler WI 53007 Kayla Chadwick 262-783-2525 Banyon 2018 1,846 Franklin City Milwaukee 9229 W. Loomis Road Franklin WI 53132 Paul Rotzenberg (414) 427-7514 ACS 2013 35,504 Glendale City Milwaukee 5909 north Milwaukee River Parkway Glendale WI 53209 Shawn Lanser (414) 228-1717 Caselle 2012 12,580 Greenfield City Milwaukee 7325 W. Forest Home Ave Greenfield WI 53220 Paula Schafer (414) 329-5285 HTE 2015 37,072 19 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 BS&A has included a summary project plan within this proposal and is able to complete this software implementation on time, and on budget. We fully understand the scope of this project including software installation, data conversions, project management, program training, and follo w up support. All software and services proposed will be provided by BS&A Software, Inc. Furthermore, BS&A is the sole developer of our software systems. With the exception of hardware, our solution does not encompass any third-party product and services. We have completed 100’s of implementations similar to this one, and are well positioned to handle this project. We will begin the implementation process as soon as the agreements are signed. Approximately 15 staff members will be involved throughout the implementation and training process. No other vendor will work with you, or care more about your project than the staff of BS&A Software. BS&A offers a fully integrated financial management solution. Additionally, we do have the ability to interface third party software with several of our applications using built in generic import/export features. All of our programs are built with the Microsoft .NET software development platform, using the latest tools available. All programs work with SQL Server 2008 or newer, which provides for the linking of databases through a seamless grouping method. What this means for our customers is: a) a reduction in data entry errors, b) minimal duplicate entry, and c) overall increased productivity. 20 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 These are just a few of the many benefits of our fully integrated Financial Management system: Drill-down feature in General Ledger allows for instant access to the originating source document. Clickable links on reports allow users to jump to the detailed, underlying transaction information for a “summary-type” report line - even across applications. All reports can be emailed or printed to Excel, PDF, or other applications and file formats. Individual User Report Profiles allow users to run memorized sets of reports. Fully integrated Budgeting with Budget Footnotes and Long Term Budget Forecasting. Over budget notifications are available within all applications. Automatic posting of encumbrance entries when a purchase order is approved in the Purchase Order application and then converted to an invoice in Accounts Payable. Fully integrated receipting process - Cash Receipting updates linked applications in real time. View journal detail and posting information from any application. GL number verification in all applications. Streamlined Check Reconciliation and Bank Reconciliation process from one application. Comprehensive capabilities for budgeting all personnel costs and fringes through integrated position based budgeting. User Groups allow you to set the same user rights for multiple users at once. This reduces the need to set up user-based security for several users with similar or identical rights in the system. Users can be set up to login automatically to the program using Windows Active Directory user names and passwords. Detailed audit tracking to log virtually all changes made. Financial Management Applications General Ledger BS&A’s General Ledger application is the foundation of our Financial Management Suite, incorporating Budgeting, Long-Term Financial Forecasting, and Project/Grant Accounting. Because these functions are the core of any financial system, we do not treat them as add-on modules, but as integral components of General Ledger. The General Ledger application acts as the final data storehouse for financial entries from seamlessly integrated applications, such as Accounts Payable, Cash Receipting, Utility Billing, Property Tax, and Miscellaneous Receivables. Our wide range of interfaces allows for the posting of transactions from other, non-BS&A products. Data is only useful if it is easily accessible. That’s why we provide many standard reports, which can be customized to meet your various needs… eliminating the necessity of add-on modules. Complete and integrated GASB 34 reports and an easy-to-use Report Writer provide unmatched reporting flexibility. Budgeting and Long-Term Budget Forecasting The Budgeting function supports decentralized budget entry, imports of preliminary budgets from spreadsheets, and multiple, user-definable budget levels. The final budget document is user-definable as well, or may be saved as a spreadsheet to give you unlimited options in formatting. Budget footnotes may be printed on the final budget document. Long-Term Budget Forecasting allows for up to 10 years of future projections, which may be saved as budget snapshots for “what-if” budget analysis; there is no limit to the amount of snapshots you can create. Statistical forecast calculations may be overridden on an ad-hoc basis to accommodate known future financial events. 21 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Cash Flow Analysis Cash Flow Analysis features enhance awareness of upcoming cash flow needs through powerful tools and rich graphical displays. Intuitive screens enable you to customize statistical and graphical data views. Integrated GASB 34 Reporting All GASB 34 reports are built in; there is no need for a separate reporting module. Adjustment journal entries can be made in a separate Adjustments fund or in a dedicated GASB 34 Adjustments screen. You can run statistical reports to identify major/minor funds with supporting calculations. Reports can be generated in a summary format – the prescribed reporting format – or in a detailed format, which shows all general ledger balances and adjustments. Summary report formats also provide drill-down into individual account balances. Complete Account and Bank Reconciliation Many software applications use the term “reconciliation,” when in fact they merely offer the ability to mark checks as cleared. In addition to identifying open and cleared check transactions - manually or electronically via export file from your bank – BS&A’s General Ledger application groups cash transactions by deposit and reconciles other transactions (e.g., manual journal entries) that affect cash. This enables a c omplete reconciliation between your general ledger account balances and your corresponding bank account balances. Automatic Interfund Accounting Entries Interfund accounting throughout General Ledger is managed by flexible settings. All entries created in linked applications (Accounts Payable or Cash Receipting, for example) are balanced between funds via automatic “due to/due from” entries when necessary. Flexible, Sophisticated Security Features System Administrators will appreciate the flexibility gained by our robust security features. Setup and maintenance of user security settings - for all applications - is easily accomplished from one central location. In addition, fund-, department-, and account-based security settings control access and posting to relevant accounts within your general ledger. Comprehensive Reporting We include over 60 standard reports in the General Ledger application. These may be used as-is, modified to fit your needs, or used as the basis for an entirely new report that you can create in our Report Writer, a tool that is built in; there is no extra charge. Report Profiles may be created to group selected reports for subsequent one-click printing. Reports may be printed, viewed on-screen, exported to Excel, or saved in a variety of formats including PDF, HTML, or text. Detailed Report Drill-Down In addition to the benefit of printing BS&A reports to the screen, saving time and paper, selected reports offer a drill-down feature for a greater level of detail. This provides easy balancing while viewing one report – there is no need to run subsequent reports from ancillary applications to gather supporting detail. For example, click on any transaction line in the Account Activity Report to view the source document (Accounts Payabl e check, Payroll check, Receipt, etc.). Unlimited History BS&A’s General Ledger application maintains an unlimited number of years of general ledger and transaction history, and makes that history useful. Comparative historical reports can be run to show nominal and budgetary amounts, displaying data from any or all fiscal years. Seamless spreadsheet integration allows unlimited statistical analysis of historical data. 22 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Extensive Import/Export Capabilities Journal entries may be imported from third-party applications via a number of formats or from Excel spreadsheets. In addition to the capabilities integral with the reporting system, all data is accessible via user- definable exports. Accounts Payable In addition to the standard invoice entry/check printing functionality, BS&A’s Accounts Payable application interfaces with our billing applications for easy tracking and maintenance of refund requests. This integration offers one-click viewing of the status of check requests from the originating department, freeing the AP staff from fielding refund-related questions. Integrated Imaging System BS&A’s Imaging System, included with Accounts Payable, allows batch scanning of invoices for electronic processing and paperless archiving. Positive Pay Positive Pay is set up using your bank’s specifications. The easily-created export file provides a list for your bank to use as a cross-reference, an important component in check fraud prevention. Full Integration with BS&A Purchase Order In addition to increased budgetary control, integration with BS&A Purchase Order eliminates duplicate entry of purchase information – simply select the PO for payment, and all data is automatically filled out. Accounts Payable easily accommodates partially-filled purchase orders by correctly relieving encumbered amounts. Electronic Check Requests Refunds processed in linked billing applications can be transferred to Accounts Payable automatically. Simply select a pending Check Request for payment, and relevant information is automatically filled in. Linked applications can query Accounts Payable for the status of the check request. For example, the Utility Billing clerk can look up requested information (check cut? check cleared?) without having to consult with the Accounts Payable clerk. Purchasing Card Support BS&A’s Accounts Payable application imports transactions from your Purchasing Card vendor. Detailed tracking of purchasing information is tied to the true vendor, while payments are made to the issuer of the Purchasing Card. ACH Payment Features The convenience and security of paying invoices via ACH transfer is just as straightforward as a check run using paper checks. Once a vendor has been set up as being paid via ACH, the application does the rest. Upon processing an ACH check run, you’ll be prompted to generate the ACH file. Simply answer “Yes” and transfer the file as instructed by your bank. Notifications The Notifications pane shows pending recurring invoices, pending check requests, unjournalized invoices/checks, and unposted journal entries. 23 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Flexibility to Handle Different Banking Situations Pay invoices from multiple checking accounts, pooled cash accounts, or single or multiple paying funds with automatic interfund accounting handled (parameters are defined in the General Ledger application). No knowledge of interfund accounting is necessary for Accounts Payable processing. Sophisticated Budget Integration Budgetary control is maintained via real-time budget availability verification. All invoices entered, regardless of status (open or posted) are reflected in the calculation of available balance. Budget override permissions are controlled via flexible security settings. Customizable Check Formats Check formats are completely customizable to your paper forms. Security-controlled printing on blank check stock is supported, saving you the expense of stocking different forms for each bank. Easy Check Reconciliation AP checks may be easily reconciled, either manually or electronically from a bank-supplied file. The application interfaces seamlessly with system-wide bank/account reconciliation. Cash Receipting BS&A Cash Receipting provides for flexible receipt entry scenarios while maintaining a centralized system for cash reporting. Counter and Department Transmittal modes deliver flexibility for a variety of receipting needs. End-of-day deposit processing seamlessly integrates with our General Ledger application for true account reconciliation. Integrates Fully With BS&A Billing Applications as well as Third-Party Software Cash Receipting not only integrates with our billing applications, but also provides the ability to import receivables from third-party software. A flexible, user-definable interface facilitates account and amount verification, and subsequent export of receipts to those applications. Flexible Receipt Item Setup Flexible receipt item setup lets you add receipt items from linked BS&A applications, and add user-defined receipt items to handle charges not maintained in BS&A applications. Receipt items may be set up to link to third-party billing systems by way of an end-of-day procedure that automatically creates exports customized to those systems. Flexible, Centralized or Decentralized Receipting Modes Cash Receipting supports centralized receipting, centralized deposit of receipts processed off -site, as well as function-specific receipting from external locations on- or off-network. Barcode Scanning Support Scanning of barcoded bills dramatically decreases data entry time and increases accuracy. With the ability of our Utility Billing, Miscellaneous Receivables, Community Development, and Property Tax applications to produce customized, barcoded bills, you get the benefits of centralized receipting for all functions along with enhanced speed and accuracy. Department Receipting Templates Initially designed for the interdepartmental receipting requirements of counties, this feature is useful for any municipality where cash is processed in multiple decentralized locations, but deposited centrally. 24 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Subsidiary Database Creation Decentralized locations may process receipts into separate databases, isolating their receipts by function. These transactions are then easily transferred as summary entries in the main database when receipts are presented to the main office for deposit for easy, automated cash reconciliation and tracking. Deposit Creation Receipt transactions are easily grouped by deposit, providing quick balancing and easy end -of-month reconciliation of deposits. Cash Receipting can even print the deposit ticket. System-Wide Receivables Lookup Simply by entering a name or address, all BS&A applications that generate bills (Utility Billing, Tax, etc.) are queried to generate a detailed list of items owed and the grand total. Any or all bills may then be marked and processed for payment. Easy Batch Entry of Receipts Repetitive receipts – for example, utility bill mail payments – may be entered as fast as the barcoded bills can be scanned. Running batch totals are then matched up with the total moneys received. Real-Time Posting of CR Data to Ancillary Applications Transactions entered into Cash Receipting update the corresponding billing system real-time, meaning there is no lag between the entry of a receipt and the update of the customer’s account status, and no need to wait until end-of-day posting for the account to be updated. This greatly reduces the volume of “duplicate- payment” refund checks issued. Miscellaneous Receivables Billing software needs to be flexible to handle receivables outside of the normal tax and utility billings. Our Miscellaneous Receivables application was designed from the ground up to deliver this flexibility. Recurring Invoices Recurring invoices can be quickly generated in batches, eliminating the need to manually create each invoice and speeding data entry for repetitive billings. Credits Credits may be applied to a customer’s account, whether for overpayment or to adjust the amount billed on an invoice. ACH File Creation and Paperless Billing Streamline your payment process by using ACH – payments can be automatically debited from customers’ bank accounts. Additionally, bills can be emailed to customers who want to go paperless. Bad Debt Write-off Past due accounts determined to be uncollectable may be written off by creating the appropriate bad debt expense entry in BS&A General Ledger. Penalty Assessment This flexible process assesses penalties based on a percentage, flat amount, or table of percentages/amounts calculated on number of days past due. 25 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Aging Reports Reconcile the outstanding balance by general ledger number as of a given date with the corresponding balance in BS&A General Ledger. Electronic Check Requests Refunding an overpayment to a customer is done through an electronic check request process with BS&A Accounts Payable, eliminating the need for the AP clerk to hand-enter the invoice for payment. You can quickly ascertain if: a) a check request has been converted to an invoice for payment; b) the converted invoice has been paid; c) the check has been cleared by the bank. This greatly increases accuracy and speeds up response time. Collection The process of sending unpaid receivables to collection includes the ability to account for them using a separate general ledger number. Lienable Billing Items Billing items considered lienable may be transferred to the customer’s property tax bill by way of a wizard. This wizard handles all aspects of the process, including adjustment creation on the customer’s accounts and reclassification of the receivable balance in General Ledger. Billing Item Level Security Security settings are available to quickly and easily configure which billing items will be available on a user -by- user basis. Purchase Order BS&A's Purchase Order application is designed to maximize your control over purchasing decisions while maintaining maximum flexibility and ease of use. The graphical flowchart-based workflow setup simplifies the complex task of translating your approval rules to an electronic model, enhancing control over the purchasing, budgeting, and bidding process. Integrated Bid Processing functionality provides electronic maintenance of bids and quotes. Integrated, Graphic Workflow and Approval Process Graphical flowcharts illustrate and aid in the setup of the approval decision workflow, greatly increasing ease- of-use. Drag and drop to set up the “next-in-line” to approve a requisition or purchase order. Templates provide easy duplication of workflow for similar items. Requisitions and PO Approval via the Web, Email, or Smart Phone Purchasing decision-makers can approve or deny off-site, reducing the number of employees to be granted authorization power. You can leave the office without wondering what’s being purchased without you r knowledge. Easy Change Order Process Change orders are easily entered, with accessible history of all changes. All pre-encumbrance and encumbrance accounting is handled automatically. 26 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Pre-Encumber at Requisition Level Setting up requisitions to pre-encumber funds prior to approval provides notification that pending requisitions exist and prevents potential over-spending prior to PO approval. Denial of requisition automatically frees up funds. Automatic Transfer to BS&A Fixed Assets Purchases of capital assets may be identified at the time of requisition. This flows through the approval process to the time of purchase, automatically updating BS&A Fixed Assets. Duplicate entry of asset-related transactions is eliminated. In addition, rules can be set in order to specify amounts and accounts that automatically flag purchases for asset creation. Bid Tracking Bidders are maintained separately from vendors, yet are easily converted to vendors. The approval/denial feature of bidding information gives you complete maintenance control. Mass Approval/Denial of Requisitions You can approve/deny a mass of requisitions from a single screen. Requisitions can be selected individually or by group, and once approved, quickly converted into purchase orders. Fixed Assets GASB 34 made the accurate tracking and reporting of fixed assets critical. By integrating with the other components of our Financial Management Suite, the Fixed Assets application greatly simplifies the tracking of these items, without sacrificing accuracy. GASB 34-Compliant Reporting Reports necessary for financial statement note disclosure are included. No separate reporting module is needed. Construction in Progress Construction projects can be tracked and automatically converted to capital assets once completed. Integration with BS&A Purchase Order and BS&A General Ledger Purchase orders may be flagged as asset purchases, facilitating electronic transfer to BS&A Fixed Assets. In addition, rules can be set in the Purchase Order applicat ion to specify amounts and accounts that automatically flag purchases for asset creation. Depreciation and disposal accounting information is posted to General Ledger. This tight integration eliminates errors and duplication of data entry. Flexible Asset Disposal Assets can be partially disposed based on quantity, dollar amount, or percentage of total cost, eliminating the need to record each asset as an individual for disposal purposes. For example, library books can be recorded as a lump sum and then written off as a percentage of the original cost. The application also supports partial asset transfers, splits, repairs, and disposition, including partial disposal. Complete, Easily-Accessible Asset History The book value as of a specific date may be determined at any time. 27 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Payroll Power, flexibility, and accuracy are the hallmarks of our Payroll application. Designed to automate the most complex compensation and deduction scenarios, it supports all necessary reports for quarterly reporting, including W2 processing and electronic submission. Simple direct deposit processing and emailing of check stubs in a password-protected PDF format supports paperless offices. Direct Deposit Secure ACH direct deposit decreases paper handling and reduces the potential for check fraud. Employees’ deposits may be spread to an unlimited number of bank accounts, and check stubs may be emailed to employees in a password-protected PDF format. Customizable Year-to-Date Screen You can easily view YTD information for each employee based on user-defined parameters. Items that can be displayed include: pay codes, deductions/expenses, leave balances, and direct deposit amounts. You can also drill down to individual transactions to ascertain which checks are included in the totals, and print transaction registers that show details. Remittance Checks Create remittance checks in Payroll, keeping all payroll transactions in one application. Leave Accrual Our flexible means of accruing and tracking leave time based on user-definable parameters includes: a) maximum number of hours allowed in each leave bank; b) number of hours that may be carried forward to the next year; c) frequency of accrual (e.g., monthly, first of the year, anniversary date, etc.); d) accrual method based on a table (e.g., number of years worked). W2 Processing Automated W2 processing uses all IRS-supported formats including the EFW2 file creation for submission to the Social Security Administration. Flexible Deduction Setup Complex deduction scenarios are easily set up and can be customized for each employee from the setup screen without having to access each employee’s screen. Child support and garnishment calculations are built in, and deductions can be set up using tables to reduce the amount of deduction codes needed. 941 Quarterly Reports You can transfer report totals to the 941 Quarterly form. All calculations are done on one report. Self-Administered Retirement Plans Manage contributions, interest, and withdrawals for self-administered retirement plans. Generate customized retirement statements and re-print previous statements. Positive Pay Positive Pay is set up using your bank’s specifications. The export file is easily created and provides a list for your bank to use as a cross-reference, preventing check fraud. Accrued Wages and Liabilities A simple process allows you to post a percentage of a payroll back to a previous accounting period. 28 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Integration with BS&A Timesheets Employees may enter their own time to be approved and imported into Payroll, reducing payroll processing time. Hours are recorded and approved in Timesheets before the payroll is processed. Scheduled Rate Increases Employee raises, including rate table updates and step increases, can be scheduled to allow rates to be split automatically in the middle of a pay period. Human Resources By utilizing both desktop and web-based components, BS&A's Human Resources application streamlines job posting, employee application, hiring, and employee tracking. The Position Budgeting feature seamlessly integrates with the Budgeting component of our General Ledger application. Integration with BS&A Payroll Integration allows for Human Resources users to view Payroll information, without needing access to the Payroll application. Change Requests are used to handle segregation of duties, while simultaneously reducing the need for duplicate data entry and providing a notification between departments when changes are made. Applicant Tracking Track basic applicant information such as address, phone number, etc., and more detailed information such as employment and education history. Employment Tracking Track employee beneficiary information, benefit plans, continuing education credits, reviews, position history, rate history, and many more HR-related items. Easy Transition from Applicant to Employee Full integration with BS&A Payroll allows successful applicants to be easily converted to employees, ready for immediate payroll processing. Employment Applications via the Web Electronic employment applications reduce the amount of staff time and resources devoted to processing and storing paper applications. Prospective employees may apply via the web or at a designated on-site workstation. Position Tracking Track current employees, openings, and applications by Position. Position Tracking saves time by storing user- defined position requirements and defaults to facilitate the setup of new employees. Position Budgeting Sophisticated Position Budgeting utilizes historical and user-defined data, and scheduled pay-rate information, all of which may be transferred to BS&A General Ledger. Unlimited budget scenarios allow “what - if” analyses for budget planning. Web-Based Open Enrollment Allowing employees to manage their benefit plans online increases employee satisfaction and reduces the drain on clerical resources. 29 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Utility Billing Feature-rich, yet user-friendly, our Utility Billing application provides complete billing and tracking for a variety of utility account types. Extensive use of wizards and process managers simplify complex tasks into efficient step-by-step operations, such as Final Bill, Meter Change, and Past Due/Shut Off. Deposit and work order processing features are available as well. GIS Integration GIS integration allows for a direct link between your data and GIS maps, giving you a very powerful tool to view data, plot various datasets, and quickly view neighboring accounts. Additionally, GIS integration allows graphical lookup of account locations through Google® Maps. Consumption–Based or Flat Fee Billings Flexible billing item setup accommodates both consumption-based and flat rate fees for items such as Water/Sewer, Electric, and Refuse. ACH File Creation and Paperless Billing Streamline your payment process by using ACH – payments can be automatically debited from customers’ bank accounts. Additionally, bills can be emailed to customers who want to go paperless. Wizards Offer Step-By-Step Guidance Through Common Tasks Tasks such as shut-offs, final bills, the billing process, etc., are done with a wizard, ensuring all necessary steps are completed. Customizable Billing Cycle Units can customize the billing cycle to include only those tasks they use. For example, if your unit does not use ACH, the ACH task may be removed from your billing process. Deposit Tracking Integrated deposit tracking provides the ability to calculate interest on deposits, and offers flexibility in returning deposits to customers. The deposit may be applied to the customer’s next bill, or be electronically refunded to Accounts Payable by check request. Built-In Meter Inventory System Detailed meter inventory includes purchasing information, manufacturer, serial numbers, meter location (specific area of customer’s location), curb box location, and information in general necessary for meter reads. Meter Read Equipment Exports/Imports Meter read export/import file layouts are provided for various meter manufacturers including, but not limited to: Sensus, Badger, SLC/Neptune, Itron, Greentree, and Hersey. One-Screen History View Each customer’s history information is accessed from one screen. Available tasks on this screen include: payment reversals, bill adjustments, and printing of various reports. Unlimited Billing Items/Services Per Customer The application allows for an unlimited number of user-definable billing items per customer account as well as an unlimited number of services to be used in the calculation of the billing. 30 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Aging Reports Aging reports can be generated at any time by specifying an “as of” date. This flexibility eliminates the need to print them on the last day of the month. CASS Certification The CASS certification export/import process helps reduce mailing cost by ensuring all addresses are entered correctly. Meter Read Estimates Flexible read estimation provides a variety of methods to use as the basis: account average usage, user - defined date range of meter reads, or user-defined amount of usage. Budget Billing Determine – for each billing item – whether or not to allow budget billing. The budget billing feature lets you bill fixed amounts based on user-definable history instead of the actual usage for the current cycle. Integrated Work Order process The fully integrated work order process allows you to track the details of all work done on a customer’s account. The process checks for scheduling conflicts of the staff person assigned to the task. Shut -off fees, etc., can be billed to the customer once completed. Quick Entry of Meter Reads For those units who do not use meter reading equipment to generate read files for import into Utility Billing, the application includes a process to manually enter reads en-masse. You can quickly enter the reads for all customers in a billing cycle without having to visit individual accounts. Resident Linking Single-sourcing of resident names eliminates repetitive data entry by automatically updating all linked accounts. For example, changing the address on a landlord’s master record will update that address for accounts on which that landlord is selected. Transfer of Delinquent Accounts to BS&A Tax Transfer of delinquent accounts to the property tax bill is done electronically. A billing adjustment is automatically created to reduce the account balance in Utility Billing. Balance Manager: Easy Reconciliation With BS&A General Ledger The Balance Manager provides an easy way to reconcile outstanding balances in Utility Billing with the accounts receivable balance in General Ledger. Drill down into the detailed transactions for the period being reconciled to easily determine the source of any discrepancies. Letter Writer Customized letters may be generated for selected accounts, increasing customer communication and reducing clerical tasks. 31 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Community Development Applications Building Department Our feature-rich Community Development application suite provides comprehensive tools and processes for modern Community Development, Building, Code Enforcement, and Housing departments. A property’s entire history can be accessed through one easily-navigated view. Manage any construction project, permit, code compliance, rental registration, certification, occupancy, or other inspection-related process. Permits Track permits from application to finish. From the start, the Add Permit wizard speeds data entry while ensuring critical information is entered. Link to existing Contractor and Licensee records, or add them on -the fly. Calculate costs by selecting items from your fee schedules and add them to the invoice. Tak e payments, issue permits, and print receipts as required. Once the permit is issued, use Inspection tools to schedule and process inspections. Productivity tools assist you with the creation of letters and attachment of images and documents. Attach reminders manually or automatically through a workflow to a permit or inspection so that no follow-up gets lost in the shuffle. Use workflow rules to automate common activities: apply fees, schedule inspections, generate letters, create reminders, send emails, and more. Code Enforcement Track all property maintenance issues such as weeds, trash, inoperable vehicles, etc. The Code Enforcement feature of our Building Department software offers comprehensive management of the entire process. Once the case is generated, use Inspection tools to schedule and process inspections. Productivity tools assist you with the creation of letters and attachment of images and documents. Attach reminders manually or automatically through a workflow to an inspection so that no foll ow-up gets lost in the shuffle. Use workflow rules to automate common activities: apply fees, schedule inspections, generate letters, create reminders, send emails, and more. Inspection Scheduling and Tracking Tools Use our flexible scheduler to set your appointments and schedule inspections. Create violations with user- defined checklists. Append information through our “Quick Text” screen. Track violations, their location, details, and current status. Use the violation text in Correction Notice letters or repair emails. Capture images of violations directly into the inspection history. GIS Integration GIS integration allows for a direct link between your data and GIS maps, giving you a very powerful tool to view data, plot various datasets, and quickly view neighboring properties using Google® Maps, or through direct integration with GIS maps, if available. Accounting Functionality The Building Department application comes ready to handle the accounting requirements of your community. Enter invoices, take payments and bond deposits, do adjustments and transfers, and print receipts. Run balance reports to match your totals. Generate detailed and summary general ledger information for deposits. Field Inspection Use our tablet-enabled application to enter inspections while out in the field quickly and efficiently. User- defined checklists and Quick Text are available, along with handwriting recognition. Synchronize from home or through your office network. Quickly upload inspection results, generate letters, automatically send emails, 32 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 and download changes with the press of a button. Tablets with built -in cameras may capture images and attach them directly to the inspection with a single click. BS&A Online Services BS&A Online - Employee Self Service Provides web access to various components of the desktop Payroll application. Key Features: Timesheet Entry: Employees can enter timesheets for other staff. Managers can view timesheets for their staff My Timesheets: Employees can enter their own time Personal Employee Info: Employees can view/request changes to “master” information, such as dependents, addresses, and W4 information. Open enrollment is also available; this requires the municipality to have BS&A Human Resources installed. Personal Financial Info: Employees can view check and W-2 history, along with withholding and direct deposit information Year to Date Info: Employees can view YTD totals and leave balances Employment Opportunities: Any user can view currently available job postings. BS&A Online - Public Records Search Provides web access to various components of the desktop Financial Management applications. Key Features: Allows Miscellaneous Receivables, Utility Billing, and Building Department (permit) data to be displayed on the web, and supports online payment of these bills Interfaces with Point And Pay online credit card processing 33 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 3.0 Functional Requirements E.11 Attachment 13 (Functional Requirements) At end of this section. B.3.2 Identify any licenses, hardware, or other products not included in this proposal that would be required to operate any of the proposed solutions contained in this proposal. Hardware Specifications Our ideal configuration is a client-server environment. The backup solutions are to be handled via SQL or appropriate backup software. Although BS&A Software recommends a physical environment for our customers, we support the implementation of our software in virtual environments. BS&A has extensively tested and approved both VMware and Hyper-V in our labs. BS&A desires that all of our customers have a pleasant experience running our software. A properly configured Virtual Server need not destroy employee productivity. In order to ensure the best possible overall performance system, administrators must be willing to allocate sufficient resources to Microsoft SQL. To that end, BS&A Software recommends the following when implementing the .NET software in VM environments: 1) Databases and log files are kept on separate physical volumes/disks 2) Volumes housing databases and/or log files are dedicated to the use of the database (no other VMs reside on those volumes) 3) High performance disk technologies are used wherever possible 34 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 4) Disparate database styles (i.e., MS Exchange) NEVER cohabitate with MSSQL on the same drives 5) VMWare RDMs are implemented wherever possible 6) Parent servers dedicate at least 2 CPU cores to MSSQL VMs 7) Sufficient RAM is allocated to reduce/minimize the need for excessive disk access 8) SQL 2008 or newer only; Workgroup or Standard Edition where possible 9) So-called snapshots of the virtual machine cannot be relied upon for data restoration or disaster recovery. Alternative database backup methods must be employed. 10) Optimize disk partitioning using industry-standard methods Supported Operating System (Workstation) Windows 10, Windows 8.1 and Windows 8 Supported Server Operating Systems Windows Server 2012 - 2019 Supported Versions of SQL Windows Server 2008 - 2017 Microsoft SQL Database schema for BS&A does not include views. All views are created programmatically at runtime of the application. All columns in the view are able to be sorted. All tables are able to be indexed by the user. This gives better functionality for a non-technical user than a standard view. SQL table schema for BS&A tables utilizes unique keys and indexes. Reporting Services BS&A’s applications come with a large amount of reports offering numerous options so our users can quickly get the most out of our software. However, our integrated Report Designer allows users the ability to create their own reports as needed. Key features: Streamlined capabilities with calculated expressions A Table option, which allows columns of fields on a report for ease in field placement and movem ent “Sort” banners and footers, which group data and can provide subtotals Clickable reports let you click on a particular report entry to drill down to the details Reports can be saved to PDF format and CSV format Same look and feel as Crystal Reports Our Report Profiles feature lets users group multiple reports together for more efficient printing. Individual reports within the profile have options that can be set and saved for the Profile process. Personal Computer Specifications Workstation Recommended Minimum 3.2 GHz Intel® Core™ i5 (or faster) 2.8 GHz Intel® Core™ i3 8 GB RAM 4 GB RAM 80 GB free disk space 40 GB free disk space Windows 10 (Professional or above) Windows 7 (Professional 64-bit or 32-bit) 35 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Tablet PC (Community Development Field Inspection App) Recommended Minimum Intel® Core™ i5 520 UM (or faster) 2.8 GHz Intel® Core™ i3 8 GB RAM 4 GB RAM 80 GB free disk space* 40 GB free disk space* Windows 10 (Professional or above)** Windows 7 (Professional 64-bit or 32-bit) *Note: The amount of free disk space required is dependent upon the size of the database and the number of attachments required **Note: BS&A applications are NOT compatible with Windows RT or Windows 10 in S mode Server Specifications (defined as a computer running a Windows Server Operating System) Database Server (fewer than 15) Recommended Minimum 1 Xeon E5 series Quad-Core 2.4 GH z (or faster) 2 GHz Multi-Core Xeon Processor 16 GB RAM 8 GB RAM 6x SATA 7.5K RPM 1TB (3x RAID 1) 250 GB free disk space Separate RAID for Operating System Windows Server 2012 Standard (32-bit) Windows Server 2019 (Essentials or above) Database Server (15 to 30 Users) Recommended Minimum 1 Xeon 2.3 GH z E5 Six-Core Processor (or faster) Xeon 2 GHz Multi-Core Processor 24 GB RAM 16 GB RAM 4x SATA 7.5K RPM 1TB (2x RAID 1) 500 GB free disk space 2x 500 GB Solid State Drive (SSD) Windows Server 2012 Standard (64-bit) Separate RAID for Operating System Windows Server 2019 (Essentials or above) Database Server (30 to 50 Users) Recommended Minimum (2) Xeon 2.5 GH z E5 Six-Core Processors (or faster) Xeon 2.8 GHz Quad-Core Processor 48 GB RAM (DDR3 1333 or faster) 24 GB RAM 4x 10K RPM SAS 1TB Hard Disks (2x RAID 1) 1 TB free disk space 2x 500GB Solid State Drive (SSD) Windows Server 2012 Standard (64-bit) Separate RAID for Operating System Windows Server 2019 (Essentials or above) Database Server (50 to 100 Users) Recommended Minimum (2) Xeon 2.5 GH z E5 Eight-Core Processors (or faster) (2) Xeon 2.8 GHz Quad-Core Processors 64 GB RAM (DDR3 1600 or faster) 48 GB RAM 8x 15K RPM SAS 1TB Hard Disks (2x RAID 10) 1 TB free disk space 2x 500GB Solid State Drive (SSD) Windows Server 2012 Standard (64-bit) Separate RAID for Operating System Windows Server 2019 (Essentials or above) Server (over 100 users) Please email our IT Department at ITSupport@bsasoftware.com 36 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Virtual Server Please see the help doc entitled "BS&A Software and Best Practices in Virtual Environments." http://bsasoftware.com/references/whitepapers_helpdocs/tech/articles_whitepapers/White_vmSupport.pdf Terminal Services/Citrix Environments Recommended Application Server Specifications Dual Quad-Core Xeon Processor 4096 MB RAM plus an additional 1024 MB RAM per user, per application 500 GB free disk space Windows Server 2019 (Essentials or above) Limit of 50 total users Please see the help doc entitled "BS&A Software and Best Practices in Terminal Server /RDP Environments." http://bsasoftware.com/references/whitepapers_helpdocs/tech/articles_whitepapers/white_terminallimits.pdf Please see the help doc entitled “BS&A Software and Remote Desktop Services 2016” http://bsasoftware.com/references/whitepapers_helpdocs/tech/articles_whitepapers/remotedesktopservices2016.pdf I.T. Recommendation BS&A has worked with IT Right for network services and implementation since 1999. If you are in need of IT services, please visit their site: http://www.itright.com Printer Recommendations BS&A Software does not officially maintain a master list of all the different printers that work with our applications. A general rule of thumb would be that any printers that are compatible with Windows are also compatible with BS&A. 37 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 B.3.3 Describe the technical environment necessary for this software for any products that are to be hosted by the Government by completing Attachment 7 (Technical Specifications) (if applicable). E.7 Attachment 7 (Technical Specifications) Technical Specifications Required Licenses Does the Proposed System Require that the Government install software? Yes/No Provide full documentation of technical specifications and requirements necessary to host the system (vendors can submit documentation in alternate format and attach to this page.) See pages 35-38 Hardware / Server / Database Requirements Supported Server Operating Systems Windows Server 2012 - 2019 Desktop / Client Requirements Supported Operating System (Workstation) Windows 10, Windows 8.1 and Windows 8 Mobile Requirements BS&A Applications run on Windows devices. Tablet specifications for BS&A Field Inspection .NET are included 3.0 Functional Requirements. Business Intelligence Describe how business intelligence tools operate and if the Government would be able to leverage tools for non-ERP data N/A Does the report writer utilize a separate database? No Security Describe database security BS&A Applications run on a Microsoft SQL Server which allows databases to be integrated into the City’s existing security plan. Describe application security System Administrators will appreciate the flexibility gained by our task- and field-level security features. Setup and maintenance of user security settings - for all applications - is easily accomplished from one central location. In addition, fund-, department-, and account-based security settings control access and posting to relevant accounts within your general ledger. Each user can either be set-up directly in the BS&A Administration system or imported from Active Directory. Access can be provided as “Read Only,” “Custom,” “Administrator” or “No Access” to each module. “Custom” access includes detailed functional security control. For example, in reporting, 38 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 each user can have separate access to: Add, Back-up, Delete, Edit, Import, Modify, Print, Rename, Restore, Run, and Create/Edit Report Profiles. Similar functional security controls are available for every function. By defining “Custom” access it is possible to granularly set the functional access for each employee. The software also has the capability to support User Groups. This allows for defining group security settings which are inherited by all members of the group. This makes it very easy to define security settings for core user constituencies. Users can be created by importing from active directory. The same active directory username would be used to sign on to BS&A applications as used for desktop login. This feature then also supports verification of passwords against active directory if that username exists in active directory. This feature also supports the ability of auto login based on the user that is logged into windows. The application also allows the ability to enforce password policies similar to active directory. Each application is equipped to keep detailed audit tracking report that log virtually all changes made. Is system compatible with single sign on? BS&A Applications can import users from Active Directory and can validate passwords against Active Directory, allowing users to have one set of credentials for Windows and BS&A logins. Additionally, once logged in to one BS&A Applications, no additional login is needed to navigate to the other modules. 39 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 4.0 Implementation Plan B.4.1 Provide a detailed plan for implementing the proposed system. This information must include: Proposed phasing for roll-out of proposed system BS&A is proposing a two phase roll out. The first phase would consist of core financials, including Purchase Orders. The second phase would consist of the Human Resources/Payroll applications. Schedule of key dates B.4.2 Explain the proposed plan for implementation. This information must include: Description of implementation tasks and activities Description of key deliverables (and how they relate to the implementation approach and activities). Please note the required deliverables listed in Section C.. Implementation Plan Services include the planning and evaluation of current hardware and network, sources and format of legacy data, potential integration with existing systems, software installation, data conversion and training. BS&A does not intend on partnering with any other software vendors for this project. Our goal is to make the transition from your current system as painless as possible. We utilize our extensive experience to accomplish this in an efficient, accurate and timely manner. For example, many municipalities believe the best time to convert is at the start of a fiscal year. Our experience has shown that this is often the busiest time of year – not the optimal time to transition to new software. Once a general transition time is agreed upon, an implementation timeline is prepared. This schedule includes evaluation of your current hardware and network, sources and format of legacy data, potential integration with existing system, software installation, data conversion and training. Implementation meetings are held to discuss/gather information about key topics like workflow process, banking information including positive pay/ACH, any unique ______________ Implementation Highlights The staff at BS&A Software is specially trained, first and foremost, to take care of customers. We are not satisfied unless your staff is pleased with your software choice. The process is not complete without a solid implementation plan to follow. Our Implementation process includes all services necessary to assure a successful transition. We will provide: Current Process Review Project Managers that understand your needs AND are Subject Matter Experts Implementation and Project Plans Project Update Conference Calls Program Installation/Network Configuration assistance Data Conversion from your legacy system Data review services – you will evaluate your converted data prior to your Go-Live Training Services that are tailored to your needs Follow-up training with advanced report design assistance. 40 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 reporting requirements, etc. As part of these meetings key team members from the municipality are identified and included, ensuring that all concerns are heard and any potential issues are addressed. We strive to shorten the transition process as much as possible – a long transition equates to diminishing productivity. Typically, we can accomplish the entire process – from initial kickoff meeting to “go-live” – in six to nine months. Implementation Approach BS&A has developed a five phase approach to implementation. Consultation: Each implementation will begin with a kick-off meeting. Here we will set the time table and develop the schedule for your onsite implementation and training. During the onsite Process Discovery meeting we will review your current processes, and make the recommendations for the best practices in BS&A. Conversion: In this phase we install the software, review your chart of accounts, run a preliminary data conversion followed by quality control testing, and finally perform the final data conversion. Setup and Training: This phase consists of user and security setup, workflow setup, custom report creation and modification, and onsite end user training. Parallel: Here we run identical payrolls and billing in BS&A as well as your legacy system as part of training. Go-Live: Our training staff is onsite working with you to perform your first payroll, billings, and check and report runs. They will review the processes with you and transition you to the BS&A support staff. Software Installation Programs will be installed by BS&A for testing and learning purposes. This is informal and simply allows users to play with the applications prior to formal training. Data will be installed at a later date. This allows time for the staff to become familiar with the applications and review tutorials prior to formal training. •Current Process Review •On Site Assessment •Best Practices Recommendations •IT Hardware Review •Project Review Meetings Consultation •Chart of Accounts Review •Preliminary Data Conversion •Quality Control Testing •Final Data Conversion •Software Installation Conversion •System Security Configuration •Workflow Setup •Custom Report Creation/Modification •Training Setup and Training •Run Parallel Cycles BS&A and Legacy System •Confirm Results •Training Staff On-site to Provide Assistance & Resolve Issues •Transition to Support Parallel / Go Live •Project Kickoff •Implementation Plan •Review Project Scope •Identify Project Team •Review Roles & Responsibilities Initiation 41 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 We have provided an option for the City to obtain hardware and hardware support services through IT Right, our preferred provider. BS&A will assist in recommending the optimal hardware configuration for this installation. Proposed Implementation Schedule Dates are estimated based on the City’s calendar of events schedule and may be subject to change. Timetable Scope of Work 1 Month Post Signing Kick-Off Meeting – This meeting will assemble all project stakeholders to discuss expectations and concerns. BS&A Software will listen to the discussion, offer input as needed, and formulate a plan at the conclusion. Assemble Project Team – The respective Project Managers will administer the day- to-day operations of the project. Establish a timeline for project components such as conversions, customizations, program training. 5 Month Pre Go-Live Meet with the City IT staff to identify possible network issues and review existing system configurations. City reviews hardware requirements and begin the process of purchasing/installing new server(s) and workstations if necessary. 4-5 Months Pre Go-Live Preliminary Data Conversion & Data Review – Begin process of converting City’s existing data into BS&A, following the agreed upon conversion plan. City sends preliminary data to BS&A for analysis and first run of data conversions. Upon completion of initial conversion, BS&A meets with key stakeholders to review conversion output. If necessary, the conversion will be updated and the process will be completed again until we have successfully converted all data. During this process, we will also gather requirements for any required program customizations. 4 Months Pre Go-Live Install programs in test environment for learning and evaluation purposes. This allows time for staff to become familiar with the applications, execute test cases and review tutorials prior to formal training. Final converted data to be installed at a later date. 0-2 Months Pre Go-Live Implementation/Training The converted data will go through a Quality Control test. BS&A will first review/test the data, and then pass it to the City for their review and critique. BS&A begins Program Training. This will familiarize staff with the new software and processes. 1 Month Post Go-Live Evaluation After you are up and running we don’t disappear. We will conduct a post project review meeting to tie up any loose ends and evaluate the entire process. We want your feedback to make sure you’re completely satisfied and learn of anything that could be done to make our process better. 42 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 B.4.3 Explain the proposed vendor staffing for the project including: Approximate dedication to the project of each resource and approximate time work will be completed on-site vs. off-site The proposed plan includes an assumption that the project management team would dedicate approximately 60 hours to this project. As currently proposed, this would include approximately 24 hours on-site. Implementation and Training staff would be expected to dedicate approximately 250 hours to the project, with 200 of those being on-site. Identify how the vendor plans to control costs by utilizing remote meetings BS&A believes that on-site training is most effective and our proposal assumes we will be able to perform training on-site. BS&A project is structured so that only critical activities are handled on-site, and other tasks are completed remotely, particularly early in the process. Major roles and responsibilities for each resource The project management team has responsibility for the project. They will communicate with the customer, and internally with developers and the implementation and training staff, to ensure that project deliverables are met. They are also responsible for scheduling, verifying conversions, coordinating technical conver sations between BS&A IT staff and the City’s, managing changes to the project, and formulating the go-live plan, with any attendant process reorganization. BS&A IT staff would be working with the City on extraction of data, testing and verification of hardware, installation of software, etc. Implementation and Training staff are responsible for enacting the project plan decided upon by the City and BS&A Project Managers, by training customers on the applications, ensure that the system is configured optimally based on the process planning done during the project management phase, and initiating the hand-off to our support department, once the go-live has been completed. BS&A’s Project Specific Roles BS&A Software will use the following roles during the project: Project Management and Implementation Planning Director Has overall accountability for the project and provides a point of escalation for the customer. Account Manager Escalate internal issues as needed. Project Manager Has day-to-day accountability for the project. Scheduling and leading the Kick-Off Meeting Manages and coordinates all activities and resources associated with the project. Produces and maintains the project plan Responsible for and leads the work associated with the development of the customer’s new processes Leads the on-site process review Hold regular conference calls with Organization project manager to review status and progress of project and to identify any outstanding issues Manage Change Orders 43 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Implementation Specialist Responsible for and leads the work associated with the development of the customer’s new databases Participates in the on-site process review Develops best practices recommendations Assist with forms analysis & creation Assist with data conversion analysis Assist with report analysis & creation Development Create custom integrations Perform data conversion Develop enhancements or bug fixes Training Specialist Participates in creation of the training plan Responsible for and leads the cutover and delivery of the training One lead training specialist will be identified to coordinate all training activities IT Assists with the extraction of test and production data from the customer’s existing applications. Responsible for the installation of the BS&A applications on the customer’s production environment. Subject Matter Experts May assist as required, typically for Payroll 44 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Note: there may be a number of people fulfilling each role. Organization’s Project Specific Roles We recommend the following roles for Organization employees for this Project Project Champion Escalate and resolve issues raised by project manager Insure Organization-wide buy-in and support Project Manager Manage completion of project planning documents Identify and communicate to BS&A project manager requirements for a successful implementation Coordinate with BS&A project manager to develop and maintain implementation schedule which identifies specific milestones and establishes accountability Schedule Organization resources for training: personnel, equipment and training rooms. Identify additional employee training needs and update schedule 45 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Ensure that employees accomplish tasks on time, including monitoring homework assignments Review invoices and approve payment in accordance with the contract and associated milestones Oversee project and monitor progress with BS&A project manager Develop conversion specifications with BS&A Coordinate analysis and proofing of conversion data Subject Matter Experts ( one each for payroll, utilities, work order and financials) Provide detailed policy/process information Analyze potential policy/process changes Subject matter experts on selected modules Participate in knowledge transfer and analysis sessions Sign off on system design Participate in form design Participate in validation of conversion Participate in testing and parallels Assign department resources for training and internal project tasks Complete workflow and security templates for all end users Attend all training sessions or appoint an appropriate management level designee Assess end user competency on trained topics Assess policy compliance Provide end users with dedicated time to complete required homework tasks Act as supervisor/cheerleader for the new BS&A processes Identify and communicate to Organization project manager any additional training needs or scheduling conflicts Help document lessons learned at end of each phase and signoff on formal acceptance for phase close-out IT Specialist Assist with data extraction Procure and install any required hardware Add new users and printers Perform basic server system maintenance Ensure all users understand BS&A log-on process and have necessary permission for all training sessions Ensure network and infrastructure is sound End User Attend Training as offered Complete tasks as assigned Practice skills learned within training before live processing date. Communicate departmental needs as needed Communicate any problems to project manager or subject manager expert Demonstrate competency with BS&A applications processing prior to GO LIVE 46 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 B.4.4 Explain proposed project management services including: Role of the vendor project manager Use of project collaboration site Expected role of Government project manager On-Site presence of vendor project manager Proposed quality assurance procedures Project Management A member of our Project Management and Implementation Planning team will be assigned to coordinate your project. Our consultant will oversee the implementation process, schedule all necessary meetings, facilitate data transfer and conversion, and schedule training. All training proposed will be performed onsite at your offices. Coordination, documentation, and communication will be provided throughout the project by way of Microsoft SharePoint. An overview of our planned method for a five-phase project management is as follows. BS&A is able to work with the timeline that best suits you. Initiation: All projects begin with a Kick -Off meeting with the Project Stakeholders. Discussions then take place with each Department. The key is to ensure everyone is kept on the same page. Planning: Comprehensive planning must occur through a variety of means. Planning is completed and is put in place through a formal Implementation Plan. The plan is specific to dates, timelines, tasks, and schedule of events. Execution: Execution is an extension of the planning process. It puts the Implementation Plan in motion. Control: We will have several basic control systems and some more formal quality control systems in place. Program installation, data conversions, training, and system testing will all have control system testing. The installation may be phased; therefore, testing of each implementation will occur at the appropriate time. Closure: This is where the project is wrapped up. BS&A will remain onsite for the first several Go-Live dates, for each application if necessary. Additionally, follow-up visits may be scheduled to assess progress and answer questions. Of course, the technical support staff is always here for you. ______________ Project Management Highlights BS&A employs a project management approach that is distinctly better for several reasons. With our staff, you will enjoy the following benefits: The Customer: The staff at BS&A Software is always concerned with the client’s needs first Details: We will follow a detailed project plan that will ensure a smooth transition Knowledgeable: You will always be dealing with a professional, knowledgeable, and dedicated staff member Passionate: Throughout the project you will work with staff members that believe it is very important to always push ourselves and to never be satisfied with "good enough." Our goal is not to be a good company by providing good services. We want to be a great company by providing remarkable services. Important: Your Project Manager will guide you through the process and make sure you are the most important part of the process. Every member of the BS&A team treats each customer as absolutely crucial to the company's survival, as indeed, each customer is. 47 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 In the event of a change in scope, the assigned Project Manager will first review the requested functionality with the appropriate Project Stakeholders, to ensure that there is a clear understanding of the des ired outcome. Once this is completed, the Project Manager may consult with development staff, or our Product Management team, in order to first determine if it is possible to accommodate the requested changes, then to determine if there will be cost involved, and finally to determine an estimated timeline for the implementation of those changes. Once this step has been completed, a Change Order, detailing the change in scope, as well as any impacts to cost or timeline, is prepared for customer review. At any stage during this process, the Project Manager may facilitate the exchange of information between BS&A’s Product Managers and developers, and the appropriate customer personnel. System Design and Documentation BS&A is responsible for creating a Recommended System Design and Configuration. This will be accomplished by conducting an in-depth, onsite review of your existing process. The output of this review will be a set of recommendations and associated system design and configuration document. It is the City’s responsibility to review, approve, and/or adjust that design. Some parts of BS&A’s recommended design may be items that the City wishes to implement in the future. We will work with you to come up with a design that optimizes efficiencies, but takes into account your current practices, policies, and procedures. This will be provided to the Stakeholders electronically and reviewed during the onsite configuration/design review meeting. The outcome of that meeting and subsequent discussions will be to agree on a final system design/configuration. Project Risk Management BS&A embeds risk management in every project. In our 25 years of data conversions and implementations we have learned this is an integral part of maintaining a successful project. Throughout the project your Project Manager will be in constant communication with you, and will schedule regular conference calls to keep everyone aware of the status of your project. Constant communication and consultation throughout the entire process is the best way to handle risk management. The project risk management model that we follow is: 1. Identify 2. Analyze 3. Evaluate 4. Implement Final Phase and Cut-Over In the final phase of the project, you will be running BS&A as your primary system. For P ayroll and Billing Cycles, we will run at least one cycle in parallel. For example, you will run a payroll in your current software. We will then run the same payroll in the BS&A Payroll software and make sure that data balances. From that point forward, all activity will be in BS&A. Similarly, we will run a parallel cycle in Utility Billing to make sure that bills are being created appropriately. BS&A will be onsite during these Go-Live periods to help quickly resolve any problems that may arise. At the conclusion of this phase, we will transition you to our Support team. 48 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Product Testing The converted data will go through a Quality Control test. BS&A will first review/test the data, and then pass it to the City for their review and critique. The recommended approach to the following types of testing is: 1) System Testing System Testing is the overall approach used to validate that an entire system satisfies the requirements, business and operational objectives. 2) Integration Testing Integration testing is intended to verify operational requirements between major applications, sub-systems or modules. Test cases should be constructed to test that all modules interact correctly. For example, Utility Billing should be able to submit a “check request” to the accounts payable module. An appropriate integration test would be to create a “check request” in Utility Billing and verify that the check request exists in Accounts Payable and can be used to generate a refund check. Likewise, an Integration Tests should be defined for each of the “Integration and Interfaces” requirements identified in the applications specifications spreadsheet. 3) Stress/Performance Testing Stress testing refers to tests intended to evaluate a system, module or function under heavy load. The goal of these tests is to ensure the software will perform adequately under maximum loading conditions. BS&A recommends creating Stress Tests that will mimic maxim expected loading for critical functions. Similarly, Performance testing refers to the assessment of the performance of system, module or function from the perspective of the user. Performance testing is often done in conjunction with stress testing. B.4.5 Explain the expected Government staffing for the project including: Assumed participation in the project (average portion of FTE). This should include all time spent working on the project (including time spent with and without vendor consultants) Assumptions about prior skills / competencies of resources Complete Attachment 12 (Staffing). Refer to Section C.4 of the RFP for project staffing. 49 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 BS&A assumes the following skills/competencies in regards to City staff: IT resources will have the knowledge and expertise to communicate effectively with BS&A IT staff, with regards to workstation/server/network specifications, and will be able to carry out the agreed upon plans. City IT staff will also be able to assist with the extraction of data from the legacy system. City will have at least one staff member to serve as a subject matter expert, for each individual application, or functional area. This person will be able to answer questions relating to process, workflow, and system requirements, as it relates to their area of expertise. Individual staff members will have working knowledge of using a windows based computer, as well as a working knowledge of the job duties relating to the job duties directly relating to the application. Beyond the time directly invested in training activities, BS&A makes the following time related staffing assumptions: - City subject matter expert - .25 FTE for the duration of the project. - City IT staffing - .25 FTE for the duration of the project. - Individual staff members – minimal involvement, beyond training, as required for testing purposes, or as needed by the City’s subject matter expert. B.4.6 Provide an overview of proposed training plan/strategy, specifying how and when training is to be delivered for both on-site and off-site training and web training services for the core project team, end users, and technology personnel (if required). Training Approach We prefer to train your staff using your data in conjunction with your go-live date. Our experience has shown that training weeks in advance of actually using the software is easily forgotten. The coordination of data conversion, installation and training is crucial to a seamless transition – and is something we do very well. ______________ Training Highlights The coordination of data conversion, installation and training is crucial to a seamless transition – and is something we do very well. Our training process includes all services necessary to assure a successful transition. This includes: Setting up user and user security right for each application Modifying custom settings in each application to fit the needs of the customer Setting up application integration and workflow methods Onsite verification of converted data for balancing and auditing purposes Trainers who are experts in our system and hold accounting degrees. Using your own data for hands- on training. After training is complete, we don’t go away. We think it’s important to revisit our customers one to two months post- training to follow up on any items covered during training that need to be refreshed. As needs arise, we can also offer assistance with bank reconciliations. 50 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 In addition to expertise in our system, our trainers all hold accounting degrees. We believe this is very important to effectively communicate accounting concepts. Our trainers teach in a friendly, relaxed manner, which helps alleviate any apprehension your staff may have over learning a new system and helps them buy into the entire transition. The training methods we utilize are perhaps the area where our flexibility is most evident. Where practical, we find a hands-on approach at your users’ desk most effective. Depending on the size of the municipality, we can offer training in a classroom environment, using a screen and projector. In either case, we utilize your data, which has the most relevance for your users and leads to best retention of training. The first step in the process is to jointly create an overall project implementation plan. From there, we will jointly develop a training plan that accommodates your requirements (vacations, elections, auditor, etc.). Training is conducted on-site, hands-on using your live data. The typical process is to walk through overall process. Once that is complete, we will then go into specific tasks. Where appropriate, a parallel cycle will be run to make sure that data generated in BS&A matches data generated in your current system. Trainers will remain on-site until the user community is up and running. Typically after 30 to 60 days of use, we bring the trainer back on-site to address any questions and reinforce prior training. BS&A will provide the existing documentation, training manuals, and texts to assist in the training process. The training materials provided can be used, copied, combined and/or distributed for any City training sessions. BS&A will provide the existing documentation, training manuals, and texts to assist in the training process. The application-specific training materials are further broken down by process, so that it is possible to pick and choose materials appropriate for the particular training session. The training materials provided can be used, copied, combined and/or distributed for any City training sessions. End User Training The estimated number of training days for end user training for City staff on all software modules: Software Setup Days: 3 General Ledger .NET Days: 2 Accounts Payable .NET Days: 3 Cash Receipting .NET Days: 1 Miscellaneous Receivables .NET Days: 2 Purchase Order .NET Days: 3 Fixed Assets .NET Days: 1 Utility Billing .NET Days: 7 Payroll .NET Days: 4 Human Resources .NET Days: 2 Timesheets .NET Days: 3 Building Department .NET Days: 7 Field Inspection .NET Days: 3 BS&A Online – Employee Self Service Days: 1 Post-Go Live Follow Up Days: 4 Total: 46 51 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Optional Post-Go Live Follow-up Training BS&A strongly recommends follow-up training approximately 30 to 60 days after initial training. During these sessions we will work one-on-one with any users who require additional assistance. For this project, we would recommend 4 days of follow-up training. Activities include: Review and consult on streamlining day-to-day activities as they relate to the processes within the BS&A applications Assist customers with more detailed and advanced report options available within the BS&A applications Revisit commonly-used procedures discussed during training As needs arise, provide assistance with bank reconciliations $1,000/day + travel costs Days quoted are estimates; you will only be billed for actu al days used If necessary, additional onsite training or support is available for $1,000/day plus applicable expenses. Alternatively, remote web training is also available for a fee of $140/hour. Several user group meetings are scheduled throughout the year. Meetings are held at our training facility in Bath, Michigan and are complementary to our customers. Webinar participation is available for those unable to attend the user group meetings in person. Additionally, videos of these meetings are availabl e on our website shortly after the meeting takes place. Our team will ensure that all necessary staff is educated to the appropriate level that allows them to support and maintain the application in the most proficient manner upon the completion of implementation. Due to the comprehensive material presented, we fully anticipate and welcome the City staff to utilize our technical support and online resources. Additionally, we have detailed application training videos and corresponding written courseware. Our video courseware is designed for: New customers and prospects who want to gain some upfront knowledge before our implementation and training staff arrive onsite. Existing customers who want to understand important topics at a deeper level once they have become more accustomed to the software. Existing customers who have hired new personnel and would like to allow them get up to speed on their own schedule. Explain the role and responsibilities the Government is expected to provide for the training effort including (but not limited to) training coordination, training material development, training delivery, etc. The City would be expected to provide assistance with ensuring that the appropriate City staff was available and scheduled for the correct training sessions, and to make Subject Matter Experts available as needed, in order to resolve any questions that arise which should not be answered to City employees by BS&A staff. Although not required by BS&A, based on the scope of this project, some customers choose to have their subject matter experts assist with training delivery, to ensure mastery of the information, and provide an internal expert. 52 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 BS&A Software will need City resources available to participate in phase 2 of the implementation. T hey will be involved in onsite discovery meetings, data reviews, and other project related activities. B.4.7 Complete Attachment 11 (Conversions). The Government expects proposers to include all conversion listed in the RFP. 53 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 54 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Data Conversion Data conversion is the single most important aspect of any system implementation. We do not force you to provide us data in a pre-defined format or go through a complex process to create data mapped to a specific structure. Instead, we simply ask you to provide us with ASCII data (preferably MS SQL or Access), data definitions, and we will then take ownership of the conversion process. Whenever possible, we take all the risk of data conversion, by providing you with a “not to exceed pricing” rule. If the conversio n takes more work than expected, we will complete the additional work at no additional charge to the City. Of course, we will require your help in running reports and validating that the data is converted correctly, but it is our job to handle the conversion process – you just help us make sure we get it right. Data Conversion Process In the course of bringing hundreds of municipalities onto our Financial Management and Utility Billing software, we have fine-tuned our data conversion process to minimize the work on your part and maximize your ability to access past data. We have experience converting data from numerous different legacy systems. We understand that your current financial management software is Banyon. Data Extraction & Formatting BS&A will extract all of the data to be converted from your system. The City does not need to touch or reformat the data in any way. The only thing required of the City is to run some reports to aid us in balancing the data. Preliminary Data Conversion/Mapping One of the first key activities in the project is to get an initial copy of your data. BS&A consultants will map your existing data into the appropriate fields within BS&A. This mapping will be used to drive the development of our data conversion routines. After a preliminary conversion is developed, we will interrogate the data and make sure it balances. Data Review Once we have converted the initial data, it will be installed onsite for review by your transition team and BS&A staff. Together, we will walk through the data – you are the experts on the information and we are the experts on our system. Any deficiencies in the raw data and/or conversion process are identified and addressed. An evaluation is also made of any missing pieces in the data that cannot be converted electronically. BS&A staff will often enter critical items to reduce your workload during the busy transition period. This data will remain on your test system for evaluation throughout the remainder of the process. If necessary, this step will be repeated until we have the data conversion approved. Final Conversion Just before the Go-Live date for a particular application, we will again extract a copy of your data. In this case, it will be data that includes all the latest transactions. We will re-run our conversion and load the data onsite into the appropriate BS&A application. Parallel Cycles To absolutely ensure that our data conversion process is 100% correct, we run payroll cycles in parallel. After running a payroll in your current system, we will re-run the same payroll in BS&A to make sure that all data is replicated. Any deficiencies will be corrected. 55 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Scope of Data Conversion The cost proposal identifies conversion costs. The scope of those conversions is specified in the followin g table. Application Scope of Conversion Payroll Database Setup Employee detail and Year to Date General Ledger Chart of Accounts Balances and Budget Up to 10 years Journal Transaction History Accounts Payable Vendors Up to 10 years Invoices and Check History Cash Receipting Receipt Items and Tender Codes Human Resources Setup of Positions and Benefit Plans Miscellaneous Receivables Setup of Billing Items, Penalties Fixed Assets Assets and Depreciation History Utility Billing Accounts, Services, Deposits, Rates, Meters Unlimited Years of Service, Billing and Payment History Building Department Property Information, Open Permits, and History data No conversion or database setup to be performed for: Purchase Order Field Inspection Timesheets Product Testing The converted data will go through a Quality Control test. BS&A will first review/test the data, and then pass it to the City for their review and critique. The recommended approach to the following types of testing is: 1) System Testing System Testing is the overall approach used to validate that an entire system satisfies the requirements, business, and operational objectives. 2) Integration Testing Integration testing is intended to verify operational requirements between major applications, sub-systems, or modules. Test cases should be constructed to test that all modules interact correctly. For example, Utility Billing should be able to submit a “check request” to the Accounts Payable application. An appropriate integration test would be to create a check request in Utility Billing and verify that the check request exists in Accounts Payable for use in generating a refund check. Likewise, an Integration Test should be defined for each of the “Integration and Interfaces” requirem ents identified in the application specifications spreadsheet. 3) Stress/Performance Testing Stress testing refers to tests intended to evaluate a system, module, or function under heavy load. The goal of these tests is to ensure the software will perform adequately under maximum loading conditions. BS&A recommends creating stress tests that will mimic maximum expected loading for critical functions. Similarly, Performance testing refers to the assessment of the performance of the system, module, or function from the perspective of the user. Performance testing is often done in conjunction with stress testing. 56 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 5.0 Ongoing Support and Hosting Services B.5.1 C omplete Attachment 8 (Software-as-a- Services / Hosting) (if applicable) Not applicable. BS&A is proposing a City hosted solution. B.5.2 Describe proposed services for hosting including: Information on the specific hosting services provided Help desk support services Application support Operational support services Technology infrastructure services Disaster recovery Will all products (including third party products) be hosted through the same provider? Will the Government need to host anything on its servers? BS&A is not proposing a hosted environment. Therefore, all data would be hosted via the City servers. However, our solution is a client/server based system, and therefore would not require a dedicated web server. Company Service And Support Philosophy BS&A believes that providing superior support is the key to success. We have over 30 staff members dedicated to supporting our software, along with an additional 16 software developers and programmers to provide a higher level of assistance when needed. Many of our support staff are degreed accountants, including multiple CPAs. This exceptional level of understanding of the accounting process, combined with their expertise in our software, has enhanced the quality of our software support. Our technical support staff continuously receives outstanding evaluations from our current customer base! BS&A’s management team measures the success of the support staff in several ways. First, approximately 3 weeks after conclusion of the project, we conduct a Post-project review. The purpose of this activity is to determine what aspects of the project went well and uncover any areas where improvements need to be made. If any additional training or support activities are required those will be completed to ensure satisfaction with the project. Then, after approximately 60 days post-implementation, a member of the senior BS&A management team will ______________ Technical Support Highlights Why is BS&A better? We believe our Support staff is the backbone of our organization. They consistently get rave reviews from our customer satisfaction surveys. If we gain your business, you’ll enjoy world- class support services. We are focused on delivering unparalleled service, solutions, support, and satisfaction. You'll see this in our literature, but it's not just a marketing strategy; it's a mindset deeply embedded in our DNA. Our goal is to provide such remarkable customer service that our customers feel compelled to remark about it. We are extremely proud of the many long-term customer relationships we have built. We strongly believe that our success is directly correlated with putting the customer first and consistently choosing to listen to them. Delivering unparalleled customer service is the foundation of our company. Our company takes pride in the fact that customers can see their fingerprints throughout our software. They have provided us with many years of great ideas and suggestions. We truly value their feedback. Typically, our response to calls for support is immediate; however, on high call volume days it has taken about an hour. The average response time is less than 15 minutes. 57 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 conduct an additional follow up. Here the focus is two-fold, improving future projects and determining if there is anything needed to ensure your complete satisfaction. Each staff member is evaluated based on several criteria; however the greatest weight is given to their overall customer care, product and process knowledge, and willingness to consistently go above and beyond to solve customer problems. BS&A tracks statistics for issues reported, resolved on the first call, average call duration, and the average time to reach issue resolution, as well as numerous other metrics. This information is monitored for the purposes of evaluating our effectiveness and efficiency. Candidly, however, these statistics are not how we measure the quality of our support. We believe each call should be given the appropriate amount of assistance, and our ultimate goal is complete satisfaction. Annual Service Fees Unlimited support during your first year with the program is included in your purchase price. Thereafter, Service Fees are billed annually. After that date, BS&A reserves the right to increase the fee by no more than the yearly CPI. Telephone, Email, and Fax Support Our support staff is available Monday through Thursday, 8:30 a.m. – 6:00 p.m., and Friday from 8:30 a.m. – 5:00 p.m. (all times Eastern). The average response time is less than 15 minutes; 95% of our support requests are answered in under 30 minutes. We do not have a voicemail service; calls are queued and taken in the order received. Support via email, fax, or remote assistance is also available. Email support requests can be initiated directly from within any BS&A application. With your annual support agreement, there is no limit on the amount of times you contact us. If you require occasional support assistance outside the normal business hours, arrangements can be made. Toll-Free Support Line BS&A’s toll-free number is (855) BSA-SOFT. Support hours are Monday through Friday, 8:30 a.m. – 5:00 p.m. (all times Eastern). Sharing Desktops Our support consultants have the ability to connect with your workstation, so that we see exactly how you are encountering the problem. If needed, we can take over control of your desktop to walk you through a resolution. Likewise, we can use that tool to conduct webinars where we share our desktop with your users. Onsite Support BS&A staff will be at your location during the implementation, training, and final Go-Live dates. Future onsite dates can be scheduled if needed. For example, if you want a representative onsite for training new staff, we can provide that. Additional onsite training or support is available for $1,000 /day, plus travel expenses. We can also provide web training for a reduced cost. User Groups Several User Group meetings are scheduled throughout the year. These meetings are complimentary, and held at our training facility in Bath, Michigan, and other regionally located sites. Webinar participation is available for those customers unable to attend the User Group meetings in person. 58 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Online Knowledgebase The Financial Management area of our website includes a plethora of information for online learning. There are hundreds of task-specific tutorials for many applications. The site is periodically updated by BS&A staff with current videos. We also provide a link from within each of our applications to query software maintenance and enhancement cases. Escalation Options and Procedures Our customers are our number one priorty. Contacting your Project Manager is the preferred way to initiate the escalation process should a problem arise that you feel is not being given the appropriate attention or priority. The PM is responsible for and has access to all resources available in providing a resolution. A solution in these circumstances may be a temporary one that gets you going again as soon as possible while a more permanent solution is identified. Software Releases The first version of BS&A Fund Accounting was released in 2001. The most current version is Financial Management .NET. Based on client requests, regular program updates are available for download on our website. The cost of these updates is included in the annual support and maintenance fee. Since the release of the .NET version, no major enhancements have been scheduled. Software Updates Our support platform includes software updates/enhancements for each application that are distributed to all current customers on at least a monthly basis, and are accompanied by an update log that details the changes/enhancements. Updates are distributed through the internet and saved to a directory on your server. In the case where a thin client technology is being used, this update must run (installed) once, but all users must be out of the program at that time. In the case of a standard client/server configuration, this process must run on each workstation, but it would not be required to have other users exit a program befor e updating. All updates are cumulative. There is no need to install each update in a sequential fashion in order to patch properly. In most cases, our customers do not develop local custom modifications, other than pulling/pushing information through ODBC connections. BS&A Software has, and will continue to be, committed to statutory and process compliance changes as deemed necessary at the Federal or State level. Timetables have historically been aggressive, and all users with paid support agreements receive periodic updates. Program changes are researched thoroughly and active communication is maintained with the appropriate State agencies. Software Customization On occasion, customers will ask for, and receive, custom modifications from BS&A directly, w hen there is a program feature that would be helpful to them, but may not benefit the majority of the customer base. By performing these customizations ourselves, BS&A is able to reduce or eliminate the amount of problems relating to local customizations, as well as provide these customizations at a price competitive to the costs to a municipality to employ a custom developer. 59 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 B.5.3 For each of the services proposed explain service levels that are used to guarantee performance for the Government through the proposed hosting agreement. Complete Attachment 9 (Proposed Service Level Agreement). BS&A is not proposing a hosted solution. B.5.4 Complete Attachment 10 (Maintenance and Support) E.10 Attachment 10 (Maintenance and Support) Proposed Maintenance and Support Post-implementation Support: Days of on-site support after go-live 4 What is purpose of on-site support? BS&A strongly recommends follow-up training approximately 30 to 60 days after initial training. During these sessions we will work one-on-one with any users who require additional assistance. Other on-site support after go-live (month end, quarter end, year end, open enrollment, etc.) Additional training may be scheduled for $1,000/day plus applicable travel expenses. Offsite support after initial go-live (not support center)? Follow up training is included in the proposal. Telephone Support: Hours available (and time zone) Our support staff is available Monday through Thursday between 8:30 a.m. and 6:00 p.m., and Friday between 8:30 a.m. and 5:00 p.m. (Eastern Time) Problem Reporting and Resolution Procedures Our customers are our number one priorty. Contacting your Project Manager is the preferred way for a customer to initiate the escalation process should a problem arise that the customer feels is not being given the appropriate attention or priority. The PM is responsible for and has access to all resources available in providing a resolution to a customer problem. A resolution in these circumstances may be a temporary one that gets the customer going again as soon as possible while a more permanent solution is identified. 60 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Response time for various levels of severity The average response time is less than 15 minutes, and 95% of our support requests are contacted in less than 30 minutes. We do not have a voicemail service; calls are queued and taken in the order received. Support via email, fax or remote assistance is also available. Email support request can be initiated directly from within any BS&A application. Third Parties: Support provided for third party products? BS&A does not provide support for any third party products. We will always work with customers, and third party vendors, to assist where possible in resolving issues relating to inter-operability, but cannot provide support directly for third party products. Upgrades/Patches: Upgrade Frequency (major and minor releases) BS&A has updates on the 1st and 15th day of each month. Each of these updates includes both new features as well as enhancements. How are upgrades delivered? These can be downloaded from our website for directly from the application. Are upgrades required? No. How many version are currently supported? Our legacy Pervasive version and current .NET version are supported. Third Party Support Upgrade Frequency (major and minor releases) N/A. No Third Party Software is included in the proposed solution. How are upgrades delivered? N/A Are upgrades required? N/A How many versions are currently supported? N/A 61 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 6.0 Exceptions to the RFP BS&A Software takes exception to the following requirements: Exception Explanations # Title Explanation of Exception D.2.4 Deliverables, and the system itself will conform to the scope and specifications presented in BS&A’s response to the RFP documents, including the functionality requirements, not to the RFP documents themselves. D.3 In the event that a problem cannot be fixed during the warranty term, BS&A will refund all monies paid to acquire the non-conforming portion of the software, but will not reimburse costs to acquire and implement a separate software package. Warranty term to extend 12 months from ‘go live’ date, not Final Acceptance. 62 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 7.0 Deliverables and Project Outcomes B.7.1 Provide a listing of project deliverables (work products) and for each identify: Purpose of deliverable Expected scope / contents of deliverable If deliverable is expected to have value outside the ERP implementation project Sample Statement of Work at end of this section B.7.2 Provide an excerpt from project deliverables showing process documentation, configuration documentation, testing scripts, training materials, and requirements traceability. Sample Statement of Work at end of this section B.7.3 The Government is looking to fully leverage the human resource functionality in the system. Please describe a past project where you feel your client established an effective system modeled in “best Practice: for managing an employee’s human resources for employee evaluations, training, skills/certifications, succession planning, and recruiting. City of Novi, MI is a B&SA customer that comprehensively uses the Human Resources .NET Application. B.7.4 The Government desires to automate the exchange of information between the system and various benefit providers. Please explain specific past client examples where your firm helped establish these interfaces. The BS&A Human Resource .NET application includes a configurable tool for importing enrollment status from a third-party benefit provider. Clinton Charter Township, MI is a customer using this tool. B.7.5 The Government’s long term fiscal sustainability depends on ability to make smart budget decisions, create long-range financial plans, and effectively manage its existing capital infrastructure and equipment. Please describe a past project where the proposed software is used to complete the following: Create a program budget Consider multiple scenarios that impact service levels Create long term financial projections Develop a multi-year CIP Create asset replacement schedules Identify long term funding needs for capital projects The City of Prior Lake, MN uses BS&A budgeting extensively, including for the creation of multiple scenarios and long term financial projections. BS&A doesn’t have functionality specifically for multi-year CIP, asset replacement schedules, and capital project funding. 63 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 B.7.6 With the system, the Government expects to improve the effectiveness of its purchasing function and a significant part of that will depend on the ability to collect and report information from p -cards. Please describe how past clients have used p-card integration to track spending by vendor, type of purchase, and user. BS&A Accounts Payable system supports the use of p-cards; information can be imported from p-card vendors. Spending can be tracked by vendor where the goods were purchased, but all paid to corresponding p-card vendor. B.7.7 With modern technology providing greater access to information, Government employees and managers are able to better utilize information for decision making. However, much of this relies on having technology that is truly accessible. Please identify how a past client used mobile features, dashboards, reporting tools, and self-service capabilities to create a source of information that is widely used across the organization. BS&A Field Inspection .NET users are using mobile tablets to allow for access to BS&A application while in the field. BS&A Online site allows for employee access to self-service functionality to a Windows browser. 64 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Sample Statement of Work 3. Activities and Deliverables This section describes specific activities and deliverables that will be provided by BS&A Software to fulfill the obligations set out in the proposal. Each subsection includes the detailed requirements for: Data Conversion, Process Definition, and Cutover. 3.1 GL/Budgeting Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Confirm fiscal year end and desired GL format 3. Preliminary conversion development 4. Preliminary conversion QC and documentation 5. Preliminary conversion data review 6. Extract final data with corroborating reports 7. Convert final data 8. QC final BS&A database and documentation 9. Build GL banks and assign GL cash accounts 10. Set up due to/due from rules 11. Verify final BS&A database at cutover Establish BS&A Process 1. Review current GL process a. Chart of Accounts analysis b. Budget process and timing c. Bank reconciliation process and timing d. Pooled cash environments e. Funds with differing FYEs f. Project accounting g. Grant accounting 2. Review BS&A application functionality 3. Define BS&A process and training requirements 4. Document BS&A process 5. Verify final BS&A process at cutover 3.2 Cash Receipting Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Confirm fiscal year end and desired GL format 3. Preliminary conversion development 4. Preliminary conversion QC and documentation 5. Preliminary conversion data review 6. Extract final data with corroborating reports 65 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 7. Convert final data a. If no conversion, add receipt items 8. QC final BS&A database and documentation 9. Verify final BS&A database at cutover Establish BS&A Process 1. Review current CR process a. Number of receipting stations b. Confirm receipting hardware requirements c. Any required application interfaces 2. Review BS&A application functionality 3. Define BS&A process and training requirements 4. Document BS&A process 5. Verify final BS&A process at cutover 3.3 Accounts Payable Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Confirm fiscal year end and desired GL format 3. Preliminary conversion development 4. Preliminary conversion QC and documentation 5. Preliminary conversion data review 6. Extract final data with corroborating reports 7. Convert final data a. If no conversion, import vendors list 8. QC final BS&A database and documentation a. Verify 1099 vendors are marked 9. Verify final BS&A database at cutover Establish BS&A Process 1. Review current AP process a. Invoice entry process and timing b. Approval process c. Check run process and timing 2. Review BS&A application functionality 3. Define BS&A process and training requirements 4. Document BS&A process 5. Verify final BS&A process at cutover 66 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 3.4 Purchase Order Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Preliminary conversion development 3. Preliminary conversion QC and documentation 4. Preliminary conversion data review 5. Extract final data with corroborating reports 6. Convert final data 7. QC final BS&A database and documentation 8. Customize purchase order format 9. Create encumbrances from open POs 10. Verify final BS&A database at cutover Establish BS&A Process 1. Review current PO process a. Requisition entry process b. Purchasing policy c. Approval workflow d. Bidding e. Receiving f. Year end process 2. Review BS&A application functionality 3. Define BS&A process and training requirements 4. Document BS&A process 5. Verify final BS&A process at cutover 3.5 Fixed Assets Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Collect screen shots from current solution 3. Preliminary conversion development 4. Preliminary conversion QC and documentation 5. Preliminary conversion data review 6. Extract final data with corroborating reports 7. Convert final data 8. QC final BS&A database and documentation 9. Verify final BS&A database at cutover Establish BS&A Process 1. Review current FA process a. Depreciation schedule b. Construction in progress c. Improvements 67 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 d. Importing assets from PO or AP 2. Review BS&A application functionality 3. Define BS&A process and training requirements 4. Document BS&A process 5. Verify final BS&A process at cutover 3.6 Miscellaneous Receivables Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Preliminary conversion development 3. Preliminary conversion QC and documentation 4. Preliminary conversion data review 5. Extract final data with corroborating reports 6. Convert final data 7. QC final BS&A database and documentation 8. Customize MR invoice format 9. Customize customer statement format 10. Verify final BS&A database at cutover Establish BS&A Process 1. Review current MR process a. Invoice entry process b. Billing frequency c. Penalties d. ACH payments e. Handling of delinquent balances f. Any required application interfaces 2. Review BS&A application functionality 3. Define BS&A process and training requirements 4. Document BS&A process 5. Verify final BS&A process at cutover 3.7 Payroll Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Preliminary conversion development 3. Refine development using implementation notes and contract language 4. Develop required payroll documents, including check formats 5. Duplicate payroll 6. Test journalization 7. Preliminary conversion QC and documentation 8. Extract final data with corroborating reports 68 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 9. Convert final data 10. QC final BS&A database and documentation 11. Verify final BS&A database at cutover Establish BS&A Process 1. Review current PR process a. Number of employees b. Departments c. Active/inactive d. Pay frequencies e. Hourly pay vs. salary pay f. Allocation tables g. Bargaining unit impact h. Pay structures/rates i. Direct deposit j. Shift work/overtime k. Leave policies l. Workers compensation m. Equipment rental 2. Review BS&A application functionality 3. Define BS&A process and training requirements 4. Document BS&A process 5. Verify final BS&A process at cutover 3.8 Human Resources Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Preliminary conversion development 3. Preliminary conversion QC and documentation 4. Benefit categories 5. Benefit carriers 6. Benefit plans 7. QC final BS&A database and documentation 8. Verify final BS&A database at cutover 69 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Establish BS&A Process 1. Review current HR process a. Number of employees with benefits b. Benefit categories, carriers, plans 2. Review BS&A application functionality 3. Define BS&A process and training requirements 4. Document BS&A process 5. Verify final BS&A process at cutover 3.9 Utility Billing Establish BS&A Databases 1. Extract preliminary data with corroborating reports 2. Collect screen shots from current solution 3. Preliminary conversion development 4. Preliminary conversion QC and documentation 5. Preliminary conversion data review 6. Customize bill format and other documents 7. Extract final data with corroborating reports 8. Convert final data 9. QC final BS&A database and documentation 10. Verify final BS&A database at cutover Establish BS&A Process 1. Review current UB process a. Billing frequency and timing b. Read file interfaces c. Bill printing process d. Payment process e. Delinquent balance process f. Work orders g. Any required application interfaces 2. Review BS&A application functionality 3. Establish new read file interface 4. Establish payment file interface 5. Establish printer export file 6. Define BS&A process and training requirements 70 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 8.0 Sample Documents B.8.1 A ny sample agreements that the Government would be required to sign upon contract award. This would include any applicable software license agreements, professional service agreements, hosting agreements, third party agreements, etc. SAMPLE SOFTWARE LICENSE AND SERVICES AGREEMENT This Software License and Services Agreement that includes attached Exhibits (“Agreement”) is between Bellefeuil, Szur & Associates, Inc. ("BS&A"), a Michigan corporation, and the City/Township of XXXXX (“Customer”), effective the date of the signature of the last Party to sign the Agreement (“Effective Date”). Each party to the Agreement is referred to as a “Party” and the parties, collectively, are referred to as “Parties.” This Agreement sets the terms and conditions under which BS&A will furnish certain licensed software and certain services described herein to Customer. SECTION A – SOFTWARE LICENSE 1. License Grant. 1.1. Upon the Effective Date, subject to the terms of this Agreement and Customer’s ongoing compliance therewith, BS&A hereby grants to Customer a perpetual, non-exclusive, non-transferable, and non- assignable license to install and use the BS&A Software Products for Customer’s internal business purposes only (and not, for example, as a data center, reseller, or service bureau for third parties), only on servers owned by Customer and located at Customer’s facilities, and otherwise in accordance with this Agreement. “BS&A Software Product(s)” means, the: (i) BS&A software products set forth in Schedule 1 to Exhibit A; (ii) related interfaces and customizations; (iii) BS&A manuals, BS&A official specifications, and BS&A user guides provided in or with BS&A software products set forth in Schedule 1 to Exhibit A (“Documentation”); and (iv) all modifications to the BS&A software products set forth in Schedule 1 to Exhibit A, including, but not limited to, fixes, new versions, new releases, updates, upgrades, corrections, patches, work-arounds (collectively, “Modifications”). For the avoidance of doubt, Documentation does not include advertising, other general statements about products, or statements by sales or other staff members. Customer may make and keep (securely) one archival copy of each BS&A Software Product solely for us e as backup. 1.2. Customer will not sublicense, modify, adapt, translate, or otherwise transfer, reverse compile, disassemble or otherwise reverse engineer BS&A Software Products or any portion thereof without prior written consent of the BS&A. Without limiting the foregoing, the BS&A Software Products may not be modified by anyone other than BS&A. If Customer modifies the BS&A Software Products without BS&A’s prior written consent, any BS&A obligation to provide support services on, and the warranty for, the BS&A Software Products will be void. All rights not expressly granted are reserved. 2. License Fees. Customer agrees to pay BS&A, and BS&A agrees to accept from Customer as payment in full for the license granted herein, the software fees set forth in Schedule 1 to Exhibit A. 3. Limited Software Warranty. 3.1. BS&A warrants and represents for a period of one (1) year from the installation of BS&A Software Product that: (i) such BS&A Software Product will perform substantially in the same manner as official 71 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 demonstration versions and in accordance with BS&A’s authorized online tutorials and videos that may have been made available as part of the sales and negotiation process leading up to this Agreement; and (ii) the BS&A Software Product shall conform to the Documentation and be free of material defects in workmanship and materials. Any claim under this Limited Software Warranty must be made within one (1) year from the installation of the applicable BS&A Software Product. Customer’s exclusive remedy in the event of a breach of this warranty shall be to have BS&A use reasonable efforts to repair or replace the non -conforming BS&A Software Product so as to render it conforming to the warranty, or in the event that is not possible to render it conforming with reasonable efforts, to receive a refund of the amount paid for the BS&A Software Product. 3.2. THE FOREGOING LIMITED SOFTWARE WARRANTY IS IN LIEU OF ALL OTHER REPRESENTATIONS OR WARRANTIES RELATING IN ANY WAY TO THE BS&A SOFTWARE PRODUCTS, INCLUDING, BUT NOT LIMITED TO, THEIR FEATURES, ATTRIBUTES, FUNCTIONALITY, AND PERFORMANCE. THE FOREGOING LIMITED SOFTWARE WARRANTY IS IN LIEU OF ALL SUCH REPRESENTATIONS OR WARRANTIES WHETHER EXPRESS OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, ANY IMPLIED WARRANTIES OR REPRESENTATIONS OF MERCHANTABILITY, MERCHANTABLE QUALITY AND FITNESS FOR A PARTICULAR PURPOSE AND THOSE ARISING BY STATUTE OR OTHERWISE IN LAW OR FROM THE COURSE OF DEALING OR USAGE OF TRADE. BS&A DOES NOT REPRESENT OR WARRANT THAT THE BS&A SOFTWARE PRODUCTS WILL MEET ANY OR ALL OF CUSTOMER’S PARTICULAR REQUIREMENTS, THAT THE OPERATION OF THE BS&A SOFTWARE PRODUCTS WILL OPERATE ERROR-FREE OR UNINTERRUPTED, OR THAT ALL PROGRAMMING ERRORS IN THE BS&A SOFTWARE PRODUCT(S) CAN BE FOUND IN ORDER TO BE CORRECTED. 4. Ownership of BS&A Software Products/Proprietary Information. 4.1. BS&A shall retain ownership of, including all intellectual property rights in and to, the BS&A Software Products. Customer agrees not to challenge such rights and hereby assigns any and all copyrights and other intellectual property rights in and to the BS&A Software Products to BS&A and agrees to execute any and all documents necessary to effect the purposes of this paragraph. “Intellectual property rights” means all trademarks, copyrights, patents, trade secrets, moral rights, know-how, and all other proprietary rights. SECTION B – PROFESSIONAL SERVICES 5. Professional Services. BS&A shall provide the services (“Professional Services”) set forth in Schedule 2 to Exhibit A and Exhibit D (Statement of Work), for the prices indicated, provided Customer fulfills its obligations set forth in this Agreement. The Parties may enter into future Statements of Work, which shall become part of this Agreement. 6. Change Orders. If Customer requires the performance of professional services not covered by the existing Agreement, or requires a change to the existing Professional Services, Customer shall deliver to BS&A’s Project Manager a written change order and specify in such change order the proposed work with sufficient detail to enable BS&A to evaluate it (“Change Order”). BS&A may, at its discretion, prescribe the format of 72 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 the Change Order. BS&A shall provide the Customer with an evaluation of the Change Order, which may include a written proposal containing the following: (i) implementation plans; (ii) the timeframe for performance; and (iii) the estimated price for such performance. Upon execution, all Change Orders shall be governed by the terms and conditions of this Agreement, unless mutually agreed upon otherwise in writing. Customer acknowledges that such Change Orders may affect the implementation schedule and Go-Live Dates. 7. License and Ownership. 7.1. All rights, including all intellectual property rights, in and to work product delivered as a result of Professional Services under this Agreement shall be owned by BS&A. For the avoidance of doubt, work product that constitutes a BS&A Software Product or portion thereof shall be governed by Section A including Section 1.1 thereof. 7.2. Subject to Section 7.1 and Customer’s compliance with this Agreement (including payment in full), BS&A grants to Customer a perpetual, non-exclusive, non-transferable, and non-assignable license to use the work product and the intellectual property rights therein for Customer’s internal business purposes only. 8. Cancellation. In the event Customer cancels or reschedules Professional Services, and without prejudice to BS&A’s other rights and remedies, Customer is liable to BS&A for: (i) all expenses incurred by BS&A on Customer’s behalf; and (ii) daily fees associated with the canceled Professional Services (in accordance with the daily fee rate), if less than thirty (30) days advance notice is given regarding the need to cancel or reschedule and BS&A cannot reasonably reassign its affected human resources to other projects where comparable skills are required. 9. Limited Professional Services Warranty. 9.1. BS&A warrants that its Professional Services will be performed in a professional and workmanlike manner, materially in accordance with the Statement of Work attached as Exhibit D. In the event of a breach of the foregoing warranty and a claim in accordance with the next sentence, BS&A’s sole obligation and Customer’s exclusive remedy with respect to such claim will be to have BS&A re - perform the portion of the Professional Services with respect to which the warranty has been breached, to bring it into compliance with such warranty. Any claim for breach of the foregoing warranty must be made by notice to BS&A within thirty (30) days of performance of the portion of the Professional Services with respect to which the claim is made, or said claim shall be deemed waived. 9.2. THE FOREGOING LIMITED PROFESSIONAL SERVICES WARRANTY IS IN LIEU OF ALL OTHER REPRESENTATIONS OR WARRANTIES RELATING TO THE PROFESSIONAL SERVICES, EXPRESS OR IMPLIED INCLUDING, BUT NOT LIMITED TO, ANY IMPLIED WARRANTIES OR REPRESENTATIONS OF MERCHANTABILITY, MERCHANTABLE QUALITY AND FITNESS FOR A PARTICULAR PURPOSE, AND THOSE ARISING BY STATUTE OR OTHERWISE IN LAW, OR FROM THE COURSE OF DEALING OR USAGE OF TRADE. 73 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 SECTION C – MAINTENANCE AND SUPPORT 10. Maintenance and Support Generally. 10.1. For a one-year period, commencing on the installation of the BS&A Software Products, and subject to Customer’s compliance with the Agreement, BS&A will provide, at no charge to Customer, “Maintenance and Support,” meaning the following: (i) Modifications (such as patches, corrections, and updates) as are generally provided at no additional charge (beyond the cost of annual Maintenance and Support) by BS&A to BS&A customers; and (ii) technical support, as further described in Section 11, during BS&A’s normal business hours. 10.2. Commencing one (1) year from the installation of the BS&A Software Products, Maintenance and Support will be provided on an annual basis, subject to compliance with the terms of the Agreement and payment of the annual Maintenance and Support fees outlined in Exhibit B. Maintenance and Support will be renewed annually unless either Party notifies the other at least sixty (60) days prior to the anniversary of installation of its intent to terminate. 10.3. BS&A guarantees that the Maintenance and Support annual fee set forth in Exhibit B will not change for two (2) years from the date of the installation of the BS&A Software Products. After that date, BS&A reserves the right each year to increase the fee over the previous year by no more than an amount that is proportionate to the increase (measured from the beginning of such previous year) in the Consumer Price Index as set forth by the U.S. Department of Labor, Bur eau of Labor Statistics, Consumer Price Index – All Urban Consumers – U.S. City Average (the “Annual Renewal Fee”). 11. Support. 11.1. With respect to Errors following expiration of the Limited Software Warranty, BS&A’s sole obligation and Customer’s sole remedy are set forth in this section 11. Subject to Customer’s compliance with the terms of the Agreement and purchase of Maintenance and Support, BS&A shall use commercially reasonable efforts, commensurate with the severity level, to achieve its support response a nd resolution targets with respect to Errors as set forth in Exhibit C. An “Error” means a verifiable and reproducible failure of a BS&A Software Product to operate in accordance with the Documentation) under conditions of normal use and where the Error is directly attributable to the BS&A Software Product as updated with current Modifications. If the customer modifies the BS&A Software Products without BS&A’s written consent, BS&A’s obligation to provide support services on the BS&A Software Products will be void. 11.2. Support does not include the following: (i) installation or implementation of the BS&A Software Products; (ii) onsite training/support, remote training, application design, and other consulting services; (iii) support of an operating system, hardware, or support outside of BS&A’s normal business hours; (iv) support or support time due to a cause external to the BS&A Software Products adversely affecting their operability or serviceability, which shall include but not be limited to water, fire, wind, lightning, other natural calamities, transportation, misuse, abuse, or neglect; (v) repair of the BS&A 74 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Software Products modified in any way other than modifications made by BS&A or its agents; (vi) support of any other third-party vendors’ software, such as operating system software, network software, database managers, word processors, etc.; and (vii) support of the BS&A Software Products that have not incorporated current Modifications. All such excluded Maintenance and Support Services performed by BS&A at Customer’s request shall be invoiced to Customer on a time and materials basis, plus reasonable expenses associated therewith. 11.3. Notwithstanding anything to the contrary, in order to maintain the integrity and proper operation of the Software, Customer agrees to use commercially reasonable efforts to implement, in the manner instructed by BS&A, all Modifications in a timely manner. Customer’s failure to implement any Modifications may limit or restrict the ability of Customer to implement future Modifications. Customer shall provide prompt notice of any Errors discovered by Customer, or otherwise brought to the attention of Customer. Proper notice may include, without limitation, prompt telephonic and written (either via e-mail or postal mail) notice to BS&A of any purported Error. If requested by BS&A, Customer agrees to provide written documentation of Errors to substantiate those Errors and to otherwise assist BS&A in the detection and correction of said Errors. BS&A will use its commercial reasonable judgment to determine if an Error exists. 11.4. Customer acknowledges and agrees that BS&A and product vendors may require online access to the BS&A system in order for BS&A to provide Maintenance and Support Services hereunder. Accordingly, Customer shall provide a connection to the Internet to facilitate BS&A’s remote access to BS&A’s system. BS&A shall provide remote connection software, which may require installation of a software component on a workstation or server computer. SECTION D – GENERAL TERMS AND CONDITIONS 12. Customer Assistance. Customer acknowledges that the implementation of the BS&A Software Products is a cooperative process requiring time and resources of Customer personnel. Customer shall, and shall cause Customer personnel to, use all reasonable efforts to cooperate with and assist BS&A as may be reasonably required to meet the project deadlines and other milestones agreed to by the Parties for implementation. BS&A shall not be liable for failure to meet such deadlines and milestones when such failure is due to force majeure (as defined in Paragraph 27. below) or to the failure by Customer personnel to provide such cooperation and assistance (either through action or omission). 13. BS&A Proprietary Information. 13.1. Customer acknowledges that the information associated with or contained in the BS&A Software Products and information used in the performance of Professional Services include trade secrets and other confidential and proprietary information of BS&A (the “Proprietary Information”). 13.2. The Customer shall maintain in confidence and not disclose Proprietary Information, directly or indirectly, to any third party without BS&A’s prior written consent. Customer shall safeguard the Proprietary Information to the same extent that it safeguards its own most confidential materials or 75 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 data, but in no event shall the standard implemented be less than industry standard. Proprietary Information shall be used by Customer solely to fulfill its obligations under this Agreement. Customer shall limit its dissemination of such Proprietary Information to employees within the Customer’s business organization who are directly involved with the performance of this Agreement and have a need to use such Proprietary Information. Customer shall be responsible for all disclosur es by any person receiving Proprietary Information, by or through it, as if Customer itself disseminated such information. 13.3. Proprietary Information shall not include any information that: (a) is or becomes publicly known through no wrongful act or breach of any obligation of confidentiality by Customer; (b) was lawfully known to Customer prior to the time it was disclosed to or learned by Customer in connection with this Agreement, provided that such information is not known to Customer solely because of it s prior business relationship with BS&A; (c) was received by Customer from a third party that is not under an obligation of confidentiality to BS&A; or (d) is independently developed by Customer for a party other than BS&A without the use of any Proprietary Information. The following circumstances shall not cause Proprietary Information to fall within any of exceptions (a) through (d) above: (i) a portion of such Proprietary Information is embraced by more general information said to be in the public domain or previously known to, or subsequently disclosed to, the Customer; or (ii) it is a combination derivable from separate sources of public information, none of which discloses the combination itself. 13.4. If Customer is required, or anticipates that it will be required, to disclose any Confidential Information pursuant to a court order or to a government authority, Customer shall, at its earliest opportunity, provide written notice to BS&A so as to give BS&A a reasonable opportunity to secure a protective order or take other actions as appropriate. Customer shall, at all times, cooperate with BS&A so as to minimize any disclosure to the extent allowed by applicable law. 14. Limitation on Liability and Damages. BS&A’S ENTIRE LIABILITY AND RESPONSIBILITY FOR ANY AND ALL CLAIMS, DAMAGES, OR LOSSES ARISING FROM THE BS&A SOFTWARE PRODUCTS (INCLUDING BUT NOT LIMITED TO THEIR USE, OPERATION, AND/OR FAILURE TO OPERATE), PROFESSIONAL SERVICES, MAINTENANCE AND SUPPORT, ANY THIRD-PARTY PERFORMANCE OR LACK THEREOF, OR OTHERWISE ARISING OUT OF OR RELATING TO THIS AGREEMENT, SHALL BE ABSOLUTELY LIMITED TO DIRECT DAMAGES NOT IN EXCESS OF THE PURCHASE PRICE OF BS&A SOFTWARE PRODUCTS PLUS, TO THE EXTENT APPLICABLE, THE PURCHASE PRICE OF ANY PROFESSIONAL SERVICE SET FORTH IN THIS AGREEMENT THAT GIVES RISE TO THE CLAIM. NOTWITHSTANDING ANY PROVISION CONTAINED HEREIN, BS&A SHALL NOT BE LIABLE FOR ANY INDIRECT, CONSEQUENTIAL, SPECIAL, INCIDENTAL, OR CONTINGENT DAMAGES OR EXPENSES, WHETHER IN CONTRACT, TORT (INCLUDING NEGLIGENCE) OR OTHERWISE, ARISING IN ANY WAY OUT OF THIS AGREEMENT, BS&A SOFTWARE PRODUCTS, ANY THIRD- PARTY PERFORMANCE, OR LACK THEREOF, OR BS&A’S PERFORMANCE, OR LACK THEREOF, UNDER THIS AGREEMENT, INCLUDING, WITHOUT LIMITING THE GENERALITY OF THE FOREGOING, LOSS OF REVENUE, PROFIT, OR USE. TO THE EXTENT THAT APPLICABLE LAW DOES NOT PERMIT THE LIMITATIONS SET FORTH HEREIN, THE LIABILITY AND DAMAGES SHALL BE LIMITED AND RESTRICTED TO THE EXTENT PERMITTED BY LAW. 76 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 15. Customer is solely responsible for its data, its database, and for maintaining suitable back-ups of the data and database to prevent data loss in the event of any hardware or software malfunction. Customer covenants and agrees to undertake all necessary measures to protect and secure its data, including implementation of technical, administrative and physical protections. BS&A SHALL HAVE NO RESPONSIBILITY OR LIABILITY FOR DATA LOSS REGARDLESS OF THE REASONS FOR SAID LOSS. To the maximum extent authorized by law, Customer agrees to defend, indemnify and hold BS&A harmless for any claim by any person or entity arising out of any loss or compromise of data or data security or arising out of Customer’s breach of this Agreement. 16. Additional Disclaimer. SUPPLIER PROVIDES NO WARRANTY FOR ANY THIRD-PARTY SOFTWARE AND/OR HARDWARE. EXCEPT AS SET FORTH IN THIS AGREEMENT, SUPPLER WILL NOT BE RESPONSIBLE FOR ANY THIRD-PARTY SOFTWARE, THIRD-PARTY SERVICES AND/OR HARDWARE. 17. Indemnification for Intellectual Property Infringement. If a claim is made or an action is brought alleging that a BS&A Software Product infringes on a U.S. patent, or any copyright, trademark, trade secret or other proprietary right, BS&A will defend Customer against such claim and will pay resulting costs and damages finally awarded, provided that: (a) Customer promptly notifies BS&A in writing of the claim; (b) BS&A has sole control of the defense and all related settlement negotiations; (c) Customer reasonably cooperates in such defense at no expense to BS&A; and (d) Customer remains in compliance with the Agreement and has continued to purchase Maintenance and Support Services. The obligations of BS&A under this Section are conditioned on Customer’s agreement that if the applicable BS&A Software Product, in whole or in part, or the use or operation thereof, becomes, or in the opinion of BS&A is likely to become, the subject of such a claim, BS&A may at its expense either procure the right for Customer to continue using the BS&A Software Product or, at the option of BS&A, replace or modify the same so that it becomes non-infringing (provided such replacement or modification maintains the same material functionality and does not adversely affect Customer’s use of the Update as contemplated hereunder). 18. No Intended Third-Party Beneficiaries. This Agreement is entered into solely for the benefit of BS&A and Customer. No third party will be deemed a beneficiary of this Agreement, and no third party will have the right to make any claim or assert any right under this Agreement. 19. Bridge Agreement. With approval from BS&A, similarly situated local government entities may use this contract as a bridge or piggyback agreement, at any point during the life of contract, for the purchase of similar software and services. BS&A reserves the right to refuse the use of this contract as a bridge contract for any reason, including, but not limited to; differences in size or scope of the agreement, changes in price structure, or market based differences. Any purchases made by other government entities shall be understood to be transactions between that entity and BS&A; Customer shall not be responsible for any such purchases. 20. Termination. Without prejudice to other rights and remedies, and except as otherwise provided in this Agreement, either Party may terminate this Agreement for the other Party’s material breach upon failure to cure such breach after thirty (30) days’ written notice identifying with specificity the nature of the breach. Upon termination of this Agreement: (a) Customer shall promptly pay all amounts payable to BS&A for 77 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Services rendered up to the date of termination; and (b) Customer shall return or destroy, at the direction of BS&A, BS&A’s Proprietary Information in its possession. The termination of this Agreement will not discharge or otherwise affect any pre-termination obligations of either Party existing under this Agreement at the time of termination. Sections 1.2, 4.1, 7.1, 13 through 16, 18, 20 through 29, and the provisions of this Agreement, which by their nature extend beyond the termination of this Agreement, will survive termination of the Agreement. No action arising out of this Agreement, regardless of the form of action, may be brought by Customer more than one (1) year after the date the action occurred. 21. Payment Terms. Customer shall pay BS&A for all amounts in accordance with this Agreement and Exhibit A. 22. Governing Law and Venue. This Agreement shall be governed by, and construed in accordance with, the laws of the state of Michigan, without regard to its choice of law rules. BS&A and the Customer agree that the exclusive venue for any legal or equitable action shall be the Courts of the County of Clinton, State of Michigan, or in any court of the United States of America lying in the Western District of Michigan. 23. Entire Agreement. This Agreement represents the entire agreement of Customer and BS&A with respect to the subject matter hereof, and supersedes any prior agreements, understandings, and representations, whether written, oral, expressed, implied, or statutory. Customer hereby acknowledges that in enteri ng into this Agreement, it did not rely on any information not explicitly set forth in this Agreement. 24. Export. Customer will comply with all applicable laws, including applicable export control laws that prohibit export or diversion of certain products and technology to certain countries or individuals, including foreign nationals in the United States. Customer undertakes to determine any export licensing requirements and to comply with such obligations. The BS&A Software Products are deemed to be commercial computer software as defined in FAR 12.212 and subject to restricted rights as defined in FAR Section 52.227 -19 “Commercial Computer Software-Restricted Rights” and DFARS 227.7202, “Rights in Commercial Computer Software or Commercial Computer Software Documentation,” as applicable, and any successor regulations. Any use, modification, reproduction release, performance, display, or disclosure of BS&A’s Software Products by the U.S. Government shall be solely in accordance with the terms of this Agreement. 25. Severability. If any term or provision of this Agreement, or the application thereof, to any extent, be held invalid or unenforceable, the remainder of this Agreement or the application of such term or provision to persons or circumstances, other than those as to which it is held invalid or unenforceable, will not be affected thereby, and each term and provision of this Agreement will be valid and enforced to the fullest extent permitted by law. 26. Successors and Assigns. This Agreement shall be binding upon the successors, permitted assigns, representatives, and heirs of the Parties hereto. For avoidance of doubt, any expanded use by Customer of the Program, for example, in the event of annexation or desired shared services, shall require the consent of BS&A. 27. Force Majeure. “Force Majeure” is defined as an event beyond the reasonable control of a Party, including governmental action, war, riot or civil commotion, fire, natural disaster, problematic weather, lack of 78 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 availability of Customer provided technology, labor disputes, restraints affecting shipping or credit, delay of carriers or any other cause that could not, with reasonable diligence, be foreseen, controlled or prevented by the Party. Neither Party shall be liable for delays in performing its obligations under this Agreement to the extent that the delay is caused by Force Majeure. 28. Notice. All notices, requests, demands, and determinations under the Agreement (other than routine operational communications), shall be in writing and shall be deemed duly given: (i) when delivered by hand; (ii) one (1) business day after being given to a nationally recognized overnight delivery service for next-business-day delivery, all fees prepaid; (iii) when sent by confirmed facsimile with a copy sent by another means specified in this provision; or (iv) six (6) calendar days after the day of mailing, when mailed by United States mail, via registered or certified mail, return receipt requested, postage prepaid, and in each case addressed as shall be set forth below. A Party may from time-to-time change its address or designee for notification purposes by giving the other prior written notice of the new address or designee and the date upon which it will become effective. If to BS&A: BS&A Software 14965 Abbey Lane Bath, MI 48808 Attn: Contracts Manager Telephone: 517-641-8900 If to Customer: ______________________________ ______________________________ ______________________________ ______________________________ Telephone No.: _________________ 29. Independent Contractor. This is not an agreement of partnership or employment of BS&A or any of BS&A’s employees by Customer. BS&A is an independent contractor for all purposes under this Agreement. 30. The text of the Agreement without any Exhibits and Schedules shall control over any inconsistent text in any of the Exhibits or Schedules. 31. Contract Documents and Order of Precedence. The text of the Agreement without any Exhibits and Schedules shall control over any inconsistent text in any of the Exhibits or Schedules. This Agre ement includes the following Exhibits and Schedules: Exhibit A – Payment Terms Generally Schedule 1 to Exhibit A - License/Interface/Customization Fees Schedule 2 to Exhibit A – Professional Services Fees 79 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Exhibit B – Maintenance and Support Fees Exhibit C – Support Call Process Exhibit D – Statement of Work IN WITNESS THEREOF, the Parties hereto have executed this Agreement as of the dates set forth below. BS&A SOFTWARE, INC. CUSTOMER By: ______________________________ By: ___________________________ Name: ___________________________ Name: _________________________ Title: ____________________________ Title: __________________________ Date: ____________________________ Date: __________________________ 80 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 EXHIBIT A Payment Terms 1. Customer shall pay BS&A within thirty (30) days of invoice. Payments not received within fifteen (15) days of the due date shall be subject to a one and one-half percent (1.5%) per month interest charge (or, if lower, the highest amount chargeable at law) assessed against the unpaid balance from the date due until the date payment is received. 2. Any amount not subject to good faith dispute and not paid within fifteen (15) days of the due date of each invoice shall, without prejudice to other rights and remedies, be subject to an interest charge equal to the lesser of 1.5% monthly or the maximum interest charge permissible under applicable law, payable on demand. Any charges not disputed by Customer in good faith will be deemed approved and accepted by Customer. For purposes of this Agreement, a good faith dispute regarding amounts owed exists only if Customer provides in writing at least ten (10) days prior to due date of payment on the invoice, notification of such dispute, the specific portion of the invoice in dispute, and the specific grounds of the dispute (which must be asserted in good faith), and Customer pays in timely fashion such portions that are not subject to such dispute. 3. BS&A shall invoice Customer $XXXX upon Effective Date for BS&A’s Project Management/Implementation Planning Fees and Data Conversion fees as set forth in Schedule 2. 4. BS&A shall invoice Customer $XXXX at start of On-Site Implementation and Training. Such amount equals BS&A’s software license fees as set forth in Schedule 1. 5. BS&A shall invoice Customer $XXXX at completion of On-Site Implementation and Training. Such amount equals On-Site Implementation and Training costs, Customization and Interface costs, and travel expenses, as set forth in Schedule 2. 6. Customer shall be responsible for all tax es (including sales taxes) imposed as a result of any transaction associated with this Agreement, exclusive of taxes on BS&A’s net income. Schedule 1 to Exhibit A License Fees Schedule 2 to Exhibit A Professional Services Fees EXHIBIT B Maintenance and Support Fees 81 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 EXHIBIT C Support Call Process BS&A’s standard hours for support are from 8:30 a.m. to 6:00 p.m. (EST), Monday through Thursday, and 8:30 a.m. to 5:00 p.m. (EST) on Friday, excluding holidays. You can lodge a support request in three way s: (i) Contact Customer Support option located within the Help menu of all of our applications (ii) our toll-free support line (1-855-BSA-SOFT) or (iii) via email. BS&A targets less than thirty (30) minutes for initial response (“Initial Response Target”). . Customer service requests fall into four main categories: A. Technical. Questions or usage issues relating to I.T. functionality, future hardware purchases, and configuration. BS&A tries to resolve these issues within BS&A’s Initial Response Target or as s oon thereafter as reasonably possible. B. Questions/Support. General questions regarding functionality, use, and setup of the applications. BS&A tries to resolve these issues within BS&A’s Initial Response Target or as soon thereafter as reasonably possible. C. Requests. Customer requests for future enhancements to the applications. Key product management personnel meet with development staff on a regular basis to discuss the desirability and priority of such requests. BS&A tries to resolve these issues within BS&A’s Initial Response Target or as soon thereafter as reasonably possible. D. Issues/Bugs. Errors fall into three (3) subcategories: i. Critical. Cases where an Error has rendered the application or a material component unusable or not usable without substantial inconvenience, causing material and detrimental consequences to business -- with no viable Customer workaround or alternative. The targeted resolution time for critical issues is within one (1) day. ii. Moderate. Cases where an Error causes inconvenience and added burden, but the application is still usable by Customer. The targeted resolution time for all moderate issues is within two (2) weeks, which is within our standard update cycle. iii. Minimal. Cases that are mostly cosmetic in nature, and do not impede functionality in any significant way. These issues are assigned a priority level at our regular meetings, and resolution times are based on the specified priority. Remote Support Process Some support calls may require further analysis of Customer’s database or setup to diagnose a problem or to assist Customer with a question. BS&A’s remote support tools share Customer’s desktop via the Internet to provide Customer with virtual on-site support. BS&A’s support team is able to quickly connect remotely to Customer’s desktop and view its setup, diagnose problems, or assist Customer with screen navigation. EXHIBIT D Sample Statement of Work 82 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 B.8.2 Sample Project Plan Sample – High Level Work Plan The following Sample Implementation Schedule details the overall implementation timeframe and schedule of events. The dates, times and order of events are subject to change based on availability of the City and BS&A staff. This will be determined at the kick-off meeting should BS&A be the selected vendor. BS&A guarantees that the system will be fully functional according to the completion document once finalized at the commencement of the project. Sample Implementation Schedule [Below Template will be updated to fit your needs] Task Responsible Parties (Bold is Primary) Start Duration Initiation Activities Conduct Kick-off Meeting BS&A and City 1 month post signing 1 day Review Project Scope and Project Management Process BS&A 1 month post signing 1 day Establish Project Meeting Schedule BS&A and City 1 month post signing 1 day Assemble BS&A Project Team BS&A 1.5 months post signing 1 day Assemble City Project Team City 1.5 months post signing 1 day Create Initial Project Timeline BS&A & City 1.5 months post signing 1 day IT and Data Conversion Activities Meet with City IT Staff to review Hardware Configurations BS&A and City 5 months pre go-live 1 day Extract Preliminary Data from current System BS&A and City 5 months pre go-live 1 week Conduct Data Mapping and Develop Data Conversion Routines BS&A 5 months pre go-live 1 month Conduct Review of Converted Data with City BS&A and City 4 months pre go-live Approx. 1 day Install Programs BS&A 4 months pre go-live 1 day Knowledge Transfer Conduct On-site Process Review Meeting BS&A and City 3 months pre go-live 2 days Conduct Analysis of Current Forms BS&A and City 3 months pre go-live 1 day Conduct Review of Required Reports BS&A and City 3 months pre go-live 1 day Conduct Analysis of System Interface Requirements BS&A and City 3 months pre go-live 1 day Develop Best Practices Recommendation BS&A 3 months pre go-live 1 day Approve Recommendations City 3 months pre go-live 1 day Provide Consulting and Assistance with Chart of Account Redesign BS&A 3 months pre go-live 1 day Create System Specification Document BS&A 3 months pre go-live 3 days Implementation 83 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Create Forms BS&A 0-2 months pre go-live 2 days Create Reports BS&A 0-2 months pre go-live 2 days Conduct Acceptance Testing City 0-2 months pre go-live 2 days Conduct Final Data Extraction City 1 week pre go-live 2 days Convert Final Data BS&A 1 week pre go-live 2 days On-site Set-up for Users & Configuration Items BS&A 0-1 month pre go-live 4 days Training On-site Training BS&A and City 0-2 months pre go-live Varies Post-Project Activities Conduct Post Project Review & Assessment BS&A and City 1 month post go-live Varies Conduct Post Implementation Follow Up Training BS&A and City TBD TBD 84 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 9.0 Cost Proposal (Under Separate Cover) 85 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 10.0 Additional Information Sample Screen Captures AP Invoice Entry This screen capture shows the Invoice Entry screen in the background, and an example of a scanned-in vendor invoice in the foreground. This latter example is used with our “Batch Add Invoices” process, which simplifies invoice entry, allows you to attach the scanned-in invoice, and then access that image via drill-down. 86 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 General Ledger Home Screen This screen capture shows the “home” GL Details screen for a particular account. Original budget, budget amendments, and encumbrances (purchase orders), are summarized at the bottom of the screen. Budget footnotes are also provided. Every field on this screen can be drilled into for additional details. Data can be presented in chart form as well, which also offers drill-down capability. 87 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 General Ledger “Column Chooser” & Reports This screen capture shows the “column chooser,” which provides extremely easy, flexible generation of reports. Drag a column from the left to the right to add it to the report output. Reports can be viewed on screen, exported to Excel, or saved as PDFs for attachments to emails. 88 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 General Ledger Long Term Budget Forecasting This screen capture illustrates how X years of budget history can be used to predict X years into the future. Items have been categorized to simplify the display. Budget forecasts can also be viewed in detail. Data that is mathematically calculated can be adjusted or overridden, and can be displayed in chart form. 89 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Payroll This screen capture shows the “master” Employee Information screen. Our payroll software manages a wealth of data, and each crucial screen – from Pay Codes to Retirement Info – can be easily navigated by way of Application Views. Included in this screen capture are examples of three of these additional employe e screens: Leave Banks; Pay Codes; Deductions and Expenses. 90 City of Corcoran, MN Enterprise Resource Planning Software System RFP February 18, 2021 Human Resources This screen capture shows the “master” Employee Information screen. Like our payroll software, our human resources software also manages a wealth of data. Each crucial screen, both Applicant and Employee, can be easily navigated by way of Application Views. Included in this screen capture are examples of four of these additional employee screens: Dependents; Licenses & Certifications; Position History; Personnel Action Fo rms. BS&A Software 14965 Abbey Lane Bath MI 48808 (855) BSA-SOFT / fax (517) 641-8960 bsasoftware.com Proposal for Software and Services, Presented to... City of Corcoran, Hennepin County MN May 12, 2021 Quoted by: Dan J. Burns, CPA Thank you for the opportunity to quote our software and services. At BS&A, we are focused on delivering unparalleled service, solutions, support, and customer satisfaction. You’ll see this in our literature, but it’s not just a marketing strategy... it’s a mindset deeply embedded in our DNA. Our goal is to provide such remarkable customer service that our customers feel compelled to remark about it. We are extremely proud of the many long-term customer relationships we have built. Our success is directly correlated with putting the customer first and consistently choosing to listen. Delivering unparalleled customer service is the foundation of our company. City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 2 of 10 Prices good for a period of 90 days from date on proposal Cost Summary Applications and Annual Service Fee prices based on an approximate population of 5,500 and 600 utility customers. Software is licensed for use only by municipality identified on the cover page. If used for additional entities or age ncies, please contact BS&A for appropriate pricing. Prices subject to change if the actual count is significantly different than the estimated count. Applications Financial Management $4,295 General Ledger .NET Accounts Payable .NET $3,645 Cash Receipting .NET $3,645 Fixed Assets .NET $3,645 Utility Billing .NET $2,995 Community Development $5,370 Building Department .NET Field Inspection .NET $2,255 BS&A Online $2,500 Public Records Search + Online Bill Pay With use of integrated Credit Card Processor Subtotal $28,350 Data Conversions Conversion scope and price are estimates, pending review of preliminary data. Convert existing Banyon data to BS&A format: $2,150 General Ledger (COA, Balances, Budget, Up to 10 Years Journal Transaction history) Accounts Payable (Vendors only) $1,825 Cash Receipting (Receipt items, Up to 10 years receipt history) $1,825 Utility Billing $4,000 Convert existing Permit Works data to BS&A format: $4,565 Building Department (per database) Database Setup: Fixed Assets (Setup of Assets, Entry of Value, Accumulated Depreciation) $1,825 Subtotal $16,190 No conversion or database setup to be performed for: Field Inspection City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 3 of 10 Prices good for a period of 90 days from date on proposal Customizations Custom import from third-party software to populate Building Department database with parcels, properties, and current owners. $1,500 BS&A Integration with Laserfiche Document Management System Ability to store and retrieve document attachments in Laserfiche Document Management system, for all currently integrated BS&A applications. $3,000 Subtotal $4,500 Project Management and Implementation Planning Services include: - Analyzing customer processes to ensure all critical components are addressed. - Creating and managing the project schedule in accordance with the customer's existing processes and needs. - Planning and scheduling training around any planned process changes included in the project plan. - Modifying the project schedule as needed to accommodate any changes to the scope and requirements of the project that are discovered. - Providing a central contact between the customer’s project leaders, developers, traine rs, IT staff, conversion staff, and other resources required throughout the transition period. - Installing the software and providing IT consultation for network, server, and workstation configuration and requirements. - Reviewing and addressing the specifications for needed customizations to meet customer needs (when applicable). $14,750 Implementation and Training - $1,000/day - Days quoted are estimates; you are billed for actual days used Services include: - Setting up users and user security rights for each application - Performing final process and procedure review - Configuring custom settings in each application to fit the needs of the customer - Setting up application integration and workflow methods - Onsite verification of converted data for balancing and auditing purposes - Training and Go-Live Software Setup Days: 3 $3,000 Financial Management Applications Days: 14 $14,000 Community Development Applications Days: 10 $10,000 Total: 27 Subtotal $27,000 City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 4 of 10 Prices good for a period of 90 days from date on proposal Post-Go Live Assistance - Review and consult on streamlining day-to-day activities as they relate to the processes within the BS&A applications - Assist customers with more detailed and advanced report options available within the BS&A applications - Revisit commonly-used procedures discussed during training - As needs arise, provide assistance with bank reconciliations - $1,000/day - Days quoted are estimates; you are billed for actual days used Post-Go Live for all applications for which training was performed Days: 4 $4,000 City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 5 of 10 Prices good for a period of 90 days from date on proposal Cost Totals Not including Annual Service Fees Applications $28,350 Data Conversions $16,190 Customizations $4,500 Project Management and Implementation Planning $14,750 Implementation and Training $27,000 Post-Go Live Assistance $4,000 Total Proposed $94,790 Travel Expenses $20,000 Payment Schedule 1st Payment: $30,940 to be invoiced upon execution of this agreement. 2nd Payment: $28,350 to be invoiced at start of training. 3rd Payment: $55,500 to be invoiced upon completion of training. City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 6 of 10 Prices good for a period of 90 days from date on proposal Annual Service Fees Unlimited support during your first year with the program is included in your purchase price. Thereafter, Service Fees are bi lled annually. After two (2) years, BS&A Software reserves the right to increase the Annual Service Fee by no more than the yearly Consumers Price Index for All Urban Consumers U.S. city average (CPI-U). Financial Management Year 1 Year 2 Year 3 Year 4 Year 5 Year 6 Year 7 Year 8 Year 9 Year 10 General Ledger .NET $0 $860 $886 $913 $940 $968 $997 $1,027 $1,058 $1,090 Accounts Payable .NET $0 $730 $752 $775 $798 $822 $847 $872 $898 $925 Cash Receipting .NET $0 $730 $752 $775 $798 $822 $847 $872 $898 $925 Fixed Assets .NET $0 $730 $752 $775 $798 $822 $847 $872 $898 $925 Utility Billing .NET $0 $600 $618 $637 $656 $676 $696 $717 $739 $761 Community Development $0 $1,075 $1,107 $1,140 $1,174 $1,209 $1,245 $1,282 $1,320 $1,360 Building Department .NET Field Inspection .NET $0 $450 $464 $478 $492 $507 $522 $538 $554 $571 BS&A Online $0 $1,500 $1,545 $1,591 $1639 $1,688 $1,739 $1,791 $1,845 $1,900 Public Record Search Total Annual Service Fees $ 0 $6,675 $6,876 $7,084 $7,295 $7,514 $7,740 $7,971 $8,210 $8,457 City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 7 of 10 Prices good for a period of 90 days from date on proposal Additional Information Program Customization BS&A strives to provide a flexible solution that can be tailored to each municipality's needs. However, in some cases, custom work may be required. Typical examples include: ` custom payment import/lock box import ` custom OCR scan-line ` custom journal export to an outside accounting system ` custom reports If you require any custom work, please let us know so that we can better understand the scope of your request and include that in a separate proposal. Cash Receipting Hardware Quantity Cost Epson THM-6000V Series Receipt Printer* $925 x _____ = $_____________ APG Series 100Cash Drawer** $250 x _____ = $_____________ Honeywell Hyperion 1300g Linear-Imaging Scanner $250 x _____ = $_____________ Credit Card Reader $75 x _____ = $_____________ This will add $____________________ to the Total Proposed. *IMPORTANT. The receipt printer must be plugged into the USB port on one workstation (not your server). This printer is not to be shared with other workstations. If more than one workstation will be used for receipting, please consider purchasing more than one receipt printer. **If using a previously-purchased receipt printer with the APG Cash Drawer, which brand will be used with the drawer? ___Epson ___Ithaca ___Other (please specify)______________________________________________ Please provide the number of cash drawers that will be hooked up to the printer_____________ Note: The availability, model numbers, and pricing for all third party hardware listed above is subject to availability from the manufacturers. In the event that the listed hardware is no longer available at the time of purchase, a comparable replacement will be available, at the then current cost. Additional Training - Building Department Report Designer Most of our Building Department customers heavily use our Report Designer, which is included free with the program . Report Designer Training is not included in the training quoted on this proposal and is highly recommended. You may attend a class at our office in Bath Township, or we can train at your location. Report Designer Training is typically completed in one day. Please check the option you are interested in. Report Designer Training will be scheduled after successful implementation and training of your Building Department software. ___ Classroom training, $205/person/day ___ On-site training (unlimited attendees), $1,000/day, travel not included City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 8 of 10 Prices good for a period of 90 days from date on proposal BS&A Online Connection Requirements BS&A Online requires a high-speed internet connection (cable modem or DSL). Payment Processing Requirements Acceptance of online payments requires a contract with one of BS&A’s approved Online Credit Card Processing com panies. Please visit https://www.bsasoftware.com/solutions/bsaonline/public-records-search/ for information. City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 9 of 10 Prices good for a period of 90 days from date on proposal Acceptance Signature constitutes... 1. An order for products and services as quoted Quoted prices do not include Program Customization, training beyond the estimated number of days, or recommended Bank Reconciliation Consultation 2. Agreement with the proposed Annual Service Fees 3. Acceptance of BS&A's hardware recommendations required to efficiently run the .NET applications Signature Date BS&A PLEDGE. We offer a one-year, risk-reversal pledge on our software. If, up to a year after installation, you are not happy with our software and service, you can return our software for a full refund. Returning Accepted Proposal to BS&A Please return the entire proposal, with signature/date (this page) and contact information (next page) filled out, by any of these methods: Mail: BS&A Software 14965 Abbey Lane Bath, MI 48808 Fax: (517) 641-8960 Email: dburns@bsasoftware.com Once your proposal is received, a BS&A representative will contact you to begin the scheduling process. City of Corcoran, Hennepin County MN | May 12, 2021 Dan J. Burns, CPA, Account Executive | (855) 272-7638 | dburns@bsasoftware.com Page 10 of 10 Prices good for a period of 90 days from date on proposal Contact Information If any mailing addresses are PO Boxes, please also provide a Street Address for UPS/Overnight mail. If additional contacts need to be submitted, please make a copy of this page. Key Contact for Implementation and Project Management Name______________________________________________________________________________ Title__________________________________________________ Phone/Fax_________________________________________________________________________ Email_________________________________________________ Mailing Address____________________________________________________________________________________________________________________________ City, State, Zip______________________________________________________________________________________________________________________________ IT Contact Name______________________________________________________________________________ Title__________________________________________________ Phone/Fax_________________________________________________________________________ Email_________________________________________________ Mailing Address____________________________________________________________________________________________________________________________ City, State, Zip______________________________________________________________________________________________________________________________ CITY OF CORCORAN, MINNESTOA PROPOSAL RESPONSE TO RFP FOR PAYROLL AND HR SYSTEM CONTACT: mike duscher mike.duscher@bergankdv.com PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 1 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. LETTER OF TRANSMITTAL Jessica Beise Administrative Services Director City of Corcoran 8200 Country Road 116 Corcoran, MN 55340 Dear Ms. Beise, On behalf of BerganKDV, I am pleased to submit this proposal in response to the RFP released by the City of Corcoran, Minnesota. We appreciate the opportunity to bid on these services and your consideration of our firm. Our firm is only bidding on the HR and PR requirements of the overall proposal. We will show you that our software will work in tandem with any financial management system to share the needed data. The attached proposal addresses the information you requested, including BerganKDV's Human Capital Management division's unique qualifications, the depth and breadth of the services we will provide your City, and our commitment to providing the highest quality work through a process that is both efficient and effective. We understand the responsibility that you, as the City leaders, face each day, your need to respond to your workforce needs with transparency and have the correct financial data at your fingertips to drive the City’s human capital department to the best of their abilities. Our human capital management team will empower you to manage your workforce more efficiently than ever before. With K‐Pay software and our team of experts, we connect the dots between every facet of human capital management for your organization. Our ability to see both in the weeds and from the treetops gives you the comfort that we will have your payroll and HR responsibilities covered and show you the path forward for this department's future. We promise to be more than your HR and PR implementation team; we will be your trusted human capital advisor and a member of the team – the City of Corcoran team. We will work to ensure we are meeting your deadlines. The undersigned is authorized to make representations for the firm. This proposal is a firm and irrevocable offer for 60 days. Sincerely, Michael Duscher Market Consulting Leader Government/Education/NFP Direct: 612‐803‐4442 mike.duscher@bergankdv.com PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 2 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. TABLE OF CONTENTS Profile of Firm Proposing: Executive Summary ............................................................................................................................ 3 Who is BerganKDV? ........................................................................................................................... 4 Qualifications Client References ................................................................................................................................ 7 Client Success Story ............................................................................................................................ 8 Dedicated Service Team ..................................................................................................................... 9 PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 3 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. Executive Summary Implementing a new part of any business software can feel daunting. Processes that are impacted by new software implementation like payroll, timekeeping, and HCM directly affect not just your daily city operations but your employees in both their work lives and home lives. We understand we get it. It is often stressful to initiate any change in these processes. BerganKDV Human Capital Management team’s goal is to reduces this stress and work with you to approach the project to be successful. At BerganKDV, we understand that: The right team needs to be engaged. It is vital to select the right team members from across the City to be part of the implementation and choose the best vendor partner who will be there every step of the way during the implementation and testing. You need to be realistic. Your staff already has a full‐time job; implementing new PR and HR software will lead to efficiency and process advancements that take time to get right. We will help you break the project down into phases that might spread out your team’s demands. A new system means new process evaluations and policies. Implementing a new system is a significant change, but it is still an excellent time to consider other changes in how current processes are running. We support the redocumentation of the new processes that will be built into the new system and will help you accomplish these. How to plan for the after. We are not an implement, drop and run group. We know that getting the system up and running is only one part of the process. We know you need to build time at the end of your plan to gather feedback from users, document your internal process with the system and address your long‐term project list so that you can continue to enhance your HR process and employee experience. HR is part of any organization that is pulled between needing to be a strategic partner and managin tactical process‐based work. We know you expect your staff to accomplish the daily manual processes around PR quickly and accurately, but you still want them to be strategic. Our solutions help you to find more time in your day to focus on strategic initiatives. We at BerganKDV take the required planning and forethought seriously before starting any implementation process. Our professionals bring a broad background of working with clients to solve their HR and PR problems. Effective Communication. Our goal is to be your first call long after this contract is complete when you experience organizational challenges, when you have a question or when you need to talk through something. We believe this can occur only when a relationship is developed and nurtured through strong communication and a thorough understanding of your mission, programs, and operations. We are unwavering in our commitment to our clients and make it our mission to ask the right questions, listen actively, understand your expectations, and deliver results. You can expect a partnership with professionals who value trust, integrity, and relationships. PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 4 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. We have an extensive background in working with clients through a strategic approach in all aspects; we don’t just keep pace with the trends; we stay ahead of the curve. We explore new ways to reduce costs and operate more efficiently. THE BACKSTORY The history of our firm began in 1945, and since the beginning, BerganKDV has been firmly rooted in community. Today we are a Top 100 Firm, we operate in multiple states in nine different offices, employ over 450 experts, and service clients across the country. As we continue to grow, we acknowledge that we are not in the business to provide one‐size‐fits‐all solutions. Every client is different – from business problems to personal preferences. We invest the time to understand your needs and customize our services and solutions to meet them. Our playbook consists of business advisory, tax, assurance and accounting, workforce management, technology, wealth management and turnaround management services. Sure, we offer a robust and competitive service portfolio and notable processes but what really makes us different? OUR PEOPLE….. Office Locations: St. Cloud, Minneapolis, and Farmington – Minnesota Cedar Rapids, Coralville, Des Moines, and Waterloo – Iowa Kanas City ‐ Missouri Omaha ‐ Nebraska OUR PEOPLE Relationships are at the core of everything we do, and our products and services are designed to meet the specific needs of our clients. When working with BerganKDV, clients find that we focus on earning their trust by being actively involved and focused on helping them be successful in all they do. Who is bergankdv? We’re glad you asked! PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 5 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. ENGAGE© | Our Proven Value Creation Process We have aligned our team around our core values and are driven in our commitment to help clients and team members achieve their potential. We help clients reach their goals by utilizing our value creation process. Results of this process have led to more robust client relationships – deeper trust, enhanced communication and minimization of time for all. This process is a key component of our strategy in supporting and helping our clients further their organizations. OUR BUSINESS LINES BerganKDV has a strong bench of resources and expertise available based on needs of the client. This ensures the most effective and efficient results are delivered! PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 6 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. COMMUNITY SUPPORT At BerganKDV, we believe in giving back. We support the organizations our people and clients are actively involved with. On average, we support multiple events a week in our communities. VISION AND VALUES We are powered by people who do business the Midwest way delivering comprehensive business, financial and technology solutions. Our firm consists of highly talented individuals that put relationships before business deals and clients before profits. Our values drive our decisions. OUR FOCUS and OUR PROMISE Empowering people and creating a wow experience for our clients. We go beyond so you can DO MORE. We continue to align BerganKDV team member core values and sense of purpose with our firm core values and mission. We hire towards our core values and manage performance through real time feedback corresponding to our core values. We have found that this work results in more open conversations at BerganKDV which impacts employee engagement and client care. Other Information More than 20% of BerganKDV owners/shareholders are women. PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 7 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. Client References A few of our engagements in recent years are listed below and we encourage you to contact them. Dave Erickson VP of Operations First American Care 651‐289‐8371 Size: 300+ employees Location sites: Three facilities and a central office System migrated from: ADP Steph Sunde Director of HR Assumption Community 320‐348‐2346 Size: 170+ employees Multiple pay types and shifts System migrated from: ADP Workforce Now Deb Moorer Office Manager Glenwood Village Care Center 320‐654‐5761 Size: 75 employees Location sites: Multiple locations and departments System migrated from: ADP PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 8 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. Client success story PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 9 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. OUR DEDICATED SERVICE TEAM BerganKDV has a personalized team of professionals to meet your unique needs. Your BerganKDV team has extensive experience working with governmental organizations. This translates into a greater ability to understand your unique organization. LEADERSHIP TEAM First, all governmental clients will interact with a member of the Government Market’s leadership team at least annually. There is no charge to our clients for these meetings. These individuals are instrumental in ensuring that our clients are receiving “WOW” service and having all their needs met. JODI L. woodward, CPA, SHAREHOLDER, GOVERNMENT MARKET LEADER Role and Experience: In her role as Government Market Leader, Jodi is responsible for the government market by managing all aspects of the value creation cycle and will work with the governmental team members throughout the firm to ensure a wow experience is being delivered. Jodi, who is located in the firm’s Omaha market, is a CPA with more than 25 years of experience in public accounting, focusing mainly on governmental and nonprofit entities; ERISA plans; commercial real estate, including HUD audits; and colleges & universities. Jodi has a bachelor’s degree in accounting from Midland University and is active in the American Institute of Certified Public Accountants where she currently serves on the Employee Benefits Plan Audit Quality Center Executive Committee and is very involved in the Peer Review Program. Jodi is a member of the Nebraska Society of CPAs, CREW Omaha Metro and Omaha Academy of Ballet, where she serves on the board. MICHAEL E. DUSCHER, GOVERNMENT CONSULTING LEADER Role and Experience: Mike serves clients in the government sector. He is responsible for growing the client base in the government market by building relationships with potential clients and working with them to help solve pain points they are experiencing in their business operations. Mike received his bachelor’s degree in organizational communication and sociology. He is involved with Northern Voices, a nationally recognized school for deaf and hearing of children and Crescent Cover Respite & Hospice Home for Kids. PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 10 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. OUR DEDICATED SERVICE TEAM (continued) Micah Zirnhelt, sphr, shrm‐scp Consulting manager human capital management Micah has worked in human resources, payroll and benefits administration outsourcing for the past 15 years and brings a wide background of working with clients to solve their business problems. He helps clients make the best use of the K‐Pay system to support and streamline their HR processes. He also provides client consulting to improve their internal human resources processes outside of K‐Pay. Micah holds a bachelor’s degree in musical theatre from the Boston Conservatory of Music. kevin ferrario, cpp solution leader payroll On a day‐to‐day basis Kevin manages the operations within the payroll and human capital management team. This includes production, support, tax filing and deposits and delivering on client expectations. Kevin works with businesses and organizations of varying sized with their payroll needs and as the clients grow, he helps them scale their payroll and human capital management tools to keep the business running smoothly. Kevin attended Winona State University and is certified payroll professional. He is the board vice president of the St. Francis Gladiator Wrestling Club, head coach for SBAA 10U Baseball team and assistant coach for the St. Francis 14U traveling fast‐pitch softball team. PROPOSAL PREPARED ESPECIALLY FOR CITY OF CORCORAN, MINNESOTA 11 | PAGE BERGANKDV, LTD.|BERGANKDV.COM|DO MORE. THANK YOU. BERGANKDV.COM | 612.803.4442 | INFO@BERGANDKV.COM Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments General Requirements HR.1 The system has the ability to support a system- generated unique employee number with override capabilities. CRITICAL Yes. Highly functional. HR.2 The system has the ability to track various employee information through unique employee identifier. CRITICAL Yes Highly Functional HR.3 The system has the ability to capture and maintain 1-9 documentation and track status. CRITICAL Yes Highly Functional HR.4 The system has the ability to via automated workflow, generate personnel status email notices on-line (e.g. FMLA, applicant rejection, military leave, leave donation, return to work, benefit information). CRITICAL Yes Highly Functional HR.5 The system has the ability to accommodate workflow approvals of human resources-related processes and documents. DESIRED Yes Highly Functional The system has the ability to maintain and manage employee personnel information, including (but not limited to) the followin g fields: HR.6 Name; CRITICAL Yes HR.7 DOB; CRITICAL Yes HR.8 SSN; CRITICAL Yes HR.9 Employee number; CRITICAL Yes HR.10 Spouse information; DESIRED Yes HR.11 Dependent information; DESIRED Yes HR.12 Contact detail (phone, cell, e-mail address); CRITICAL Yes HR.13 Date of hire; CRITICAL Yes HR.14 Start date; CRITICAL Yes HR.15 Leave date(s); CRITICAL Yes HR.16 Benefit detail (benefit eligible date, retirement date); CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.17 Emergency contact information (name(s), phone, address, e-mail address); and CRITICAL Yes HR.18 Other standard and user-defined fields. CRITICAL Yes HR.19 The system has the ability to capture multiple emergency contacts. DESIRED Yes HR.20 The system has the ability to, upon new hire, notify all pertinent departments (based on user0defined criteria) and trigger appropriate workflow processes (e.g. established network access and sets up workstation, Payroll set-up, Benefits enrollment, equipment issued etc.). DESIRED Yes HR.21 The system has the ability to provide for an orientation process checklist that can be customized by and for each department and by job title. DESIRED Yes HR.22 The system has the ability to attach files to work orders at entry, management or reporting stage. DESIRED Possible Need more Info HR.23 The system has the ability to accommodate planned or immediate terminations. CRITICAL Yes HR.24 The system has the ability to define multiple separation codes (discharged die to misconduct, performance issues, poor attendance, other user-defined; resignation due to mutual agreement, career advancement, career change relation, retirement, other user-defined). CRITICAL Yes HR.25 The system has the ability to record employee's and supervisor's reasons for termination/separation. CRITICAL Yes HR.26 The system has the ability to track the length of time an employee has filled a position. CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.27 The system has the ability to record and track items assigned to employees (e/g/ cell phone, keys, ID card, Parking pass, etc). CRITICAL Yes HR.28 The system has the ability to general personnel action forms on-line. CRITICAL Yes HR.29 The system has the ability to transfer employees from one position to another. CRITICAL Yes HR.30 The system has the ability to accommodate user - defined rules for employee transfer (e.g. employees assigned to multiple departments are flagged as exceptions). DESIRED Yes The system has the ability to track the following position data: HR.31 Fiscal year; CRITICAL Yes HR.32 Job title; CRITICAL Yes HR.33 Job code; CRITICAL Yes HR.34 Position number; CRITICAL Yes HR.35 Position type (e/g/ skilled labor, management, etc). DESIRED Yes HR.36 Supervisor name; CRITICAL Yes HR.37 Physical work location; DESIRED Yes HR.38 Department/program/project; CRITICAL Yes HR.39 Exempt/mom-exempt status; CRITICAL Yes HR.40 Percent of fulltime; CRITICAL Yes HR.41 Pay rate; CRITICAL Yes HR.42 Probation end date/period; CRITICAL Yes HR.43 Salary range; DESIRED Yes HR.44 FT/PT/retiree flag; CRITICAL Yes HR.45 Temp/permanent flag; CRITICAL Yes HR.46 Department/division/program start date; DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Budget Preparation HR.47 Promotion date(s); CRITICAL Yes HR.48 Anniversary date; CRITICAL Yes HR.49 Unlimited text field or comments; and DESIRED Yes HR.50 Other user-defined fields. DESIRED Yes HR.51 The system has the ability to accommodate multiple labor codes. DESIRED Yes HR.52 The system has the ability to maintain job descriptions online. CRITICAL Yes HR.53 The system has the ability to allow positions to be budgeted for partial year (e.g. 3,6,9 months). CRITICAL Yes HR.54 The system has the ability to reinstate a separated employee, requiring approval sign-ff per user-defined rules (at multiple levels if necessary). CRITICAL Yes The system has the ability to maintain current salary information including (but not limited to): HR.55 Effective date; CRITICAL Yes HR.56 Salary range; DESIRED Yes HR.57 Wage range; DESIRED Yes HR.58 Employee review date; CRITICAL Yes HR.59 Pay change reason/action code; CRITICAL Yes HR.60 Amount of change; CRITICAL Yes HR.61 Unlimited text field to describe pay change reason/action; and DESIRED Yes HR.62 Other user-defined fields. DESIRED Yes HR.63 The system has the ability to provide for multiple salary schedule. CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.64 The system has the ability to accommodate multiple salary table lined to multiple job/description classes. CRITICAL Yes HR.65 The system has the ability to accommodate tracking shift structure for employees. CRITICAL Yes HR.66 The system has the ability to capture permanent and temporary job-type indicators, including (but not limited to) seasonal and provisional employees. DESIRED Yes HR.67 The system has the ability to capture the typical hours of a position (e.g. 9am to 5pm). CRITICAL Yes HR.68 The system has the ability to support the submission of a detailed budget, one that includes revenue sources, detailed expenditures, multi- funding sources, multi-year budget and matching funds. DESIRED Possible Need more info HR.69 The system has the ability to provide multiple pay grades. CRITICAL Yes HR.70 The system has the ability to assign employees to single or multiple jobs and graces (with multiple levels of sign-off approval per user-defined rules). Yes HR.71 The system has the ability to provide positions filled/available reporting. CRITICAL Yes HR.72 The system has the ability to monitor base salary and additional compensation components by employee. CRITICAL Yes The system has the ability to allow the City to define a number of employee deductions/garnishments including (but not limited to): HR.73 Child support; CRITICAL Yes HR.74 Tax liens; CRITICAL Yes HR.75 Bankruptcy's; CRITICAL Yes HR.76 Creditors; CRITICAL Yes HR.77 Trustees; CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.78 Court orders; and CRITICAL Yes HR.79 Other, user defined. DESIRED Possible Need more Info HR.80 The system has the ability to track temporary alternate duty assignments and restrictions. DESIRED Yes HR.81 The system has the ability to generate seniority reporting. DESIRED Yes HR.82 The system has the ability to support HIPPA compliance. DESIRED Yes The system has the ability to maintain, at a minimum, the following applicant data: HR.83 Date of application; CRITICAL Yes HR.84 Time of application; CRITICAL Yes HR.85 Applicant Name CRITICAL Yes HR.86 Source of application information; DESIRED Yes HR.87 Relatives employed by City; CRITICAL Yes HR.88 Address; CRITICAL Yes HR.89 Phone number/s; CRITICAL Yes HR.90 Email address/es; CRITICAL Yes HR.91 Positions applied/referred for; CRITICAL Yes HR.92 Ability to be legally employed in the USA (Y/N); CRITICAL Yes HR.93 Reference detail; CRITICAL Yes HR.94 Attached resume (Word or pdf); CRITICAL Yes HR.95 Criminal background information; CRITICAL Yes HR.96 Previous employment information; CRITICAL Yes HR.97 Education; CRITICAL Yes HR.98 Certificates/licensure; CRITICAL Yes HR.99 Results of required test; and CRITICAL Yes HR.100 Other user defined. DESIRED Possible Need more info Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to track EEO data for use in statistical analysis and reporting, including but not limited to: HR.101 Requisition Number; DESIRED Yes HR.102 Selected Flag; DESIRED Yes HR.103 Applicant name; CRITICAL Yes HR.104 Applicant ID; DESIRED Yes HR.105 Applicant Record Number DESIRED Yes HR.106 Applicant address; CRITICAL Yes HR.107 Hone phone; CRITICAL Yes HR.108 Application received date CRITICAL Yes HR.109 Email address; CRITICAL Yes HR.110 Race; CRITICAL Yes HR.111 Sex; CRITICAL Yes HR.112 Department; CRITICAL Yes HR.113 Highest grade completed; CRITICAL Yes HR.114 GPA; DESIRED Yes HR.115 Recruiting Source; CRITICAL Yes HR.116 Other user-defined fields. DESIRED Possible Need more in HR.117 The system has the ability to store EEO data separate from the applicant record. CRITICAL Yes HR.118 The system has the ability to restrict access to EEO data to authorized users as determined by City user profiles. CRITICAL Yes HR.119 The system has the ability to populate EEO data by electronic submissions from applicant record and requisition data. CRITICAL Yes HR.120 The system has the ability to save EEO data upon initial entry for user's profile with blocks prefilled for multiple application submissions. DESIRED Yes HR.121 The system has the ability to track ADA accommodations with an applicant. DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.122 The system has the ability to support EEO an ADA analysis. DESIRED Possible Need more info HR.123 The system has the ability to flag an employee record upon SSN validation, once terminated as unable to reapply. CRITICAL Yes New Hite Processing HR.124 The system has the ability to send information to required departments for data transfer once hired (i.e. IS for computer account setup, etc.). DESIRED Yes HR.125 The system has the ability to require fingerprints for certain employees, prior to starting their first day. CRITICAL Yes HR.126 The system has the ability to produce a user-defined pre-employment checklist of forms that must be completed electronically. CRITICAL Yes HR.127 The system has the ability to monitor conditional fire requirements and pass/fail information, test scores, drug tests and other data. CRITICAL Yes HR.128 The system has the ability to notify applicant that additional documentation is needed for hire (e.g. degrees, certifications, etc.)/ CRITICAL Yes HR.129 The system has the ability to identify training requirements based on multiple factors including the position ID, job code, department, division/service area. DESIRED Yes The system has the ability to define a checklist for benefit eligible and non-benefit eligible new employees, including: HR.130 Employee Handbook and Policy Manuals CRITICAL Yes HR.131 Union Contract (confirm that contract was provided only). CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to provide salary and benefit forecasting capabilities based on the import/integration from the payroll application including: HR.132 Required Forms; DESIRED Yes HR.133 Optional Forms; and DESIRED Yes HR.134 Other, user defined. DESIRED Possible The system has the ability to define a checklist for employees new to position based upon: HR.135 Job class; CRITICAL Yes HR.136 Position level; CRITICAL Yes HR.137 Department; and CRITICAL Yes HR.138 Other, user defined. DESIRED Possible HR.139 The system has the ability to define orientation requirements for new hires based upon department, job class, and/or other factors. CRITICAL Yes HR.140 The system has the ability to route completed new employee forms to appropriate departments, based upon multiple workflows. DESIRED Yes HR.141 The system has the ability to list missing documents by each new hire and/or dates. CRITICAL Yes HR.142 The system has the ability to define different escalation factors based upon checklist item (e.g. required item has a certain time frame vs and optional item). DESIRED Possible Need more Info HR.143 The system has the ability to override missing required checklist items with security permissions. DESIRED Yes HR.144 The system has the ability to correct and make adjustments to forms based upon effective date and/or retroactively. CRITICAL Yes HR.145 The system has the ability to set up special posting and hiring rules for union, related jobs and positions (example; lateral postings). CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Benefits HR.146 The system has the ability to provide for a Benefits-specific new employee orientation checklist that can be customized by and for each department, job class, and status (temporary or permanent) (all items assigned to employee). CRITICAL Yes HR.147 The system has the ability to accommodate participant and dependent benefit enrollment processing for benefit options. CRITICAL Yes HR.148 The system has the ability to establish multiple eligibility rules. CRITICAL Yes HR.149 The system has the ability to calculate premium amounts based on user-defined tables. CRITICAL Yes HR.150 The system has the ability to start and stop any deductions at any given time. CRITICAL Yes HR.151 The system has the ability to support flexible benefit accounts. CRITICAL Yes HR.152 The system has the ability to support flexible spending accounts enrollment and reimbursement. CRITICAL Yes HR.153 The system has the ability to identify type of coverage (e.g., single, 2-person family). CRITICAL Yes HR.154 The system has the ability to track benefits eligibility. CRITICAL Yes HR.155 The system has the ability to notify employees of benefit eligibility dates. CRITICAL Yes HR.156 The system has the ability to maintain coverage and deduction detail by date. CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to track the following: HR.157 Coverage effective dates; CRITICAL Yes HR.158 Coverage history; CRITICAL Yes HR.159 Name change history; CRITICAL Yes HR.160 Dependent information; CRITICAL Yes HR.161 Beneficiary information; and CRITICAL Yes HR.162 Years of service CRITICAL Yes The system has the ability to maintain premium and deduction amounts for multiple benefit plans including (but not limited to): HR.169 Health Insurance; CRITICAL Yes HR.164 Dental Insurance; CRITICAL Yes HR.165 Vision Insurance; CRITICAL Yes HR.166 Life Insurance; CRITICAL Yes HR.167 Deferred compensation plans, including retirement plans; CRITICAL Yes HR.168 Flexible spending accounts for medical and childcare reimbursement accounts; CRITICAL Yes HR.169 Long term disability; CRITICAL Yes HR.170 Short term disability; CRITICAL Yes HR.171 529.Education Savings Plan; and DESIRED Yes HR.172 457 Plan. CRITICAL Yes HR.173 The system has the ability to allow six months open for benefits enrollments and closeouts. DESIRED Yes HR.174 The system has the ability to establish multiple eligibility rules. DESIRED Yes HR.175 The system has the ability to track benefit allowance contributions to insurance other than health insurance. DESIRED Yes HR.176 The system has the ability to differentiate for deferred compensation purposes, any employer match. CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.177 The system has the ability to establish the appropriate tax ramifications for the deferred compensation amounts. CRITICAL Yes HR.178 The system has the ability to manually adjust benefit withholdings. CRITICAL Yes HR.179 The system has the ability to maintain the benefit pool even in the certain user-defined non-paid statuses. DESIRED Possible Need more info The system has the ability to maintain benefit eligibility data including: HR.180 Length of service CRITICAL Yes Hr.181 Age; CRITICAL Yes HR.182 Marital status; CRITICAL Yes HR.183 Dependent information for multiple dependents (including name, SSN, Address, other contact information); DESIRED Yes HR.184 Employee status (active, retired, leave of absence, suspension, termination, FMLA, military leave, etc.) CRITICAL Yes HR.185 Hours worked by various search criteria (e.g. weekly, bi-weekly, pay period, annually); and CRITICAL Yes HR.186 Other user defined. DESIRED Yes HR.187 The system has the ability to provide tracking for death of employees, retirees or dependent. DESIRED Yes HR.188 The system has the ability to allow mass updates of employee plan designation. DESIRED Yes HR.189 The system has the ability to allow online update of benefits individually and as a group. DESIRED Yes HR.190 The system has the ability to generate summary statements by employees. DESIRED Yes HR.191 The system has the ability to integrate COBRA and Retiree Benefits with General Ledger and Accounts Receivable. DESIRED Yes HR.192 The system has the ability to track and bill health and other benefit payments for retirees. DESIRED Possible Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.193 The system has the ability to identify leave, start and end dates. CRITICAL Yes HR.194 The system has the ability to identify employee status (e.g. FLMA leave, military leave, retired). CRITICAL Yes HR.195 The system has the ability to track different leave types which accumulate concurrently as defined by user for each employee (e.g. military annual leave, military leave, workers' compensation). DESIRED Yes HR.196 The system has the ability to track leave and place annual or automatic stop on accruals when contract maximums are reached. CRITICAL Yes HR.197 The system has the ability to notify employees of rejected leave requests. CRITICAL Yes HR.198 The system has the ability to provide notices to employees for Family Medical Leave Act (FMLA) events, based on user-defined criteria. DESIRED Yes HR.199 The system has the ability to track FMLA based on user-defined criteria (e.g. length of service, eligibility, previous FMLA use etc.). DESIRED Yes HR.200 The system has the ability to maintain benefit coverage for employees on leave who elect to pay for his or her own coverage. DESIRED Yes HR.201 The system has the ability to produce confirmation letters indicating the employee's current participation levels in all benefit plans. DESIRED Yes HR.202 The system has the ability to interface with the employee’s self-service module for benefit plan open enrollment, benefits and other changes, etc., (with verification process). CRITICAL Yes HR.203 The system has the ability to track current and historical benefit costs including (But not limited to) employer cost, employee cost and total premiums/contributions. DESIRED Yes HR.204 The system has the ability to maintain a record of employee plan history. DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.205 The system has the ability to validate that the employee is eligible for the plan selected. CRITICAL Yes HR.206 The system has the ability to determine coverage and deduction amounts for the employee using parameters stored in the benefit plan structure tables. CRITICAL Yes HR.207 The system has the ability to support pre-and post- tax payroll deductions. CRITICAL Yes HR.208 The system has the ability to automatically produce payroll deductions based on benefit plan enrollments. CRITICAL Yes HR.209 The system has the ability to process and pay benefits reimbursement on a payroll check. DESIRED Yes HR.210 The system has the ability to retroactively enroll in plans and automatically impact payroll to compute the proper pay adjustments and dedu ctions. CRITICAL Yes HR.211 The system has the ability to retroactively enroll dependents in plans and automatically impact payroll to compute the proper pay adjustments and deductions. CRITICAL Yes HR.212 The system has the ability to recalculate life insurance amounts and costs to be recalculated for all employees at any time during the year based on changed salary, cover, and/or plan cost parameters. DESIRED Possible HR.213 The system has the ability to enter new enrollment data for a future date without changing the current elections until the date of the new enrollment period begins. DESIRED Yes Employee Discipline/Grievances HR.214 The system has the ability to record and track various discipline types that are maintained by the HR department. DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.215 The system has the ability to record and track disciplinary actions (and maintain history) including information on incidents causing the action, steps taken in resolution, and the personnel involved. CRITICAL Yes HR.216 The system has the ability to allow a new supervisor (within the City) to view prior discipline action, with appropriate security. CRITICAL Yes HR.217 The system has the ability to automatically route information to HR, supervisors, etc., regarding disciplinary actions. CRITICAL Yes HR.218 The system has the ability to capture user-entered narrative for each step of grievance process. CRITICAL Yes HR.219 The system has the ability to track all disciplinary complaints, investigations, and actions, including (but not limited to); letters of reprimand; warnings; suspensions; discharges. CRITICAL yes The system has the ability to capture and maintain disciplinary action detail, including (but not limited to): HR.220 File number; Yes HR.221 Employee name; CRITICAL Yes HR.222 Home department; CRITICAL Yes HR.223 Issue; CRITICAL Yes HR.224 Proposed discipline; CRITICAL Yes HR.225 Date; CRITICAL Yes HR.226 Date discipline rendered; CRITICAL Yes HR.227 Supervisor's name; CRITICAL Ys HR.228 Grievance field indicator; DESIRED Possible HR.229 Unlimited notes and/or text entry; and DESIRED Yes Though not unlimited as a default HR.230 Other user-defined fields. DESIRED Yes HR.231 The system has the ability to define multiple grievance rules. DESIRED Yes The system has the ability to maintain historical disciplinary action detail, including (but not limited to): HR.232 Employee; CRITICAL Yes HR.233 Date: CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.234 Type of incident; CRITICAL Yes HR.235 Follow-up action; and CRITICAL Yes HR.236 Other user-defined fields. DESIRED Yes Position Control The system has the ability to perform the following position transactions: HR.237 Add or delete positions; CRITICAL Yes HR.238 Reclassify positions; CRITICAL Yes HR.239 Change job title: CRITICAL Yes HR.240 Transfer positions; CRITICAL Yes HR.241 Freeze or unfreeze positions; CRITICAL Ys HR.242 Activate or inactivate positions; CRITICAL Yes HR.243 Split position funding and/or labor allocation; DESIRED Yes HR.244 Change the number of authorized full-time equivalents per positional and DESIRED Yes HR.245 Record associated effective dates of position transactions. CRITICAL Yes HR.246 The system has the ability to ensure that a position is defined and authorized before it can be budgeted. DESIRED Possible HR.247 The system has the ability to move positions from one location to another. DESIRED Yes HR.248 The system has the ability to track employee movement between positions. DESIRED Yes HR.249 The system has the ability to maintain multiple probation/adjustment period codes (including temporary position codes). DESIRED Yes HR.250 The system has the ability to assign a unique identifier and title to each position. DESIRED Yes HR.251 The system has the ability to track position budgeted cost. DESIRED Yes HR.252 The system has the ability to track position characteristics including (but not limited to); job classification; position title; work schedule; skills, training and certification requirements. CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.253 The system has the ability to track internal promotions. CRITICAL Yes HR.254 The system has the ability to create budgets at job, grade, position, and organizational levels . CRITICAL Yes HR.255 The system has the ability to provide budget comparisons against actual costs. CRITICAL Yes HR.256 The system has the ability to perform multiple personnel budgeting forecast scenarios, with the ability to save information ("what-if" scenarios). DESIRED Yes HR.257 The system has the ability to capture job title history. DESIRED Yes HR.258 The system has the ability to accommodate budgeting for overall and departmental headcount salaries. CRITICAL Yes HR.259 The system has the ability to accommodate single or multiple funding sources for each position DESIRED Yes HR.260 The system has the ability to maintain history on job vacancy (position) information for at least ten years. CRITICAL Yes Performance Evaluations HR.261 The system has the ability to accommodate job- specific employee evaluation forms in various formats that can be easily customized by the City. DESIRED Yes HR.262 The system has the ability to attach unlimited performance evaluations to the employee record. CRITICAL Yes HR.263 The system has the ability to capture performance and salary review information. CRITICAL Yes HR.264 The system has the ability to perform evaluation scheduling (including employee, reviewer(s), date). CRITICAL Yes HR.265 The system has the ability to record performance evaluation detail, including narratives. CRITICAL Yes HR.266 The system has the ability to accommodate electronic performance evaluations, utilizing electronic signatures to notate approval. CRITICAL Yes HR.267 The system has the ability to notify employees and supervisors of evaluation due dates (through workflow). CRITICAL Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.268 The system has the ability to track evaluation completion and overdue status (through workflow0, with periodic and/or continued automatic notifications until completion. CRITICAL Yes HR.269 The system has the ability to accommodate performance evaluation "forms" that are linked to employee class (e.g. occupational types, etc.). CRITICAL Yes Training and Certifications The system has the ability to record and update employee training data, including (but not limited to): HR.270 Licenses; CRITICAL Yes HR.271 Certificates; CRITICAL Ys HR.272 Course enrollment/completion; and CRITICAL Yes HR.273 Other user-defined fields. DESIRED Yes HR.274 The system has the ability to track dates of licensure, certification, training, permits and other expirations. CRITICAL Yes HR.275 The system has the ability to provide employee and supervisor notices when expirations are within a user-defined time period. DESIRED Possible HR.276 The system has the ability to provide employee and supervisor notices of violation and expirations. DESIRED Yes HR.277 The system has the ability to track driver's license requirements for various job classes. DESIRED Yes HR.278 The system has the ability to track training attendance/completion by employee, division and department. CRITICAL Yes HR.279 The system has the ability to track progress toward and completion of licenses and certifications as required for specific jobs. CRITICAL Yes HR.280 The system has the ability to integrate with imaging/scanning/document management systems. CRITICAL yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments Employee Self Service The system has the ability to provide employees view access to personal information including (but not limited to): HR.281 Name; CRITICAL Yes HR.282 Address; CRITICAL Yes HR.283 Emergency contact information; CRITICAL Yes HR.284 Demographics; CRITICAL Yes HR.285 Benefit information (selected plans, dependents beneficiaries); CRITICAL Yes HR.286 Salary information (base, supplemental, YTD, history); CRITICAL Yes HR.287 Other deductions information (garnishments, child support, voluntary deductions); CRITICAL Yes HR.288 Flexible spending information (amount spent, remaining balance); CRITICAL Ys HR.289 Leave balances; and CRITICAL Yes HR.290 Other user-defined fields. DESIRED The system has the ability to allow employees to update personal information with appropriate verification process/workflow, including (but not limited to) the following: HR.291 Address; CRITICAL Yes HR.292 Phone number/s; CRITICAL Yes HR.293 Contact information; CRITICAL Yes HR.294 Emergency contact information; CRITICAL Yes HR.295 Direct deposit with attached supporting documentation; CRITICAL Yes HR.296 W4; CRITICAL Yes HR.297 Voluntary deduction amounts; CRITICAL Yes HR.298 Open enrollment at appropriate dates, and CRITICAL Yes HR.299 Other user-defined fields. DESIRED Yes HR.300 The system has the ability to provide notification of changes (as described able) to an employee and a supervisor or other user-defined department. DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.301 The system has the ability to accommodate user- defined approval for Employee Self Service activities (changes, information entry) performed by the employee, including (but not limited to) user verification (via password or other identification verification means). DESIRED Yes HR.302 The system has the ability allow employees to view pay stub information including (but not limited to) the following: gross pay, taxes, other deductions, net pay, pay period and year-to-date totals. CRITICAL Yes HR.303 The system has the ability to allow employees to review vacation and sick day balances and submit leave requests. CRITICAL Yes HR.304 The system has the ability to allow employees to review and request changes for direct deposit amounts. CRITICAL Yes HR.305 The system has the ability to allow employees to submit time/leave online. CRITICAL Yes HR.306 The system has the ability to display W2s for viewing and printing in a secure environment. CRITICAL Yes HR.307 The system has the ability to display the most recent pay stub CRITICAL Yes General Reporting HR.308 The system has the ability to provide employee benefits reporting. CRITICAL Yes HR.309 The system has the ability to generate reports and forms that comply with EEOC, FMLA, Department of Labor, Military Status and FLSA standards and regulations. CRITICAL Yes HR.310 The system has the ability to provide standard data and reports to meet established State and Federal reporting requirements. CRITICAL Yes HR.311 The system has the ability to generate a list of all employees charged to departments other than their home department. DESIRED Yes Human Resources – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments HR.312 The system has the ability to query and generate reports on all information that is tracked and maintained. CRITICAL Yes HR.313 The system has the ability to query and export reports on all information that is tracked and maintained in the system. CRITICAL Yes HR.314 The system has the ability to generate a labor utilization report that shows filled and unfilled positions with user-defined dates and position salary information. DESIRED Possible REQUEST FOR PROPOSALS ERP SYSTEM PAGE 24 OF 35 CITY OF CORCORAN RFP Section E: Attachments E.1 Attachment 1 (RFP Submittal Checklist) Submittal Checklist Section Item Submitted B.1 Executive Summary and Introductory Materials yes E.1 Attachment 1 (RFP Submittal Checklist) yes E.2 Attachment 2 (Signature Page) yes E.3 Attachment 3 (Proposer Statement) yes B.2 Scope of Services E.4 Attachment 4 (Scope of Proposal) Yes + attachment E.5 Attachment 5 (Company Background) Yes E.6 Attachment 6 (Reference Form) yes B.3 Functional Requirements E.13 Attachment 13 (Functional Requirements) yes E.7 Attachment 7 (Technical Specifications) yes B.4 Implementation Plan E.11 Attachment 11 (Conversions) read E.12 Attachment 12 (Staffing) B.5 Ongoing Support and Hosting Services E.8 Attachment 8 (Software-as-a-Services / Hosting) Yes E.9 Attachment 9 (Proposed Service Level Agreement) Yes E.10 Attachment 10 (Maintenance and Support) Yes B.6 Exceptions to the RFP yes B.7 Deliverables and Project Outcomes yes B.8 Sample Documents B.9 Price Proposal (under separate cover) Yes E.14 Attachment 14 (Cost) Yes REQUEST FOR PROPOSALS ERP SYSTEM PAGE 25 OF 35 CITY OF CORCORAN RFP E.2 Attachment 2 (Signature Page) The undersigned proposer having examined this RFP and having full knowledge of the condition under which the work described herein must be performed, hereby proposes that the proposer will fulfill the obligations contained herein in accordance with all instructions, terms, conditions, and specifications set forth; and that the proposer will furnish all required products/services and pay all incidental costs in strict conformity with these documents, for the stated prices as proposed. Submitting Firm: BerganKDV Address:3800 American Blvd West Government: Government Market State: Minnesota Zip: 55431 Authorized Representative (print):_Michael Duscher Title: Government Market Consulting Leader Authorized Signature: Date: 2 -28 -21 Contact Information: Name: Michael Duscher Title: Market Consulting Leader Address: 3800 American Blvd. West, Bloomington Government: Government Market State:Minnesota Zip:55431 Email: mike.duscher@berganKDV.com Phone: 612 -803-4442 Cell Phone: 612-803-4442 Fax: N/A Software Demonstrations / Implementation Interviews: Software demonstrations are currently scheduled for the following dates. Please indicate your availability and date preference to provide software demonstrations in the event your proposal is elevated to software demonstrations. Elevated proposers will be notified of the scheduled demonstrate date when elevated. Week Availability (Y/N) Preference (1,2,3,No Preference) 3/8/2021 3/10/2021 Y 3 3/11 -12 and 3/15/2021 Y 2 3/17/2021 3/19/2021 Y 1 REQUEST FOR PROPOSALS ERP SYSTEM PAGE 26 OF 35 CITY OF CORCORAN RFP E.3 Attachment 3 (Proposer Statement) By submitting a response, the respondent acknowledges that he/she has acquainted themselves with the terms, scope, and requirements of the project based on the information contained in this RFP and any addendums. Any failure by the proposer to acquaint themselves with available information will not relieve them from the responsibility for estimating properly the difficulty or cost of successfully performing the work available. The Government is not responsible for any conclusions or interpretations made by the proposer on the basis of the information made available by the Government. The following addendums have been acknowledged and are included in our response. Proposals that do not acknowledge addendums may be rejected. Addendum# Initials n/a MD Michael Duscher PRINTED NAME OF AUTHORIZED AGENT (TITLE) 2-28 -21 SIGNATURE OF AUTHORIZED AGENT DATE REQUEST FOR PROPOSALS ERP SYSTEM PAGE 27 OF 35 CITY OF CORCORAN RFP E.4 Attachment 4 (Scope of Proposal) Identify the scope of the proposal and if the proposal contains software and services for each scope option. Scope options are defined in the RFP in section A and Section C. Software and Implementation Services: X Proposed Not Proposed Primary Software Firm Kronos Software Product Proposed KPAY/Workforce Ready _ Version N/A Primary Implementation Firm BerganKDV Technology Services: Hosting Services Proposed XSoftware as a Service Proposed Not Proposed Hosting Provider: Ongoing Support X Ongoing Support Provided by Software Vendor Ongoing Support Provided by Implementation Firm Ongoing Support Provided by Third Party Firm Primarily Responsible for Ongoing Support: Third Party Products/Services xThird Party Products/Services Proposed No Third Party Products/Services Proposed Firm Kronos Purpose Software Firm Purpose Firm Purpose Firm Purpose Firm Purpose Firm Purpose Name of Individual / Firm Submitting Proposal: Michael Duscher Signature of Proposer: REQUEST FOR PROPOSALS ERP SYSTEM PAGE 28 OF 35 CITY OF CORCORAN RFP E.4 Attachment 4 – Scope of Proposal Schedule A Client City of Corcoran Agreement Number Full Suite for the City of Corcoran_001 Start Date TBD Terms Description of Services BerganKDV will provide the following (collectively, the "Services") Deliverables Implementation Services: Payroll • Build your company shell • Setup the payroll tax payment system • Setup direct deposit (if applicable) • Setup company earnings and deductions • Setup online reports module and report writer access • Import of Employee demographic information • 2020 YTD entry by quarter and reconciliation of payroll history Timeclock • Setup policies as outlined in the implementation survey • Setup vacation accrual policies and enter balances HCM Core • Setup policies as outlined in the implementation survey • Setup benefits package • Standard HR training track • Applicant Tracking & Recruitment Special Notes: *Following the implementation kick off meeting, a timeline with key tasks will be agreed upon between the client and BerganKDV. During implementation there are a variety of items that the client needs to provide BerganKDV. Submitting this information to us by the deadlines established in the implementation timeline is critical to the timeliness of your implementation. Please note that BerganKDV will begin billing you for Outsourced Payroll Services on the agreed upon "go live" date in the timeline. *Meetings cancelled by the client without 24 hours' notice during the implementation will be charged at standard hourly rates. Software Training Services: • 1 – General navigation training • 1 – Time & labor training • 1 – Reports training • 1 – Payroll training • 1 – Standard HR Training Track • Applicant Tracking & Recruiting Training REQUEST FOR PROPOSALS ERP SYSTEM PAGE 29 OF 35 CITY OF CORCORAN RFP E.5 Attachment 5 (Company Background) Complete one form for each firm included in the proposal. Company Background Company Name: BerganKDV Location of corporate headquarters: Bloomington, MN Proposer Experience # of years in business: 72 years # of years providing systems/services to public sector: 35 Customer Base: # of clients using proposed software/services 800 # of clients using other similar software/services 400 Market Focus: Identify other industries serviced (other than local governments) Schools. Private companies, NFP, all areas of business If not Primary Proposer # of past projects partnering with primary proposer 800 Official Partnership status/certification (if applicable) Kronos Gold Level Partner About the Company Number of Total Employees: 450 Number of Employees Providing Implementation Services (if applicable) 40 Number of Employees Supporting Product (Maintenance and Support) (if applicable) 70 Number of Employees Dedicated to Product Development (if applicable) Kronos has 300 developers on staff REQUEST FOR PROPOSALS ERP SYSTEM PAGE 210 OF 35 CITY OF CORCORAN E.6 Attachment 6 (Reference Form) Please provide at least five (5) references for past projects that include products and services similar to those proposed for this RFP. Please use the following format in submitting references. GENERAL BACKGROUND Name of Client: Circle of Life Project Manager/Contact: Himmat Singh Title: CEO Phone: 612-871-2474 E-mail: himmat@colhca.net Software Program/Version: Kronos Summary of Project: Payroll Number of Employees: 1200 Size of Operating Budget: $100/m PROJECT SCOPE Please indicate (by checking box) functionality installed: Financials Budgeting HR X Payroll TECHNOLOGY INFORMATION Hosted? Yes No x If yes, hosting provider IMPLEMENTATION INFORMATION Project Duration: 12-16 weeks Initial Go-Live: TBD Describe Role on Project: Consulting Project Challenges: None forseeable Major Accomplishments: Leader in implementing Kronos solution nationwide REQUEST FOR PROPOSALS ERP SYSTEM PAGE 30 OF 35 CITY OF CORCORAN RFP E.7 Attachment 7 (Technical Specifications) Technical Specifications Required Licenses Does the Proposed System Require that the Government install software? Yes/No Provide full documentation of technical specifications and requirements necessary to host the system (vendors can submit documentation in alternate format and attach to this page.) N/A – No technical requirements needed. Hardware / Server / Database Requirements N/A - Cloud Desktop / Client Requirements N/A works with all browsers Mobile Requirements Apple Android type Business Intelligence Describe how business intelligence tools operate and if the Government would be able to leverage tools for non-ERP data Open to discussion Does the report writer utilize a separate database? No, same database. Security Describe database security DOD level security Describe application security DOD level Security Is system compatible with single sign on? Yes, single database solution REQUEST FOR PROPOSALS ERP SYSTEM PAGE 31 OF 35 CITY OF CORCORAN RFP E.8 Attachment 8 (Software-as-a-Services / Hosting) *Attach additional pages if necessary Alternative Delivery Options Options Is system available through a hosted model (Government owns license and system implemented on dedicated single tenant environment) No – cloud solution Is the system available through SaaS model (Government pays subscription fee and system implemented in multi -tenant environment) Yes Is the system available through a managed services model (Government owns and hosts system; vendor maintains system) No Where is the data center and disaster recovery data center located? New Jersey, with all redundancies in place Network Bandwidth If ASP or SaaS, what are the internet bandwidth requirements for optimal performance? N/A works with almost all bandwidths Contract Describe any minimum contract periods (example: Minimum of 5 year) No minimum Does vendor contract provide for price increases above 0% per year for years 2-5 No. We do not have yearly price increases After contract period, is it possible to transition to self-hosted model? Describe what is required for transition and cost Not at this time, but Kronos is working on this. Does vendor contract cap price increase to less than 5% for years 6-10) No price increase is planned Proposed Services Number of database instances (please list) N/A Describe proposed disaster recovery services Upon request Describe proposed application availability service level 99.7% up time Support Describe operations support Dedicated service structure and support Describe back up procedures and testing of backups and other quality assurance processes to ensure the backup is working correctly. Upon Request, Kronos has all the backups at multiple data centers and backups. Describe process for installing patches and updates Remote off-time quarterly updates Describe process for roll-back of patches and updates if major functionality is broken as a result of the patch and/or update Upon Request REQUEST FOR PROPOSALS ERP SYSTEM PAGE 32 OF 35 CITY OF CORCORAN RFP E.9 Attachment 9 (Proposed Service Level Agreement) If hosting services are proposed, please complete the following table identifying proposed service level guarantees. For each service, please indicate the metric used to measure the service quality, the proposed requirement (target for service), and the proposed remedy/penalty if guarantee is not met. Proposed Service Level Guarantees Service Metric Requirement/ Guarantee Remedy if Not Met System Availability (Unscheduled Downtime) N/A System Response (Performance) Issue Response Time Issue Resolution Time System Data Restore Implementation of System Patches Notification of Security Breach Please list other proposed service levels Proposed Service Level Guarantees How is performance against service levels reported to the Government N/A Describe process for Government reporting issue to the vendor N/A REQUEST FOR PROPOSALS ERP SYSTEM PAGE 33 OF 35 CITY OF CORCORAN RFP E.10 Attachment 10 (Maintenance and Support) Proposed Maintenance and Support Post-implementation Support: Days of on-site support after go-live 0 What is purpose of on-site support? N/A Other on-site support after go-live (month end, quarter end, year-end, open enrollment, etc.) N/A Telephone Support: Hours available (and time zone) 7:00 CST – 5:00 CST Problem reporting and resolution procedures Ticket system Response time for various levels of severity Client sets call back time Third Parties: Support provided for third party products? Yes Upgrades/Patches: Upgrade Frequency (major and minor releases) N/A How are upgrades delivered? Off hours quarterly Are upgrades required? No How many versions are currently supported? Only One version Third Party Support Upgrade Frequency (major and minor releases) N/A How are upgrades delivered? N/A Are upgrades required? No How many versions are currently supported? N/A Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments General Requirements PR.1 The system has the ability to generate one and only one payroll record per employee. CRITICAL Yes PR.2 The system has the ability to accommodate user- defined tables of acceptable ranges for time entry according to work groups. CRITICAL Yes PR.3 The system has the ability to accommodate an infinite number of employees, departments, jobs, shifts, pay rules, and other user-defined variables. CRITICAL Yes PR.4 The system has the ability to update pay rules and set effective date as desired (including retroactive, immediate/real-time, next payroll, any other future date). CRITICAL Yes PR.5 The system has the ability to accommodate multiple pay periods, including (but not limited to): weekly; bi-weekly; semi-monthly; and monthly. CRITICAL Yes PR.6 The system has the ability to accommodate user- defined overtime rules, including start/stop times, scheduled hours, type of duty performed. CRITICAL Yes PR.7 The system has the ability to accommodate user- defined rules for shift differentials. CRITICAL Yes PR.8 The system has the ability to accommodate user- defined rules for premium pay (overtime and "time and a half") calculations, using variables such as scheduled hours, scheduled vs actual hours. CRITICAL Yes PR.9 The system has the ability to accommodate user- defined rules comp time for non-exempt employees. CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.10 The system has the ability to accommodate user- defined rules for comp time for exempt employees. DESIRED Possible PR.11 The system has the ability to calculate the remaining annualized payroll costs by month including accruals. DESIRED Yes PR.12 The system has the ability to track employee assignments to grants/projects/programs, including the percentage of time spent on those activities. DESIRED Yes PR.13 The system has the ability to mask at the field level in the payroll module based on security permissions. DESIRED Yes PR.14 The system has the ability to integrate the payroll and HR modules with the budget module. DESIRED Yes Time Entry and Approval The system has the ability to support a variety of data collection methods and devices, including (but not limited to): PR.15 Terminal/PC entry; CRITICAL Yes PR.16 Time clocks; DESIRED Yes PR.17 Swipe card readers; DESIRED Yes PR.18 Bar coding; and DESIRED Yes PR.19 Smartphones and mobile devices. CRITICAL Yes PR.20 The system has the ability to support the concurrent use of different types of devices for data collections. DESIRED Yes PR.21 The system has the ability to print weekly timesheets for user-selected employees as necessary. DESIRED Yes The system has the ability to track and adjust time in the following manner: PR.22 Earned; DESIRED Yes PR.23 Used; DESIRED Yes PR.24 Paid; DESIRED Yes PR.25 Training; DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.26 Vacation; CRITICAL Yes PR.27 Holiday; CRITICAL Yes PR.28 Unpaid leave; CRITICAL Yes PR.29 Administrative leave; CRITICAL Yes PR.30 Adjusted; CRITICAL Ys PR.31 Lost (e.g. vacation not rolled over); CRITICAL Yes PR.32 Sick bank; CRITICAL Yes PR.33 Sick leave; CRITICAL Ys PR.34 Funeral/bereavement leave; CRITICAL Yes PR.35 FLSA hours; CRITICAL Yes PR.36 FMLA hours (available and used); and CRITICAL Yes PR.37 POIC (Police Officer in Change); DESIRED Yes PR.38 Comp time; CRITICAL Yes PR.39 Workers' Compensation; CRITICAL Yes PR.40 Coupons (wellness, unscheduled City-wide days off); DESIRED possible PR.41 Personal leave; CRITICAL Yes PR.42 Voluntary doc days; DESIRED Yes PR.43 Civil leave (jury duty, witness duty); CRITICAL Yes PR.44 Military pay; CRITICAL Yes PR.45 Short term disability CRITICAL Yes PR.46 Long term disability CRITICAL Yes PR.47 Other user defined. DESIRED Yes The system has the ability to support the following types of time entry: PR.48 Employee self-entry; CRITICAL Yes PR.49 Batch entry by data entry personnel CRITICAL Yes PR.50 Third party time entry system; and CRITICAL Yes PR.51 Assignment and reassignment of employee time entry by a different supervisor. CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.52 The system has the ability to accommodate remote site online timesheet data entry with online account validation. CRITICAL Yes PR.53 The system has the ability to allow a user defined comments field in the timesheet. CRITICAL yes PR.54 The system has the ability to restrict time entry to pre-establishment ranges, with authorized override capabilities. CRITICAL Yes PR.55 The system has the ability to allow employees to record time for at least 10 different jobs per shift. CRITICAL Yes PR.56 The system has the ability to process and approve time sheets and time reports in a decentralized and electronic format. CRITICAL Yes PR.57 The system has the ability to provide administrative rights to managers (e.g. allow managers to enter employee sick time). CRITICAL Yes PR.58 The system has the ability to require online approval of time by managers. CRITICAL Yes PR.59 The system has the ability to display employee's timesheet totals to enable timekeeper administration (e.g. supervisor) to validate, confirm and approve data. CRITICAL Yes PR.60 The system has the ability to route (through workflow) timecards to multiple manages (including Accounting Department) for review, edit and approval (i.e. in instances where employee has worked for multiple managers). CRITICAL Yes PR.61 The system has the ability to notify employees and/or a supervisor of rejected timecard (via workflow). CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.62 The system has the ability to designate a back-up timecard and leave requests approval (e.g. when a typical approving manager is not available). CRITICAL Yes PR.63 The system has the ability to require electronic signatures for time approval. DESIRED possible PR.64 The system has the ability to allow overtime approval to occur prior to or after the work has been performed. DESIRED Yes PR.65 The system has the ability to reverse overtime with user-defined authorization. CRITICAL Yes PR.66 The system has the ability to hold data entered on-line in a suspense of pending file until approved electronically and released for processing. DESIRED Yes PR.67 The system has the ability to allow managers to edit employee timecards (with appropriate authorization). CRITICAL Yes PR.68 The system has the ability to allow managers to perform mass edits on employee timecards (with appropriate authorization). DESIRED Yes PR.69 The system has the ability to adjust time entries in prior periods, with an audit trail of change (user, date change). DESIRED Yes PR.70 The system has the ability to require an employee to acknowledge changes made to their timecard (submitted by anyone other than the employee). DESIRED Yes PR.71 The system has the ability to allow overtime approval to occur prior to or after the work has been performed. DESIRED Yes The system has the ability to store time and attendance history data, including (but not limited to): PR.72 Employee name; CRITICAL Yes PR.73 Employee ID number; CRITICAL yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.74 Dates; CRITICAL Yes PR.75 Time leave (e.g. overtime); CRITICAL Yes PR.76 Manager approval history CRITICAL Yes PR.77 The system has the ability to store time and attendance history for at a minimum of six years. CRITICAL Yes PR.78 The system has the ability to store time and attendance history for at a minimum of ten years. DESIRED Yes PR.79 The system has the ability to accommodate for Fair Labor Standards Act (FLSA) laws based on the City's current pay codes. CRITICAL Yes PR.80 The system has the ability to adhere to all current and future local, State and Federal laws. CRITICAL Yes Leave Time Accrual and Use PR.81 The system has the ability to provide query capabilities for leave and accrual balances. CRITICAL Yes The system has the ability to capture and track leave for multiple leave types, including (but not limited to): PR.82 Earned; DESIRED Yes PR.83 Used; DESIRED Yes PR.84 Paid; DESIRED Yes PR.85 Training; DESIRED Yes PR.86 Vacation; CRITICAL Yes PR.87 Holiday; CRITICAL Yes PR.88 Unpaid leave; CRITICAL Yes PR.89 Administrative leave; CRITICAL Yes PR.90 Adjusted; CRITICAL Yes PR.91 Lost; CRITICAL Yes PR.92 Sick bank; CRITICAL yes PR.93 Sick leave; CRITICAL Yes PR.94 Funeral/bereavement leave; CRITICAL Yes PR.95 FLSA hours; CRITICAL yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.96 FMLA hours CRITICAL Yes PR.97 POIC (Police Officer in Charge); DESIRED Yes PR.98 Comp time; CRITICAL Yes PR.99 Workers' Compensation CRITICAL Yes PR.100 Coupons (wellness, unscheduled City-wide days off); DESIRED possible PR.101 Personal days; CRITICAL Yes PR.102 Voluntary doc days; DESIRED Yes PR.103 Civil leave (jury duty, witness duty); CRITICAL Yes PR.104 Military pay; DESIRED Yes PR.105 Short term disability; CRITICAL Yes PR.106 Long term disability; CRITICAL yes PR.107 Other user-defined/ DESIRED Yes PR.108 The system has the ability to capture and maintain breaks in service. DESIRED Yes PR.109 The system has the ability to provide comp time calculation functionality. CRITICAL Yes PR.110 The system has the ability to accrue sick leave time every pay period for all qualified employees (on a work Status). DESIRED Yes PR.111 The system has the ability to provide separate user- defined accrual processes by leave type (such as vacation, comp, sick and personal time). CRITICAL Yes PR.112 The system has the ability to set and maintain leave and vacation accrual schedules by job class (or other user-defined classification). CRITICAL Yes PR.113 The system has the ability to accrue sick and vacation at the end of a user specified period (e.g. day, week, pay period, or month). CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.114 The system has the ability to accommodate partial eave accrual on a temporary and/or permanent basis (e.g. during FMLA leave). DESIRED Yes PR.115 The system has the ability to accommodate cumulative (rollover) and non-cumulative (used-it- to-lose-it) Leave accruals. CRITICAL Yes PR.116 The system has the ability to set a maximum for cumulative (rollover) leave accruals. CRITICAL Yes PR.117 The system has the ability to maintain leave accrual schedules, containing leave type and accrual rates. CRITICAL Yes PR.118 The system has the ability to temporarily suspend leave accrual (e.g. during unpaid leave). CRITICAL Yes PR.119 The system has the ability to calculate liability for unused earned leave by individual employee at regular intervals and on demand. CRITICAL Yes PR.120 The system has the ability to calculate liability for unused earned leave by groups of employees at regular intervals on demand. CRITICAL Yes PR.121 The system has the ability to calculate liability for unused earned leave in accordance with city payout rules (i.e.50% is paid years of service). DESIRED Yes PR.122 The system has the ability to track and calculate the value of lost earned time at regular intervals and on demand. DESIRED Yes PR.123 The system has the ability to alert managers on leave usage exceptions. DESIRED Ys The system has the ability to perform electronic approval process to approve overtime and leave time, including (but not limited to): PR.124 Request submittal; DESIRED Yes PR.125 Manager(s) review/decisioning; DESIRED Yes PR.126 Request status monitoring; DESIRED Yes PR.127 Notification of request approval/decline; and DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.128 Other user defined. DESIRED Yes PR.129 The system has the ability to provide drill down capability to see attachments to records based on security permissions. CRITICAL Yes PR.130 The system has the ability to notify user of attempt to submit leave request where accrued time is less than requested time. CRITICAL Yes PR.131 The system has the ability to submit sick and vacation leave request prior to accrual with appropriate workflow. DESIRED Yes PR.132 The system has the ability to provide employees online access to leave request status (e.g. pending, under review, etc.). CRITICAL Yes PR.133 The system has the ability to automatically track FMLA leave based on Federal requirements. CRITICAL Yes PR.134 The system has the ability to restrict or allow sick and vacation leave to be used only after it is earned. CRITICAL Yes PR.135 The system has the ability to send an alert/notification to employee and supervisor when accrual maximum/minimum for leave time(s) is approaching. DESIRED Yes PR.136 The system has the ability to deduct military, vacation and/or personal leave time if not used by City defined year end, with option to override with appropriate security. CRITICAL Yes Check Processing The system has the ability to print the following information on pay stubs: PR.137 Benefit tracking; DESIRED Yes PR.138 Leave tracking; CRITICAL Yes PR.139 YTD payroll; CRITICAL yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.140 YTD benefits; DESIRED Yes PR.141 YTD leave; CRITICAL Yes PR.142 Itemized deductions (e.g. garnishments, union dues, flower fund, Community Foundation deductions, etc.) CRITICAL Yes PR.143 Other user-defined fields. DESIRED Yes The system has the ability to print multiple messages on pay stubs, specific to any combination of the following: PR.144 City-wide; DESIRED possible PR.145 Department; DESIRED possible PR.146 Division; DESIRED possible PR.147 Job classification; DESIRED possible PR.148 Employee; DESIRED possible PR.149 Benefits status; DESIRED possible PR.150 Health plan; DESIRED possible PR.151 Any deduction category; DESIRED possible PR.152 Other user-defined categories. DESIRED yes PR.153 The system has the ability to provide a user-defined payroll direct deposit pay stubs. DESIRED Yes PR.154 The system has the ability to provide a user-defined payroll check stub format. CRITICAL Yes PR.155 The system has the ability to print excess pay and deductions on a supplemental report (overflow report) that does not utilize check or voucher stock (e.g. when all pay and deductions will not print on the check stub. CRITICAL Yes PR.156 The system has the ability to send electronic payroll stubs to employees through email. CRITICAL Yes PR.157 The system has the ability to allow employees to view their pay stubs or direct deposit remittance slips on-line, through employee self-service, including current and past pay periods. CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.158 The system has the ability to issue one paycheck/pay stub for employees holding multiple jobs with the City. DESIRED Yes PR.159 The system has the ability to automatically produce direct deposit tapes/files for banks. CRITICAL Yes PR.160 The system has the ability to transmit direct deposit funds to more than one account within the same banking institution (e.g. savings, checking and loan accounts). CRITICAL Yes PR.161 The system has the ability to accommodate direct deposit to multiple banking institutions at minimum of four. DESIRED Yes PR.162 The system has the ability to accommodate deposit of paychecks through electronic fund transfer (EFT). CRITICAL Yes PR.163 The system has the ability to reimburse employees for travel and other expenses. DESIRED Yes PR.164 The system has the ability to prevent negative or zero-dollar amount checks from being created. CRITICAL Yes PR.165 The system has the ability to accommodate review and approval of payroll prior to production run (e.g. first by department heads, second by the HR and Payroll departments). CRITICAL Yes PR.166 The system has the ability to generate a hardcopy payroll pre-list prior to final payroll production run. DESIRED yes PR.167 The system has the ability to do "what-if" scenarios of payroll runs, prior to running the actual payroll. CRITICAL Yes PR.168 The system has the ability to produce non-standard payrolls with an automatic update of all employee and employer accumulators. CRITICAL Yes PR.169 The system has the ability to issue manual checks outside of the regular payroll schedule. CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments The system has the ability to provide a payroll proof list of all payroll calculations, gross-to-net, before checks are produced, including (but not limited to): PR.170 Hours by type; CRITICAL Yes PR.171 Earnings by type; CRITICAL Yes PR.172 Employee tax liabilities; CRITICAL Yes PR.173 Employee deduction amount; CRITICAL Yes PR.174 Employee contribution amount; CRITICAL Yes PR.175 Deductions not taken and set-up in arrears; DESIRED Yes PR.176 Employer portion of taxes; CRITICAL Yes PR.177 Totals by employee, grant, project, cost center, division, department, location, total City; and DESIRED Yes PR.178 User-specified ranges. DESIRED Yes PR.179 The system has the ability to run audit report to reflect that payroll has captured benefit deductions. DESIRED Yes PR.180 The system has the ability to run audit report to reflect discrepancies between benefits and payroll information. DESIRED Yes PR.181 The system has the ability to provide for adjustments to final paycheck. CRITICAL Yes PR.182 The system has the ability to issue payment corrections. CRITICAL Yes PR.183 The system has the ability to perform overpayment adjustments CRITICAL Yes PR.184 The system has the ability to calculate retroactive amounts due on all forms of pay for individual employees for up to 24 months or user defined period of time. DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.185 The system has the ability to apply different separation pay-out rules depending on factors including (but not limited to); contract date; leave balance as of a certain date; other user-defined factors. CRITICAL Yes PR.186 The system has the ability to pay out or convert vacation/sick leave if user-defined number of days have accumulated at specified time of the year. DESIRED Yes PR.187 The system has the ability to accommodate pay rate steps for pay grades (at least at the hourly, bi- monthly, and annual levels). CRITICAL Yes PR.188 The system has the ability to automatically allocate employee benefit costs across multiple funds based on user-defined criteria. DESIRED Yes PR.189 The system has the ability to charge overtime to several different overtime accounts. DESIRED Yes The system has the ability to provide reconciliation functionality, including (but not limited to): PR.190 Changes to employee pay, deductions and taxes; DESIRED possible PR.191 Changes to employer deductions and taxes; DESIRED possible PR.192 Gross pay changes; DESIRED possible PR.193 Number of paychecks/direct deposits per pay cycle; DESIRED possible PR.194 Supplemental pays; DESIRED possible PR.195 Federal and State government reporting for each employee; and CRITICAL possible PR.196 Other user-defined reconciliation. DESIRED possible PR.197 The system has the ability to print/reprint W-2s on a laser printer. CRITICAL yes PR.198 The system has the ability to process the first of the year payroll with the year end W-2 simultaneously in production. CRITICAL yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.199 The system has the ability to accommodate unlimited number of user-defined pay rates. CRITICAL yes PR.200 The system has the ability to automatically pass cost detail to the Budget system. CRITICAL Yes PR.201 The system has the ability to natively integrate with General Ledger and does not require a separate chart of accounts. CRITICAL Yes General Reporting PR.202 The system has the ability to produce and modify Form 941s in electronic format. CRITICAL Yes PR.203 The system has the ability to produce ad hoc reports. CRITICAL Yes PR.204 The system has the ability to generate a labor utilization report that shows filed and unfiled positions with user-defined dates and position salary information. DESIRED Yes PR.205 The system has the ability to accommodate proper reporting of all taxed and non-taxed employee income. DESIRED Yes PR.206 The system has the ability to generate the monthly and quarterly state taxes reports (e.g. 501N, W-3N, 941N) with ability to submit electronically. CRITICAL Yes PR.207 The system has the ability to produce all quarterly federal reports (e.g. W-2). CRITICAL Yes PR.208 The system has the ability to produce 941. W-2, Unemployment, Census Bureau and other Federal and State required reports. CRITICAL Yes PR.209 The system has the ability to produce all W-2 information for employees and reporting agencies (e.g. IRS, state, etc). CRITICAL Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.210 The system has the ability to support electronic submission of reports for certain grants and/or federal requirements (e.g. 1099, W-2, time and effort reporting, etc.) DESIRED Yes PR.211 The system has the ability to track and generate reports on employees paid through Accounts Payable and Payroll (reconciliation of the two modules for "checks and balances"). DESIRED Yes The system has the ability to generate reconciliation reporting including (but not limited to) the following: PR.212 Biweekly payroll balancing – exception reporting by Department and City wide; CRITICAL Yes PR.213 Biweekly payroll reconciliation to the General Ledger – exception reporting; CRITICAL Yes PR.214 Monthly payroll liability accounts reconciliation – exception reporting; DESIRED yes PR.215 Ad hoc reconciliation reporting at the department level. DESIRED Yes The system has the ability to generate Payroll reporting, including (but not limited to) the following: PR.216 Payroll balancing, including wages, taxes, withholdings; DESIRED Yes PR.217 Tax reporting for remitting payroll tax deposits; DESIRED Yes PR.218 Employee Labor Distribution Report (by department at the employee level); CRITICAL Yes PR.219 Audit reporting showing journal voucher that passes to the General Ledger; CRITICAL Yes PR.220 Direct deposit report to reconcile ACH and identify potential errors; and CRITICAL Yes PR.221 Emergency time reporting (e.g. FEMA complaint time reporting). DESIRED Yes Payroll – General Requirements City of Corcoran – Critically = Critical, Desired, N/A BERGANKDV, LTD. | BERGANKDV.COM | DO MORE Req. # Description of Requirement Criticality Response from Vendors Comments PR.222 The system has the ability to provide online screens and reports related to earnings including quarter- to-date, year-to-date (calendar and fiscal), and user-defined period (weekly, bi-weekly, monthly, semi-monthly). CRITICAL Yes PR.223 The system has the ability to query and generate reports for one-time deductions. DESIRED yes PR.224 The system has the ability to query and generate reports that delineate regular and overtime hours worked per pay period for user-defined period of time. CRITICAL Yes PR.225 The system has the ability to query and generate reports that delineate regular and overtime hours worked per pay period, for a user-defined period of time, on an individual employee basis. CRITICAL yes City of Corcoran RFP for ERP Attachment 14 E.14 Pricing Summary – Details. All Costs – Required Modules. Required Module Notes Comments Core Financials • 3 currently will want additional users for growth • Remote access required N/A Human Resources • 30 FTE • 15 temp/seasonal • 36 W-2’s See Detail – KPay budget estimate Payroll • 26 Pay periods • 30 FTE • 15 temp/seasonal See Detail – KPay budget estimate Time keeping/HR • 45 named users See Detail – KPay budget estimate Cash receipting • 2 named users • 2 collection points N/A Utility Billing • 600 named accounts • 12 billing cycles N/A Project/Grant Accounting • 6 named projects • 4 named grants • 2 named users N/A Fixed Assets • 212 named assets • $27,537,618 total amount of assets N/A Implementation: Total cost for implementation, data conversion, training, report development, integration, travel, etc. for required modules. Payroll = $900.00 Time Keeping = $900 HR = $3,500 Maintenance: Total cost years 1-10 Other Costs Time clock hardware purchase vs rental Other services for time clock Buy= $2,950 + 295/yr support Rent= $60/payroll See Detail – Kpay budget estimate Total First Year Cost – required modules $17,446 Total Ten-Year Cost – required modules $126,760 STAFF REPORT Agenda Item 9b. Council Meeting: June 10, 2021 Prepared By: Kevin Mattson Topic: Water Supply Work Plan – Supplemental Information Action Required: Approval Summary: On March 25th, 2021, the Council authorized staff to complete a supplemental analysis of several items related to water supply planning in Northeast Corcoran. • Treatment options • Storage alternatives • Wells The attached document details the requested information for council’s review and consideration. The engineering team will present the outcomes and discuss how treatment options, service area demand projections, market volatility, and architectural selections can impact the overall cost of the project. As a next step, staff advises completion of a financial comparison analysis to better understand the risk tolerance thresholds involved with such a significant project. Financial/Budget: Costs for the financial analysis could be supported from the water fund. The adopted 2021 Water Fund budget included $125,000 for water supply planning. Options: 1. Direct staff to complete a financial analysis of the NE Water Supply System options as outlined in the supplemental report. 2. Decline. Recommendation: Staff recommends directing staff to complete a financial analysis of the NE Water Supply System options as outlined in the supplemental report. Council Action: Consider a motion to direct staff to complete a financial analysis of the NE Water Supply System options as outlined in the supplemental report. Attachments: 1. Feasibility Report Supplements – NE Water Supply System Feasibility Report Supplements 2020 Northeast Water System June 4, 2021 Prepared for: City of Corcoran FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM Table of Contents 1.0 TREATMENT .................................................................................................................1.1 1.1 SOFTENING...................................................................................................................1.1 1.1.1 Lime Softening..............................................................................................1.1 1.1.2 Membrane Softening.....................................................................................1.2 1.1.3 Cost Comparison ..........................................................................................1.3 1.1.4 Summary.......................................................................................................1.5 2.0 STORAGE......................................................................................................................2.1 2.1 GROUND STORAGE TANKS........................................................................................2.1 2.1.1 Cost Summary ..............................................................................................2.1 2.1.2 Cost Comparison ..........................................................................................2.2 2.1.4 Summary.......................................................................................................2.3 3.0 MUNICIPAL WELL PLANNING CONSIDERATIONS...................................................3.1 3.1.1 Well Planning................................................................................................3.1 3.1.2 Total Well Capacity VS. Demand..................................................................3.2 3.1.3 Raw Watermain.............................................................................................3.2 4.0 FINANCIAL PLANNING.................................................................................................4.1 5.0 RECOMMENDATION.....................................................................................................5.1 LIST OF TABLES Table 1: Lime Softening Cost Summary.....................................................................................1.4 Table 2: Membrane Softening Cost Summary ...........................................................................1.4 Table 3: Treatment System Cost Summary ...............................................................................1.5 Table 4: Ground Storage Tank Cost Summary..........................................................................2.2 Table 5: Storage Cost Comparison............................................................................................2.2 Table 6: Total Project Cost Comparison for Financial Planning.................................................4.2 LIST OF FIGURES Figure 1 Geologic Map with Planned and Potential Municipal Well Locations FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM TREATMENT 1.1 1.0 TREATMENT 1.1 SOFTENING The primary purpose of softening drinking water in Minnesota is to remove hardness caused by calcium and magnesium in the groundwater supply. Depending on the specific softening process being utilized and the characteristics of the water the treatment process will remove varying levels of other unwanted elements from groundwater including minerals, organics, and contaminants. There are three mainstream approaches to softening employed across the municipal treatment industry including: 1. Lime / Soda Ash 2. Ion exchange 3. Membrane Due to recent improvements in our understanding of chlorides in our environment, water purveyors are paying close attention to the impacts from using salts with chlorides to exchange ions in the treatment process for drinking water. This understanding has caused regulators to be more critical of ion exchange process for softening at the municipal level. Currently, the system receiving residuals from Corcoran’s sanitary sewer is the Metropolitan Council of Environmental Services (MCES). MCES is encouraging communities to reduce the production of chlorides to allow MCES to comply with current and anticipated limits on chlorides. For this reason, the feasibility for softening in Corcoran will focus on the comparison of lime softening to nanofiltration membrane softening. 1.1.1 Lime Softening Lime softening was originally conceived in the 1830s and has been in practice for municipal treatment since the early 1900s. The process of conventional lime softening is a safe, reliable, and effective means for reducing hardness and removing other undesirable elements from drinking water. The process is robust and typically involves a series of treatment steps including rapid mixing, flocculation, sedimentation, primary clarification, recarbonation, secondary clarification, filtration and storage. While the process of lime softening is traditional in the industry and reliable, the facilities housing these unit processes require significant infrastructure and labor to maintain and operate. The following are Pros for Lime Softening: 1. Reliable treatment process that produces highly stable water quality 2. Reduction of wide variety of elements, including iron and manganese removal 3. Achieves partial disinfection byproduct removal FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM TREATMENT 1.2 The following are Cons for Lime Softening: 1. Labor intensive for operations staffing requiring significant staffing 2. Mechanically intense 3. Maintenance intense 4. High chemical consumption 5. Large footprint 6. Sludge production and disposal required 1.1.2 Membrane Softening Membrane softening for groundwater supplies typically utilizes nanofiltration membranes versus other membrane treatment approaches such as reverse osmosis. Reasons for this treatment practice are that nanofiltration is accomplished with lower pressure, produces a more dilute waste stream, and a product water requires less stabilization to minimize corrosion in the distribution system. Nanofiltration also removes less of the monovalent ions, such as chloride, thereby lessening any concentrating of these ions in the waste stream. Membrane softening differs from lime softening in many ways. Membranes represent an approach that has been developing, since the 1960s and involves a more streamlined series of treatment steps that ultimately result in water being pressed through a specially designed sheet of proprietary material consisting of tiny pores sized to restrict or reject unwanted elements and produce an effluent water quality that meets a particular criterion. Membrane processes generate reject water, with nanofiltration at approximately 20%. The following are Pros for nanofiltration softening: 1. Effective removal of hardness, organic matter, disinfection byproducts, radium, and other contaminants 2. Smaller footprint than lime softening 3. According to study by McGivney and Kawamura (2008) a. For lower capacity treatment plants (up to 5 MGD), the cost to produce water using nano filtration is significantly less than lime softening by as much as 1:3. b. For comparison a plant with 10 MGD capacity the cost ratio is approximately same at 1:1 4. Reduced chemical requirements and storage 5. Waste stream is liquid, sludge is not generated 6. Less staff time required to operate and maintain FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM TREATMENT 1.3 The following are Cons for Nanofiltration Softening: 1. Membrane fouling (including organic, colloidal, biofouling, and scale formation) can impact membrane permeability and lifetime performance 2. Twenty percent water loss to reject waste stream 3. Significant membrane replacement cost 4. Chemical cleanings 5. Wastewater volume for the reject/waste stream consumes MCES capacity allotted for growth a. Further discussions with MCES on NE Sewer capacity is required. While the membrane treatment process contains fewer steps and less facility infrastructure, the material cost for the membranes is significant and operational costs and limitations should be investigated. When designing these systems, it is good practice to set up the array of membranes with separate skids such that one skid of membranes can remain online while routine maintenance is performed on others. Examples of routine maintenance include cartridge “change out” and “cleaning in place” operations that are commonplace for membranes. For this reason, the footprint and cost per gallon for nanofiltration (including 25-year capital and OM costs (per study by McGivney and Kawamura) may not be as significant as the 3:1 cost difference identified above. As the treatment capacity increases from 0 to 10 MGD the cost per gallon treated decreases significantly from 3:1 cost of lime soda ash softening vs. nanofiltration down to 1:1 at 10 MGD. For context, the following section includes a comparison of construction costs for lime softening facilities constructed in the state of MN with a treatment capacity of 1.0 MGD or less. 1.1.3 Cost Comparison Due to the raw water quality in Corcoran, filtration to remove iron, manganese, and other constituents would be required prior to membrane softening. Filtration would also be a required step in the lime softening process (near the end). The main cost drivers for the addition of a softening process center around the required footprint and building size, equipment costs, chemical costs, and waste disposal. Lime softening requires the largest footprint to accommodate lime storage, rapid mixing, clarification, recarbonation and other tanks/equipment along with significant expenditures on chemicals and sludge disposal. Table 1 summarizes the capital cost and associated operating expenses received from operators for the lime softening plants in Staples and Granite Falls. Each facility employs three operators with specialized training to run and maintain their facilities, with dedicated hours ranging from 48 to 75 hours per week. The facilities require operator attention on a daily basis and have a significant number of components that require regular maintenance and periodic replacement. Sludge from the softening process requires labor and equipment for proper handling and disposal. In Granite Falls lime sludge is stored on site in lagoons. When the lagoons reach capacity the lime is loaded into trucks using heavy equipment and hauled away (typically for land application). Alternatively, a lime press can be incorporated into the facility to receive and dewater the lime waste pressing it into “cakes” FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM TREATMENT 1.4 prior to being dropped into trucks for removal. Lime lagoons require more labor at a lower capital cost, while lime press equipment requires less labor at a greater capital cost. Table 1: Lime Softening Cost Summary City Staples, MN Granite Falls, MN Design Flow, MGD (gpm)0.75 (500)1.0 (700) Current Operating Flow, MGD (gpm)0.25 (175)0.40 (275) Year Built 2006 2012 Construction Cost $4,500,000 $9,500,000 Annual Chemical Cost $68,000 $81,600 Annual Utilities Not Available $138,000 Annual Sludge Disposal Not Available $30,000 # Staff (Total Hours per Week)3 (48)3 (75) Due to the modular nature of membrane filtration units, the footprint required for the same design flow is significantly less than that for lime softening. As discussed, some chemical is required for membrane maintenance to remove scale and reject water must be disposed of. Additional information regarding disposal options and potential costs associated with the reject water should be further evaluated during design if this option is selected. Table 2 summarizes the capital costs and associated operating expenses for a nanofiltration softening facility. The treatment process is largely automated requiring minimal operator attention in addition to the time required for monitoring of the iron/manganese filtration system provided that routine maintenance is performed on the controls systems. Quarterly or semi-annual membrane cleanings would require additional staff hours. Table 2: Membrane Softening Cost Summary Parameter Nanofiltration Vendor Info Design Flow, MGD (gpm)1.44 (1000) Iron/Manganese Removal Facility Cost $4,000,000 Facility Enlargement, etc. $2,500,000 Filter Skid Cost $900,000 Annual Chemical Cost $30,000 Annual Electrical Usage $130,000 Filter Replacement Cost (Period)$750,000 (15 years) FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM TREATMENT 1.5 1.1.4 Summary With regards to the overall approach to treatment in Corcoran, based on the information we have from Granite Falls, Staples and other literature, the need for an iron/manganese filtration system is a component for Corcoran’s permanent water treatment system. This suggests that the treatment process can be designed to include iron/manganese as Phase 1 for a scenario including either lime-soda ash softening or nanofiltration with provisions for later phases or expansions. Under the scenario for lime softening, the conventional approach is to incorporate the filtration AFTER the lime-soda ash softening equipment i.e. (flocculation, clarification, recarbonation, secondary clarification). For nanofiltration the filtration step would occur PRIOR to nanofiltration equipment to prevent iron-fouling of the membranes. In summary, filtration is an important step with either nanofiltration or lime softening however, by design, the filtration step is incorporated on opposite ends of the treatment train. Cost Summary At the feasibility stage it is useful to compare options in simplified costs. In addition, the post-COVID inflation has affected materials and labor so an adjusted number is shown for use in financial planning. The summary of total costs are as follows: Table 3: Treatment System Cost Summary Treatment System Construction Cost Comments Iron Manganese, Pressure Filtration $2.7 M Original Feasibility Study Cost with no premium architectural features Iron Manganese, Gravity Filtration w/ Clearwell Storage $5 M Provides additional operational flexibility and storage Gravity Filtration + Nanofiltration $9 M Disposal options for filtrate must be investigated, WTP sized 20% larger for filter reject water Lime Softening + Gravity Filtration $11.5 M Becomes cost efficient compared to NF near 10 MGD Phasing / Expansions Effectively there are two approaches for implementation of filtration treatment: 1.Phased Approach: If it is desired to spread capital investment over a longer time period, the iron and manganese treatment would be installed in Phase 1 with flexibility for softening installed at later phases for both pressure filter and gravity filter options. FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM TREATMENT 1.6 2.One-time Approach: If softened water is desired on Day 1, a proposed treatment plant would be designed with softening included with the original construction. An investment into an iron and manganese removal/filtration plant today is useful for either lime softening or nanofiltration in the future as in integral component of a long-range treatment system. Service Area The area being currently developed and undergoing the most development pressure is within the CR 116/CR101/CR30/CR117 area. Informally this can be identified as “The Box”. Water demand for The Box is approximately 1 MGD using conservative demand that are consistent with the Maple Grove modeling/system operation. Typical treatment system sized at 1,000 gpm is 1.4 MGD which would service an area 40% beyond The Box, with conservative values. The MUSA demand for the NE is 2.5 MGD. The storage (tower/ground storage tank) within this study will serve the NE MUSA. FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM STORAGE 2.1 2.0 STORAGE 2.1 GROUND STORAGE TANKS The original feasibility study evaluated two potential sites for a 0.75 MG water tower and summarized the anticipated construction costs. Ground storage tanks (GST) are an alternative storage solution for the City to consider with the following benefits: GSTs are more protected from extreme weather events Long-term savings are realized in the form of reduced maintenance and upkeep associated with painting Cost ranges occur depending on a partially buried tank or fully buried tank There are a wide array of architectural and visual options to customize the aesthetic if not fully buried. Additional flexibility in siting as high ground and site lines are less critical. Relevant drawbacks for GSTs include: GSTs require pumps to provide constant water pressure to the system and high-service pumps are on standby to provide fire flow GSTs rely on backup power to run pumps in the event of a power outage (no water volume available from overhead tower) GSTs are less visible to the public in terms of displaying the City’s name and offering a location for cellular service rental revenue. 2.1.1 Cost Summary The major cost components for a GST include the tank itself, tank piping and connection to the watermains, foundation requirements, earthwork, architectural treatments, and the pump house with backup power generation. The pump house will include high service pumps that provide pressure to the distribution system and fire flow pumps that can be utilized when demand increases significantly. DN tanks is a provider of prestressed concrete GSTs in Minnesota and metro examples of these facilities include Eden Prairie, Eagan, Loretto, and Maple Grove. A cost summary of the major components associated with the construction of a GST is included in Table 3. Fully buried or partially buried tanks affect the capital costs due to different structural needs. Not included in the pricing is site work that would be similar for both GST and water tower options, with the GST being more extensive. Annual maintenance and replacement costs are associated with tank cleaning and occasional maintenance for the pumps. Note that the extent of architectural treatments can vary significantly from very basic to very elaborate. FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM STORAGE 2.2 Table 4: Ground Storage Tank Cost Summary Component Cost Tank (partially buried, tank only)$900,000 Piping & Appurtenances $100,000 Deep Foundation $300,000 Site Improvements / Architectural / Landscaping $350,000* Pump House & Backup Power $1,200,000 TOTAL EST. CONSTRUCTION COST $2,850,000 *Grading exports, groundwater conditions, and site condition complexity can increase costs. A site-specific analysis during preliminary design would refine costs. 2.1.2 Cost Comparison Based on the available cost data, the GST is a competitive option over the long term due to maintenance. Maintenance costs for the GST consist of annual tank inspections and pump replacement estimated at every 15 years. Maintenance costs for the water tower consist of annual inspections and painting every 15 years (well pumps would be replaced at this 15-year time frame also). Table 4 summarizes the capital and maintenance expenses. However, this analysis does not include potential revenue from hosting a cellular antenna on the water tower. Table 5: Storage Cost Comparison Component GST Water Tower Construction Cost $2,850,000 $3,000,000 Inspection Cost (frequency)$7,500 (annual)$7,500 (annual) Pump Replacement (frequency)$150,000 (15-yrs)-- Painting (frequency)N/A $300,000 (15-20 yrs) Annualized Cost $112,500 $127,500 FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM STORAGE 2.3 2.1.4 Summary Ground storage tanks and water towers are both in use in the metro area and have individual benefits and disadvantages. The cost comparisons are approximately equal, with ground storage having less maintenance due to no painting. Several factors can weigh into this discussion at the community level, including: Surrounding visibility for a tower Surrounding land use Operator opinions also support both systems, some operators appreciate the volume of water in a tower for emergencies, while operators with GSTs are supportive of less maintenance. A combined long-term approach could also be considered to harness some of the advantages of both types of storage, i.e., construct Tower No. 1 for the first storage and utilize GSTs thereafter. Another option is to build clearwell (ground) storage within the footprint of the treatment plant, which supplements the overhead (tower) storage. This hybrid approach is cost effective and will be further refined during preliminary design. Cost Summary The cost analysis shows that both systems are reasonably close in capital costs. The ground storage costs have more variables during design such as groundwater levels, buried or half/buried tanks and final setting. Eventually a ground storage tank will be more cost effective, however this payback period may be beyond the financial projections for a community just starting its first system. FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM MUNICIPAL WELL PLANNING CONSIDERATIONS 3.1 3.0 MUNICIPAL WELL PLANNING CONSIDERATIONS The primary water supply focus for this feasibility study is the first municipal well, which is to be installed at the water treatment plant site. However, given the anticipated pace of development in NE Corcoran, it is prudent to conduct preliminary planning for additional municipal wells locations and the raw (untreated) watermain layout that will be needed to deliver raw water from the network of wells to the centralized water treatment plant. The preliminary layout for wells and raw watermain is presented on Figure 1, as discussed throughout this section. 3.1.1 Well Planning For planning purposes, the wells are assumed to all be completed in the Tunnel City-Wonewoc aquifer, the same planned for Municipal Well No. 1. Targeting well locations in the areas where the Jordan aquifer is present (the yellow areas on Figure 1 will ensure that a full thickness of the Tunnel City-Wonewoc aquifer is present, which maximizes the potential well capacity. As can be seen on the figure, a significant north-south trending bedrock valley is present just west of CSAH 116, which are areas where the full thickness of the target aquifer may not be present. Furthermore, the MN Department of Natural Resources identified a wetland located above this bedrock valley on the north side of CSAH 30 that they suggest may be connected to the target aquifer and that required special monitoring during pump testing of the test well (see Section 3.2). The well layout generally places wells northeast, east, and south of Municipal Well No. 1 to avoid encroaching on this wetland with the additional wells. Lastly, the Jordan aquifer could also be considered for water supply at a given well location if a full or nearly full thickness of the Jordan is present. It would not be viable at many locations due to substantial erosion of the Jordan aquifer thickness and is also somewhat less desirable due to potential increased vulnerability to surface contamination events (i.e., the St. Lawrence confining unit lies between the Jordan and Tunnel City- Wonewoc aquifers) and also due to possible increased water treatment operational variability due to the varying raw water composition when multiple aquifers are involved. Hence, the Tunnel City-Wonewoc aquifer remains the “first choice” target aquifer for well field planning purposes, and the Jordan aquifer is only noted as a possible secondary choice, should the Tunnel City-Wonewoc aquifer prove inadequate at a given location. The minimum well spacing utilized in Figure 1 was 2,000 feet. Wells need to be located a reasonable distance apart to prevent any significant overlap in the drawdown zones, which would reduce the capacities of the two wells when they need to be pumped at the same time. Two primary reference points were utilized in selecting this spacing. The City of Rogers is the closest adjacent city that has multiple wells (seven) completed in the Tunnel City-Wonewoc aquifer. Within the two distinct well groupings, the well spacings are generally 1,200 or 1,500 feet. Since Corcoran has not yet installed its first municipal well or two to allow detailed testing and analysis of actual well interference potential in the Corcoran well field area, a slightly more conservative spacing of 2,000 feet was selected. Another reference is the pump testing of Dayton Municipal Well No. 3, in which drawdown was measured at approximately 20 feet in a monitoring well located 1,000 feet away. It is likely that the potential drawdown at 2,000 feet would be around 10 feet or less and would be a tolerable amount. FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM MUNICIPAL WELL PLANNING CONSIDERATIONS 3.2 3.1.2 Total Well Capacity VS. Demand There are 9 wells shown on Figure 1, and thus the firm capacity would be determined with 8 of the 9 wells pumping (the largest well is assumed to be offline for determining firm capacity). If well capacities were to ultimately be around 500 gpm, which was the assumption used in determining trunk fees, total well production capacity would be 4,000 gpm (8 x 500 gpm), or 5.75 MGD. However, well capacities could ultimately prove to be somewhat higher, i.e., the average well capacity in Rogers is over 750 gpm. At this higher rate, total well production capacity would be 6,000 gpm (8 x 750 gpm), or 8.6 MGD. A somewhat conservative estimate for the ultimate capacity needed for NE Corcoran was 10 MGD. Hence, if the higher potential well rates were found to be achievable, the 9 wells could be at or very near the ultimate capacity needed. If the well rates are near the lower end, then several more wells could be needed. If only 2 or 3 more wells were needed, it is possible another well could be installed between the two easternmost wells that are nearing CSAH 101, and 1 or 2 wells could possibly be installed east of the southernmost well. Otherwise, a “western branch” of raw watermain could be installed parallel to CSAH 30, across the bedrock valley area, such that additional wells could be installed in other area of substantial Jordan presence. 3.1.3 Raw Watermain A conceptual layout for raw watermain is shown on Figure 1, utilizing sizes of 8- to 16-inch diameter. Sizing was based on 750 gpm per well and a target velocity of 4 to 5 fps. Where possible, the watermains were placed along county roads, and were assumed to be placed just outside the county road right-of- way in City drainage and utility easement. Such placement was preferred given that development in some areas may proceed faster than the need for the wells/watermain, which eliminates open trenching as a practical option in development streets. Directional drilling would still be an option in either case (development streets or county roads), but is more expensive, especially in the larger sizes. Along county roads, some segments might still be able to be installed by open trenching, thereby reducing costs. Also, even from a strictly technical/practicality standpoint, there would be far less utilities and service lines to avoid in the county road option, and for any potential tight turns that would require excavation to open up the connection area, the county road option would avoid tearing up a development street. As well capacities are better defined, the conceptual sizing may need to be adjusted slightly in some areas. However, these adjustments are expected to be relatively limited, i.e., possibly one pipe size different in limited segments. FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM FINANCIAL PLANNING 4.1 4.0 FINANCIAL PLANNING Summarized below are four options for the City to consider when conducting their financial analysis relative to the total project costs. Since the original feasibility study was submitted, City Staff and Stantec have had the opportunity continue discussions regarding the City’s budgeting process, pressure from development, and market volatility. Staff has also taken time to tour nearby facilities and collectively identify issues that will be important to the success of the overall design. As a result, the following items have been incorporated into the total project cost estimates: Architectural Design – Based on the proposed location of the water treatment plant in a residential area, it is understood that the expectations for a facility with mid- to premium-level architectural features may be raised. The base design (Option 1) allows for a more modest building envelope and associated architectural features. Incorporating features that help the facility blend into the neighborhood increases construction and design costs relative to the original feasibility study and is reflected in the projected costs in Table 6. Gravity Filtration with Clearwell Storage– The City has expressed an interest in having the most operational flexibility and reduced life cycle costs relative to filter replacement, given the projected long-term water demand. Gravity filtration with clearwell storage in lieu of pressure filtration offers these benefits and is the City’s preference. Site Utilities – Additional consideration for sanitary sewer, three-phase power, and other site utility extensions not included in the original feasibility study have been included to provide additional contingency for budgeting purposes. Market Volatility & Contingency – The current market relative to construction materials and labor has been at a premium in response to the COVID-19 pandemic. Given the importance of establishing realistic budgetary comparisons a contingency of 10% has been included in the total project costs for all options to appropriately account for volatility in the marketplace, elements of the project that are yet to be defined, and anticipated construction costs in 2022 and beyond. The four options presented in Table 6 represent varying levels of financial commitment relative to treatment goals and level of complexity with respect to design, construction, and operations. Estimates for the municipal well, storage (GST or water tower), and watermain and site utilities are consistent across all options. Engineering, admin, legal are percentage based estimates. FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM FINANCIAL PLANNING 4.2 Table 6: Total Project Cost Comparison for Financial Planning FEASIBILITY REPORT SUPPLEMENTS – NORTHEAST WATER SYSTEM RECOMMENDATION 5.1 5.0 RECOMMENDATION Through the analysis engineering feasibility along with staff input, local city operator input and Council direction it is recommended that Council authorize staff as follows: Conduct a financial viability analysis for Option 2 which provides flexibility for future increased treatment alternatives (regulatory or softening), additional treatment capacity on “Day 1”, and increased storage via construction of clearwell ground storage at the treatment facility . A tower provides a factor of safety utilizing overhead storage and also reduces the site construction variables as compared to ground storage. In addition, conduct the financial viability analysis of a more limited facility using pressure filters with phased improvements to increase capacity as demand warrants. This (Option 1) would be implemented as demand warrants but also increases construction activity over time. TLAC fee review will be included in the financial analysis and also include additional wells. After the financial viability analysis has been completed, staff and engineering will work together during the design development / preliminary design phase to further define the project within budget with items that include SCADA, materials storage, security, automation, laboratory space, office space, roofing preference, architecture enhancements and building envelope. Figure 1 Geologic Map with Planned and Potential Municipal Well Locations STAFF REPORT Agenda Item 10a. Council Meeting: June 10, 2021 Prepared By: Brad Martens Topic: 2021 Dust Control Program Action Required: Hold Public Hearing; Approval Summary: On April 22nd staff provided an overview of the proposed 2021 dust control program. At that meeting, Council called a public hearing for the project which is to be held. It is proposed to bill properties for the application as in years past with unpaid fees to be assessed later in the year, if necessary. The percentage of the project to be assessed has been reduced overtime with incremental budget adjustments. The City anticipates the following costs for the program for 2021: Neighborhood Road Assessment Collector/Adjacent Road Assessment Other Assessment City Share Total $8,232 $28,009 $1,260 $74,099 $111,600 Staff has received a request from Dennis and Jan Stieg to not be charged the dust control fee for their property at 19510 Stieg Road, which is approximately 2,000 feet off of Stieg Road. While staff finds this request reasonable, there are several other properties with homes located several hundred feet off of the road also proposed to receive fees. Council should direct staff on how to proceed with this request. Financial/Budget: Costs for this project are included in the adopted 2021 budget along with projected revenue from billing in the amount of $37,500. Options: 1. Hold the public hearing; approve resolution 2021-60 ordering improvement of dust control treatments to be applied to city streets in 2021 as presented. 2. Hold the public hearing; approve resolution 2021-60 ordering improvement of dust control treatments to be applied to city streets in 2021 with amendments. 3. Send back to staff for further review. Recommendation: Hold the public hearing; approve resolution 2021-60 ordering improvement of dust control treatments to be applied to city streets in 2021 as presented. Page 2 Council Action: Hold the public hearing; consider a motion to approve resolution 2021-60 ordering improvement of dust control treatments to be applied to city streets in 2021 as presented. Attachments: 1. Resolution 2021-60 2. Proposed dust control fee by property City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-60 Page 1 of 2 Motion By: Seconded By: RESOLUTION ORDERING IMPROVEMENT OF DUST CONTROL TREATMENTS TO BE APPLIED TO CITY STREETS IN 2021 WHEREAS, Resolution 2021-32 of the City Council, adopted on April 22, 2021, fixed a date for a public hearing on the proposed improvement of dust control treatments to be applied to streets throughout the City as outlined in Exhibit A which was rescheduled and re-noticed for June 10, 2021; and WHEREAS, ten days’ mailed notice and two weeks’ published notice of the hearing was given, and the hearing was held thereon on the 10th day of June, 2021, at which all persons desiring to be heard were given an opportunity to be heard thereon; and WHEREAS, the City Council received a report from the City Administrator at the hearing indicating that the project is necessary, cost-effective, and feasible, and will be best accomplished as proposed, and informing the City Council of the estimated cost of the proposed treatments; and WHEREAS, the City Administrator prepared an estimate of the total charges to the affected landowners, as well as a method for calculating costs to individual landowners, which was available at the hearing. NOW, THEREFORE, BE IT RESOLVED by the Corcoran City Council: 1. The Corcoran City Council determined the improvement of the application dust control treatments necessary, cost-effective, and feasible. 2. Such improvements are hereby ordered as proposed in Exhibit A. VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Thomas, Manoj Thomas, Manoj Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan Whereupon, said Resolution is hereby declared adopted on this 10th day of June 2021. ________________________________ Tom McKee - Mayor ATTEST: ____________________________________ City Seal Jessica Beise – Administrative Services Director City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-60 Page 2 of 2 Exhibit A 8690 BECHTOLD RD 16‐119‐23‐33‐0002 $81.51 8925 BECHTOLD RD 17‐119‐23‐14‐0004 $81.51 8955 BECHTOLD RD 17‐119‐23‐14‐0003 $81.51 8985 BECHTOLD RD 17‐119‐23‐14‐0001 $81.51 9305 BECHTOLD RD 08‐119‐23‐44‐0001 $81.51 9310 BECHTOLD RD 09‐119‐23‐33‐0006 $81.51 9725 BECHTOLD RD 08‐119‐23‐14‐0004 $81.51 9730 BECHTOLD RD 09‐119‐23‐23‐0002 $81.51 9733 BECHTOLD RD 08‐119‐23‐14‐0003 $81.51 9785 BECHTOLD RD 08‐119‐23‐14‐0002 $81.51 9810 BECHTOLD RD 09‐119‐23‐23‐0003 $81.51 9820 BECHTOLD RD 09‐119‐23‐23‐0007 $81.51 9845 BECHTOLD RD 08‐119‐23‐14‐0013 $81.51 9847 BECHTOLD RD 08‐119‐23‐14‐0014 $81.51 10025 BECHTOLD RD 08‐119‐23‐11‐0002 $81.51 10060 BECHTOLD RD 09‐119‐23‐22‐0004 $81.51 10124 BECHTOLD RD 04‐119‐23‐33‐0003 $81.51 10165 BECHTOLD RD 05‐119‐23‐44‐0001 $81.51 10206 BECHTOLD RD 04‐119‐23‐33‐0002 $81.51 10214 BECHTOLD RD 04‐119‐23‐33‐0001 $81.51 10290 BECHTOLD RD 04‐119‐23‐32‐0003 $81.51 10515 BECHTOLD RD 05‐119‐23‐14‐0014 $81.51 10525 BECHTOLD RD 05‐119‐23‐14‐0013 $81.51 10600 BECHTOLD RD 04‐119‐23‐24‐0001 $81.51 10700 BECHTOLD RD 04‐119‐23‐23‐0001 $81.51 10720 BECHTOLD RD 04‐119‐23‐21‐0005 $81.51 10721 BECHTOLD RD 05‐119‐23‐11‐0007 $81.51 10725 BECHTOLD RD 05‐119‐23‐11‐0008 $81.51 10740 BECHTOLD RD 04‐119‐23‐22‐0003 $81.51 10845 BECHTOLD RD 05‐119‐23‐11‐0005 $81.51 10895 BECHTOLD RD 05‐119‐23‐11‐0001 $81.51 8220 CAIN RD 23‐119‐23‐22‐0003 $81.51 8270 CAIN RD 23‐119‐23‐22‐0010 $81.51 8300 CAIN RD 23‐119‐23‐22‐0009 $81.51 8540 CAIN RD 14‐119‐23‐33‐0003 $81.51 8695 CAIN RD 15‐119‐23‐44‐0001 $81.51 8707 CAIN RD 15‐119‐23‐41‐0002 $81.51 8722 CAIN RD 14‐119‐23‐31‐0002 $81.51 8810 CAIN RD 14‐119‐23‐32‐0001 $81.51 8825 CAIN RD 15‐119‐23‐41‐0001 $81.51 9103 CAIN RD 15‐119‐23‐14‐0002 $81.51 9201 CAIN RD 15‐119‐23‐11‐0001 $81.51 9226 CAIN RD 14‐119‐23‐22‐0004 $81.51 9231 CAIN RD 15‐119‐23‐12‐0001 $81.51 9320 CAIN RD 11‐119‐23‐33‐0003 $81.51 9400 CAIN RD 11‐119‐23‐33‐0004 $81.51 9401 CAIN RD 10‐119‐23‐44‐0010 $81.51 9403 CAIN RD 10‐119‐23‐44‐0003 $81.51 9420 CAIN RD 11‐119‐23‐33‐0006 $81.51 9423 CAIN RD 10‐119‐23‐44‐0005 $81.51 9434 CAIN RD 11‐119‐23‐33‐0005 $81.51 9437 CAIN RD 10‐119‐23‐44‐0001 $81.51 9505 CAIN RD 10‐119‐23‐41‐0004 $81.51 9530 CAIN RD 11‐119‐23‐32‐0009 $81.51 9580 CAIN RD 11‐119‐23‐32‐0011 $81.51 10410 CAIN RD 02‐119‐23‐32‐0002 $81.51 10415 CAIN RD 03‐119‐23‐41‐0003 $81.51 10420 CAIN RD 02‐119‐23‐31‐0001 $81.51 10430 CAIN RD 02‐119‐23‐32‐0003 $81.51 10450 CAIN RD 02‐119‐23‐32‐0004 $81.51 10501 CAIN RD 03‐119‐23‐14‐0003 $81.51 10540 CAIN RD 02‐119‐23‐23‐0005 $81.51 10580 CAIN RD 02‐119‐23‐23‐0004 $81.51 10620 CAIN RD 02‐119‐23‐23‐0003 $81.51 10660 CAIN RD 02‐119‐23‐23‐0002 $81.51 10855 CAIN RD 03‐119‐23‐11‐0002 $81.51 8520 COUNTY RD 19 18‐119‐23‐43‐0002 $81.51 20504 HORSESHOE TRL 35‐119‐23‐24‐0002 $81.51 20755 HORSESHOE TRL 34‐119‐23‐41‐0003 $81.51 21020 HORSESHOE TRL 34‐119‐23‐13‐0004 $81.51 21030 HORSESHOE TRL 34‐119‐23‐13‐0002 $81.51 21033 HORSESHOE TRL 34‐119‐23‐42‐0002 $81.51 21050 HORSESHOE TRL 34‐119‐23‐24‐0004 $81.51 21070 HORSESHOE TRL 34‐119‐23‐24‐0005 $81.51 21090 HORSESHOE TRL 34‐119‐23‐24‐0006 $81.51 21124 HORSESHOE TRL 34‐119‐23‐21‐0003 $81.51 21150 HORSESHOE TRL 34‐119‐23‐24‐0003 $81.51 21200 HORSESHOE TRL 34‐119‐23‐24‐0002 $81.51 21250 HORSESHOE TRL 34‐119‐23‐24‐0001 $81.51 21300 HORSESHOE TRL 34‐119‐23‐23‐0001 $81.51 21404 HORSESHOE TRL 34‐119‐23‐22‐0002 $81.51 21407 HORSESHOE TRL 34‐119‐23‐32‐0003 $81.51 21801 HORSESHOE TRL 33‐119‐23‐42‐0006 $81.51 21903 HORSESHOE TRL 33‐119‐23‐31‐0004 $81.51 22075 HORSESHOE TRL 33‐119‐23‐31‐0003 $81.51 22105 HORSESHOE TRL 33‐119‐23‐32‐0017 $81.51 22125 HORSESHOE TRL 33‐119‐23‐32‐0015 $81.51 22202 HORSESHOE TRL 33‐119‐23‐23‐0001 $81.51 22201 HORSESHOE TRL 33‐119‐23‐32‐0016 $81.51 22245 HORSESHOE TRL 33‐119‐23‐32‐0012 $81.51 7340 KALK RD 27‐119‐23‐24‐0002 $81.51 7360 KALK RD 27‐119‐23‐24‐0003 $81.51 7400 KALK RD 27‐119‐23‐24‐0004 $81.51 7450 KALK RD 27‐119‐23‐21‐0005 $81.51 7500 KALK RD 27‐119‐23‐21‐0006 $81.51 7620 KALK RD 27‐119‐23‐21‐0004 $81.51 7705 KALK RD 22‐119‐23‐33‐0004 $81.51 7710 KALK RD 22‐119‐23‐34‐0003 $81.51 7800 KALK RD 22‐119‐23‐34‐0002 $81.51 7801 KALK RD 22‐119‐23‐33‐0005 $81.51 7885 KALK RD 22‐119‐23‐33‐0002 $81.51 21000 LARKIN RD 27‐119‐23‐13‐0003 $81.51 21025 LARKIN RD 27‐119‐23‐42‐0004 $81.51 21115 LARKIN RD 27‐119‐23‐42‐0006 $81.51 21125 LARKIN RD 27‐119‐23‐42‐0007 $81.51 21201 LARKIN RD 27‐119‐23‐31‐0001 $81.51 21300 LARKIN RD 27‐119‐23‐23‐0003 $81.51 21301 LARKIN RD 27‐119‐23‐23‐0002 $81.51 21400 LARKIN RD 27‐119‐23‐23‐0001 $81.51 21420 LARKIN RD 27‐119‐23‐23‐0004 $81.51 21500 LARKIN RD 27‐119‐23‐23‐0005 $81.51 21600 LARKIN RD 28‐119‐23‐13‐0002 $81.51 6420 OLD SETTLERS RD 35‐119‐23‐31‐0002 $81.51 6575 OLD SETTLERS RD 35‐119‐23‐32‐0001 $81.51 6810 OLD SETTLERS RD 34‐119‐23‐11‐0002 $81.51 6855 OLD SETTLERS RD 27‐119‐23‐44‐0007 $81.51 6900 OLD SETTLERS RD 27‐119‐23‐44‐0006 $81.51 6904 OLD SETTLERS RD 27‐119‐23‐44‐0011 $81.51 6905 OLD SETTLERS RD 27‐119‐23‐43‐0001 $81.51 6910 OLD SETTLERS RD 27‐119‐23‐44‐0028 $81.51 6925 OLD SETTLERS RD 27‐119‐23‐43‐0005 $81.51 7100 OLD SETTLERS RD 27‐119‐23‐44‐0010 $81.51 7121 OLD SETTLERS RD 27‐119‐23‐43‐0003 $81.51 7131 OLD SETTLERS RD 27‐119‐23‐42‐0002 $81.51 7200 OLD SETTLERS RD 27‐119‐23‐41‐0007 $81.51 7203 OLD SETTLERS RD 27‐119‐23‐42‐0005 $81.51 7250 OLD SETTLERS RD 27‐119‐23‐41‐0008 $81.51 19100 SCHUTTE RD 13‐119‐23‐14‐0010 $81.51 19125 SCHUTTE RD 13‐119‐23‐41‐0002 $81.51 19301 SCHUTTE RD 13‐119‐23‐42‐0001 $81.51 19410 SCHUTTE RD 13‐119‐23‐13‐0002 $81.51 19420 SCHUTTE RD 13‐119‐23‐13‐0001 $81.51 19600 SCHUTTE RD 13‐119‐23‐21‐0004 $81.51 19425 STIEG RD 01‐119‐23‐42‐0001 $81.51 19510 STIEG RD 01‐119‐23‐21‐0001 $81.51 19520 STIEG RD 01‐119‐23‐31‐0002 $81.51 19715 STIEG RD 01‐119‐23‐32‐0001 $81.51 19725 STIEG RD 01‐119‐23‐32‐0005 $81.51 19740 STIEG RD 01‐119‐23‐23‐0019 $81.51 19800 STIEG RD 01‐119‐23‐23‐0021 $81.51 19801 STIEG RD 01‐119‐23‐32‐0006 $81.51 19850 STIEG RD 01‐119‐23‐23‐0022 $81.51 19880 STIEG RD 01‐119‐23‐23‐0023 $81.51 7900 STREHLER RD 21‐119‐23‐42‐0002 $81.51 7970 STREHLER RD 21‐119‐23‐42‐0013 $81.51 8020 STREHLER RD 21‐119‐23‐42‐0012 $81.51 8100 STREHLER RD 21‐119‐23‐13‐0005 $81.51 8175 STREHLER RD 21‐119‐23‐24‐0001 $81.51 8301 STREHLER RD 21‐119‐23‐31‐0006 $81.51 22060 STREHLER RD 16‐119‐23‐34‐0006 $81.51 22070 STREHLER RD 16‐119‐23‐34‐0005 $81.51 22090 STREHLER RD 16‐119‐23‐43‐0001 $81.51 22505 STREHLER RD 20‐119‐23‐14‐0001 $81.51 22701 STREHLER RD 20‐119‐23‐13‐0001 $81.51 22720 STREHLER RD 17‐119‐23‐43‐0002 $81.51 22735 STREHLER RD 20‐119‐23‐12‐0002 $81.51 22814 STREHLER RD 17‐119‐23‐43‐0001 $81.51 22820 STREHLER RD 17‐119‐23‐34‐0003 $81.51 22840 STREHLER RD 17‐119‐23‐34‐0002 $81.51 22900 STREHLER RD 17‐119‐23‐33‐0002 $81.51 22903 STREHLER RD 20‐119‐23‐22‐0004 $81.51 23020 STREHLER RD 17‐119‐23‐32‐0003 $81.51 23110 STREHLER RD 18‐119‐23‐44‐0005 $81.51 23120 STREHLER RD 18‐119‐23‐44‐0006 $81.51 23212 STREHLER RD 18‐119‐23‐44‐0007 $81.51 23255 STREHLER RD 19‐119‐23‐11‐0002 $81.51 23300 STREHLER RD 18‐119‐23‐43‐0001 $81.51 23335 STREHLER RD 19‐119‐23‐12‐0003 $81.51 23600 STREHLER RD 18‐119‐23‐34‐0002 $81.51 23651 STREHLER RD 19‐119‐23‐21‐0010 $81.51 23660 STREHLER RD 18‐119‐23‐34‐0001 $81.51 23700 STREHLER RD 18‐119‐23‐33‐0002 $81.51 23750 STREHLER RD 18‐119‐23‐33‐0001 $81.51 23785 STREHLER RD 19‐119‐23‐23‐0003 $81.51 23817 STREHLER RD 19‐119‐23‐22‐0001 $81.51 23825 STREHLER RD 19‐119‐23‐22‐0003 $81.51 23825 TESSMER RD 07‐119‐23‐22‐0001 $81.51 7875 TRAIL HAVEN RD 21‐119‐23‐41‐0010 $81.51 7905 TRAIL HAVEN RD 21‐119‐23‐41‐0009 $81.51 8095 TRAIL HAVEN RD 21‐119‐23‐41‐0008 $81.51 8175 TRAIL HAVEN RD 21‐119‐23‐14‐0001 $81.51 8400 TRAIL HAVEN RD 22‐119‐23‐21‐0006 $81.51 8401 TRAIL HAVEN RD 21‐119‐23‐11‐0002 $81.51 8490 TRAIL HAVEN RD 22‐119‐23‐22‐0001 $81.51 8645 TRAIL HAVEN RD 16‐119‐23‐44‐0005 $81.51 8655 TRAIL HAVEN RD 16‐119‐23‐44‐0003 $81.51 8750 TRAIL HAVEN RD 15‐119‐23‐32‐0006 $81.51 8850 TRAIL HAVEN RD 15‐119‐23‐32‐0010 $81.51 8900 TRAIL HAVEN RD 15‐119‐23‐32‐0001 $81.51 8901 TRAIL HAVEN RD 16‐119‐23‐14‐0001 $81.51 9010 TRAIL HAVEN RD 15‐119‐23‐23‐0001 $81.51 9017 TRAIL HAVEN RD 16‐119‐23‐14‐0022 $81.51 9035 TRAIL HAVEN RD 16‐119‐23‐14‐0014 $81.51 9120 TRAIL HAVEN RD 15‐119‐23‐22‐0001 $81.51 9125 TRAIL HAVEN RD 16‐119‐23‐11‐0005 $81.51 9223 TRAIL HAVEN RD 16‐119‐23‐11‐0003 $81.51 9247 TRAIL HAVEN RD 16‐119‐23‐11‐0002 $81.51 9415 TRAIL HAVEN RD 09‐119‐23‐44‐0004 $81.51 9425 TRAIL HAVEN RD 09‐119‐23‐44‐0003 $81.51 9435 TRAIL HAVEN RD 09‐119‐23‐44‐0019 $81.51 9475 TRAIL HAVEN RD 09‐119‐23‐44‐0018 $81.51 9515 TRAIL HAVEN RD 09‐119‐23‐41‐0003 $81.51 9625 TRAIL HAVEN RD 09‐119‐23‐41‐0010 $81.51 9710 TRAIL HAVEN RD 10‐119‐23‐23‐0008 $81.51 9714 TRAIL HAVEN RD 10‐119‐23‐23‐0007 $81.51 9735 TRAIL HAVEN RD 09‐119‐23‐14‐0003 $81.51 9823 TRAIL HAVEN RD 09‐119‐23‐14‐0002 $81.51 9837 TRAIL HAVEN RD 09‐119‐23‐14‐0001 $81.51 9901 TRAIL HAVEN RD 09‐119‐23‐11‐0008 $81.51 9933 TRAIL HAVEN RD 09‐119‐23‐11‐0007 $81.51 9945 TRAIL HAVEN RD 09‐119‐23‐11‐0006 $81.51 10035 TRAIL HAVEN RD 10‐119‐23‐22‐0005 $81.51 10104 TRAIL HAVEN RD 03‐119‐23‐33‐0006 $81.51 10150 TRAIL HAVEN RD 03‐119‐23‐33‐0005 $81.51 10170 TRAIL HAVEN RD 03‐119‐23‐33‐0010 $81.51 10210 TRAIL HAVEN RD 03‐119‐23‐33‐0009 $81.51 10215 TRAIL HAVEN RD 04‐119‐23‐44‐0010 $81.51 10220 TRAIL HAVEN RD 03‐119‐23‐33‐0001 $81.51 10400 TRAIL HAVEN RD 03‐119‐23‐32‐0004 $81.51 10405 TRAIL HAVEN RD 04‐119‐23‐41‐0002 $81.51 10410 TRAIL HAVEN RD 03‐119‐23‐32‐0003 $81.51 10440 TRAIL HAVEN RD 03‐119‐23‐32‐0002 $81.51 10500 TRAIL HAVEN RD 03‐119‐23‐32‐0001 $81.51 10600 TRAIL HAVEN RD 03‐119‐23‐23‐0003 $81.51 10690 TRAIL HAVEN RD 03‐119‐23‐22‐0008 $81.51 10765 TRAIL HAVEN RD 04‐119‐23‐11‐0001 $81.51 10800 TRAIL HAVEN RD 03‐119‐23‐22‐0005 $81.51 6215 WILLOW DR 33‐119‐23‐34‐0005 $40.76 6221 WILLOW DR 33‐119‐23‐34‐0004 $40.76 6225 WILLOW DR 33‐119‐23‐34‐0002 $40.76 6280 WILLOW DR 34‐119‐23‐33‐0001 $81.51 6300 WILLOW DR 33‐119‐23‐44‐0003 $81.51 6315 WILLOW DR 33‐119‐23‐42‐0002 $81.51 6320 WILLOW DR 33‐119‐23‐44‐0002 $81.51 6330 WILLOW DR 33‐119‐23‐44‐0001 $81.51 6501 WILLOW DR 33‐119‐23‐41‐0002 $81.51 6603 WILLOW DR 33‐119‐23‐13‐0001 $81.51 6620 WILLOW DR 33‐119‐23‐14‐0001 $81.51 6655 WILLOW DR 33‐119‐23‐13‐0008 $81.51 6675 WILLOW DR 33‐119‐23‐13‐0002 $81.51 6685 WILLOW DR 33‐119‐23‐13‐0003 $81.51 6705 WILLOW DR 33‐119‐23‐13‐0005 $81.51 6715 WILLOW DR 33‐119‐23‐13‐0007 $81.51 6721 WILLOW DR 33‐119‐23‐12‐0001 $81.51 6801 WILLOW DR 33‐119‐23‐12‐0007 $81.51 6855 WILLOW DR 33‐119‐23‐21‐0001 $81.51 6915 WILLOW DR 28‐119‐23‐43‐0009 $81.51 6925 WILLOW DR 28‐119‐23‐43‐0008 $81.51 7145 WILLOW DR 28‐119‐23‐42‐0005 $81.51 7200 WILLOW DR 28‐119‐23‐41‐0002 $81.51 7229 WILLOW DR 28‐119‐23‐42‐0004 $81.51 20700 70TH AVE 27‐119‐23‐44‐0022 $81.51 20730 70TH AVE 27‐119‐23‐44‐0021 $81.51 20735 70TH AVE 27‐119‐23‐44‐0025 $81.51 20740 70TH AVE 27‐119‐23‐44‐0020 $81.51 20800 70TH AVE 27‐119‐23‐44‐0019 $81.51 20807 70TH AVE 27‐119‐23‐44‐0024 $81.51 20818 70TH AVE 27‐119‐23‐44‐0018 $81.51 20833 70TH AVE 27‐119‐23‐44‐0023 $81.51 20840 70TH AVE 27‐119‐23‐44‐0017 $81.51 21400 CIRCLE LN 10‐119‐23‐23‐0004 $81.51 21401 CIRCLE LN 10‐119‐23‐23‐0006 $81.51 21410 CIRCLE LN 10‐119‐23‐23‐0003 $81.51 21415 CIRCLE LN 10‐119‐23‐23‐0005 $81.51 21420 CIRCLE LN 10‐119‐23‐23‐0002 $81.51 8900 FOXLINE DR 16‐119‐23‐14‐0006 $81.51 8901 FOXLINE DR 16‐119‐23‐14‐0021 $81.51 8919 FOXLINE DR 16‐119‐23‐14‐0020 $81.51 8920 FOXLINE DR 16‐119‐23‐14‐0025 $81.51 8939 FOXLINE DR 16‐119‐23‐14‐0019 $81.51 9000 FOXLINE DR 16‐119‐23‐14‐0009 $81.51 9001 FOXLINE DR 16‐119‐23‐14‐0018 $81.51 9016 FOXLINE DR 16‐119‐23‐14‐0010 $81.51 9019 FOXLINE DR 16‐119‐23‐14‐0017 $81.51 9037 FOXLINE DR 16‐119‐23‐14‐0016 $81.51 9040 FOXLINE DR 16‐119‐23‐14‐0011 $81.51 9101 FOXLINE DR 16‐119‐23‐14‐0015 $81.51 9117 FOXLINE DR 16‐119‐23‐11‐0022 $81.51 9148 FOXLINE DR 16‐119‐23‐11‐0010 $81.51 9200 FOXLINE DR 16‐119‐23‐11‐0009 $81.51 9220 FOXLINE DR 16‐119‐23‐11‐0008 $81.51 9239 FOXLINE DR 16‐119‐23‐11‐0017 $81.51 9240 FOXLINE DR 16‐119‐23‐11‐0007 $81.51 9259 FOXLINE DR 16‐119‐23‐11‐0016 $81.51 9260 FOXLINE DR 16‐119‐23‐11‐0006 $81.51 9305 FOXLINE DR 09‐119‐23‐44‐0016 $81.51 21000 GREENVIEW CT 03‐119‐23‐43‐0005 $40.76 20705 HIDDEN PONDS DR 03‐119‐23‐44‐0016 $40.76 20715 HIDDEN PONDS DR 03‐119‐23‐44‐0017 $40.76 20810 HIDDEN PONDS DR 03‐119‐23‐44‐0025 $40.76 20815 HIDDEN PONDS DR 03‐119‐23‐44‐0009 $40.76 20835 HIDDEN PONDS DR 03‐119‐23‐44‐0008 $40.76 20840 HIDDEN PONDS DR 03‐119‐23‐44‐0005 $40.76 20900 HIDDEN PONDS DR 03‐119‐23‐43‐0001 $40.76 20910 HIDDEN PONDS DR 03‐119‐23‐43‐0002 $40.76 20920 HIDDEN PONDS DR 03‐119‐23‐43‐0003 $40.76 20925 HIDDEN PONDS DR 03‐119‐23‐44‐0007 $40.76 20940 HIDDEN PONDS DR 03‐119‐23‐43‐0004 $40.76 20945 HIDDEN PONDS DR 03‐119‐23‐44‐0006 $40.76 21524 HOMESTEAD TRL 28‐119‐23‐41‐0008 $81.51 21527 HOMESTEAD TRL 28‐119‐23‐44‐0007 $81.51 21536 HOMESTEAD TRL 28‐119‐23‐41‐0007 $81.51 21539 HOMESTEAD TRL 28‐119‐23‐44‐0008 $81.51 21625 HOMESTEAD TRL 28‐119‐23‐44‐0009 $81.51 21630 HOMESTEAD TRL 28‐119‐23‐41‐0011 $81.51 21635 HOMESTEAD TRL 28‐119‐23‐44‐0010 $81.51 21645 HOMESTEAD TRL 28‐119‐23‐44‐0011 $81.51 21777 HOMESTEAD TRL 28‐119‐23‐43‐0001 $81.51 21801 HOMESTEAD TRL 28‐119‐23‐43‐0007 $81.51 21850 HOMESTEAD TRL 28‐119‐23‐42‐0003 $81.51 21901 HOMESTEAD TRL 28‐119‐23‐43‐0006 $81.51 21920 HOMESTEAD TRL 28‐119‐23‐31‐0002 $81.51 22201 HOMESTEAD TRL 28‐119‐23‐33‐0002 $81.51 10024 MEADOW CIR 10‐119‐23‐22‐0006 $81.51 21324 MEADOW CIR 10‐119‐23‐22‐0007 $81.51 21300 MEADOW LN 10‐119‐23‐22‐0009 $81.51 21310 MEADOW LN 10‐119‐23‐22‐0008 $81.51 21313 MEADOW LN 10‐119‐23‐22‐0010 $81.51 21325 MEADOW LN 10‐119‐23‐22‐0011 $81.51 21406 MEADOW LN 10‐119‐23‐22‐0012 $81.51 21414 MEADOW LN 10‐119‐23‐22‐0004 $81.51 21417 MEADOW LN 10‐119‐23‐22‐0013 $81.51 21422 MEADOW LN 10‐119‐23‐22‐0003 $81.51 21427 MEADOW LN 10‐119‐23‐22‐0014 $81.51 21525 NYSTROM LN 28‐119‐23‐44‐0021 $81.51 21528 NYSTROM LN 28‐119‐23‐44‐0015 $81.51 21535 NYSTROM LN 28‐119‐23‐44‐0022 $81.51 21607 NYSTROM LN 28‐119‐23‐44‐0018 $81.51 21617 NYSTROM LN 28‐119‐23‐44‐0019 $81.51 21627 NYSTROM LN 28‐119‐23‐44‐0020 $81.51 21636 NYSTROM LN 28‐119‐23‐44‐0013 $81.51 21646 NYSTROM LN 28‐119‐23‐44‐0012 $81.51 20403 RUSH MEADOW LN 02‐119‐23‐21‐0005 $81.51 20411 RUSH MEADOW LN 02‐119‐23‐21‐0004 $81.51 20419 RUSH MEADOW LN 02‐119‐23‐21‐0003 $81.51 20500 RUSH MEADOW LN 02‐119‐23‐22‐0006 $81.51 20503 RUSH MEADOW LN 02‐119‐23‐22‐0011 $81.51 20512 RUSH MEADOW LN 02‐119‐23‐22‐0005 $81.51 20515 RUSH MEADOW LN 02‐119‐23‐22‐0010 $81.51 20600 RUSH MEADOW LN 02‐119‐23‐22‐0004 $81.51 20605 RUSH MEADOW LN 02‐119‐23‐22‐0009 $81.51 20610 RUSH MEADOW LN 02‐119‐23‐22‐0003 $81.51 20617 RUSH MEADOW LN 02‐119‐23‐22‐0008 $81.51 20624 RUSH MEADOW LN 02‐119‐23‐22‐0002 $81.51 20629 RUSH MEADOW LN 02‐119‐23‐22‐0007 $81.51 21580 SICORA LN 09‐119‐23‐11‐0015 $81.51 21600 SICORA LN 09‐119‐23‐11‐0005 $81.51 21500 TREELINE DR 16‐119‐23‐11‐0015 $81.51 21510 TREELINE DR 16‐119‐23‐11‐0014 $81.51 21515 TREELINE DR 16‐119‐23‐14‐0013 $81.51 21520 TREELINE DR 16‐119‐23‐11‐0013 $81.51 21525 TREELINE DR 16‐119‐23‐14‐0012 $81.51 21530 TREELINE DR 16‐119‐23‐11‐0012 $81.51 21540 TREELINE DR 16‐119‐23‐11‐0011 $81.51 10050 JEFFREY LN 09‐119‐23‐21‐0006 $89.45 10140 CHAPARRAL CIRCLE 04‐119‐23‐33‐0016 $89.45 22105 CHAPARRAL CIRCLE 04‐119‐23‐33‐0018 $89.45 22112 CHAPARRAL CIRCLE 04‐119‐23‐33‐0017 $89.45 22195 CHAPARRAL LANE 04‐119‐23‐33‐0022 $89.45 22200 CHAPARRAL LANE 04‐119‐23‐33‐0006 $89.45 22212 CHAPARRAL LANE 04‐119‐23‐33‐0005 $89.45 22215 CHAPARRAL LANE 04‐119‐23‐33‐0021 $89.45 22218 CHAPARRAL LANE 04‐119‐23‐33‐0004 $89.45 22229 CHAPARRAL LANE 04‐119‐23‐33‐0020 $89.45 7720 CORCORAN TRL E 23‐119‐23‐33‐0009 $41.37 7745 CORCORAN TRL E 23‐119‐23‐33‐0007 $41.37 7760 CORCORAN TRL E 23‐119‐23‐33‐0010 $41.37 7770 CORCORAN TRL E 23‐119‐23‐33‐0020 $41.37 7775 CORCORAN TRL E 23‐119‐23‐33‐0024 $20.69 7780 CORCORAN TRL E 23‐119‐23‐33‐0019 $20.69 7790 CORCORAN TRL E 23‐119‐23‐33‐0018 $20.69 7800 CORCORAN TRL E 23‐119‐23‐33‐0017 $20.69 7801 CORCORAN TRL E 23‐119‐23‐33‐0023 $20.69 7895 CORCORAN TRL E 23‐119‐23‐32‐0013 $20.69 7900 CORCORAN TRL E 23‐119‐23‐32‐0009 $20.69 7950 CORCORAN TRL E 23‐119‐23‐32‐0008 $20.69 7965 CORCORAN TRL E 23‐119‐23‐32‐0012 $20.69 8010 CORCORAN TRL E 23‐119‐23‐32‐0007 $20.69 8070 CORCORAN TRL E 23‐119‐23‐32‐0006 $20.69 7710 CORCORAN TRL W 23‐119‐23‐33‐0013 $41.37 7715 CORCORAN TRL W 23‐119‐23‐33‐0002 $41.37 7730 CORCORAN TRL W 23‐119‐23‐33‐0006 $41.37 7735 CORCORAN TRL W 23‐119‐23‐33‐0003 $41.37 7755 CORCORAN TRL W 23‐119‐23‐33‐0004 $41.37 7780 CORCORAN TRL W 23‐119‐23‐33‐0021 $20.69 7785 CORCORAN TRL W 23‐119‐23‐33‐0014 $20.69 7798 CORCORAN TRL W 23‐119‐23‐33‐0022 $20.69 7888 CORCORAN TRL W 23‐119‐23‐32‐0010 $20.69 7915 CORCORAN TRL W 23‐119‐23‐32‐0002 $20.69 8015 CORCORAN TRL W 23‐119‐23‐32‐0003 $20.69 8030 CORCORAN TRL W 23‐119‐23‐32‐0011 $20.69 8055 CORCORAN TRL W 23‐119‐23‐32‐0004 $20.69 8075 CORCORAN TRL W 23‐119‐23‐32‐0005 $20.69 9820 CREEK VIEW CIR 08‐119‐23‐23‐0013 $93.43 9829 CREEK VIEW CIR 08‐119‐23‐23‐0011 $93.43 9400 FOX VALLEY DR 09‐119‐23‐43‐0005 $85.71 9405 FOX VALLEY DR 09‐119‐23‐43‐0006 $85.71 9410 FOX VALLEY DR 09‐119‐23‐43‐0004 $85.71 9422 FOX VALLEY DR 09‐119‐23‐43‐0003 $85.71 9425 FOX VALLEY DR 09‐119‐23‐43‐0007 $85.71 9433 FOX VALLEY DR 09‐119‐23‐43‐0008 $85.71 9500 FOX VALLEY DR 09‐119‐23‐43‐0010 $85.71 9507 FOX VALLEY DR 09‐119‐23‐42‐0007 $85.71 9512 FOX VALLEY DR 09‐119‐23‐42‐0006 $85.71 9515 FOX VALLEY DR 09‐119‐23‐42‐0008 $85.71 9520 FOX VALLEY DR 09‐119‐23‐42‐0013 $85.71 9528 FOX VALLEY DR 09‐119‐23‐42‐0012 $85.71 9531 FOX VALLEY DR 09‐119‐23‐42‐0009 $85.71 9536 FOX VALLEY DR 09‐119‐23‐42‐0011 $85.71 9817 GARDEN LA 08‐119‐23‐13‐0012 $55.85 9709 GARDEN LN 08‐119‐23‐13‐0015 $55.85 9710 GARDEN LN 08‐119‐23‐13‐0003 $55.85 9724 GARDEN LN 08‐119‐23‐13‐0004 $55.85 9725 GARDEN LN 08‐119‐23‐13‐0014 $55.85 9732 GARDEN LN 08‐119‐23‐13‐0005 $55.85 9800 GARDEN LN 08‐119‐23‐13‐0006 $55.85 9820 GARDEN LN 08‐119‐23‐13‐0007 $55.85 9823 GARDEN LN 08‐119‐23‐13‐0011 $55.85 9830 GARDEN LN 08‐119‐23‐13‐0008 $55.85 9837 GARDEN LN 08‐119‐23‐13‐0010 $55.85 9840 GARDEN LN 08‐119‐23‐13‐0009 $55.85 9927 GARDEN LN 08‐119‐23‐12‐0004 $55.85 8715 GARRISON LN 18‐119‐23‐41‐0002 $128.67 23110 GARRISON RD 18‐119‐23‐41‐0007 $128.67 23120 GARRISON RD 18‐119‐23‐41‐0006 $128.67 23210 GARRISON RD 18‐119‐23‐41‐0005 $128.67 23216 GARRISON RD 18‐119‐23‐41‐0004 $128.67 10105 JEFFREY LN 04‐119‐23‐33‐0023 $89.45 10108 JEFFREY LN 04‐119‐23‐33‐0019 $89.45 10205 JEFFREY LN 04‐119‐23‐33‐0007 $89.45 10213 JEFFREY LN 04‐119‐23‐33‐0008 $89.45 10218 JEFFREY LN 04‐119‐23‐33‐0009 $89.45 10221 JEFFREY LN 04‐119‐23‐32‐0004 $89.45 23105 LARSEN RD 17‐119‐23‐33‐0001 $128.67 23107 LARSEN RD 18‐119‐23‐44‐0004 $128.67 23110 LARSEN RD 18‐119‐23‐41‐0008 $128.67 23119 LARSEN RD 18‐119‐23‐44‐0003 $128.67 23120 LARSEN RD 18‐119‐23‐41‐0009 $128.67 23205 LARSEN RD 18‐119‐23‐44‐0002 $128.67 23217 LARSEN RD 18‐119‐23‐44‐0001 $128.67 23230 LARSEN RD 18‐119‐23‐41‐0003 $128.67 23303 LARSEN RD 18‐119‐23‐43‐0008 $128.67 23315 LARSEN RD 18‐119‐23‐43‐0007 $128.67 23327 LARSEN RD 18‐119‐23‐43‐0006 $128.67 23405 LARSEN RD 18‐119‐23‐43‐0005 $128.67 23417 LARSEN RD 18‐119‐23‐43‐0004 $128.67 10503 Maple Lane 06‐119‐23‐13‐0025 $55.06 10512 Maple Lane 06‐119‐23‐13‐0016 $55.06 10517 Maple Lane 06‐119‐23‐13‐0024 $55.06 10613 Maple Lane 06‐119‐23‐13‐0007 $55.06 10625 Maple Lane 06‐119‐23‐13‐0008 $55.06 10650 Maple Lane 06‐119‐23‐13‐0023 $55.06 10627 Maple Lane East 06‐119‐23‐13‐0009 $55.06 10630 Maple Lane East 06‐119‐23‐13‐0017 $55.06 10631 Maple Lane East 06‐119‐23‐13‐0010 $55.06 10634 Maple Lane East 06‐119‐23‐13‐0018 $55.06 10635 Maple Lane East 06‐119‐23‐13‐0011 $55.06 10638 Maple Lane East 06‐119‐23‐13‐0019 $55.06 10639 Maple Lane East 06‐119‐23‐13‐0012 $55.06 10642 Maple Lane East 06‐119‐23‐13‐0020 $55.06 10643 Maple Lane East 06‐119‐23‐13‐0013 $55.06 10646 Maple Lane East 06‐119‐23‐13‐0021 $55.06 10647 Maple Lane East 06‐119‐23‐13‐0014 $55.06 9710 RUSH CREEK BLVD 08‐119‐23‐24‐0008 $93.43 9720 RUSH CREEK BLVD 08‐119‐23‐24‐0007 $93.43 9730 RUSH CREEK BLVD 08‐119‐23‐24‐0006 $93.43 9733 RUSH CREEK BLVD 08‐119‐23‐23‐0016 $93.43 9740 RUSH CREEK BLVD 08‐119‐23‐23‐0009 $93.43 9750 RUSH CREEK BLVD 08‐119‐23‐23‐0008 $93.43 9800 RUSH CREEK BLVD 08‐119‐23‐23‐0007 $93.43 9815 RUSH CREEK BLVD 08‐119‐23‐23‐0019 $93.43 9830 RUSH CREEK BLVD 08‐119‐23‐23‐0006 $93.43 9836 RUSH CREEK BLVD 08‐119‐23‐23‐0005 $93.43 9845 RUSH CREEK BLVD 08‐119‐23‐23‐0010 $93.43 9848 RUSH CREEK BLVD 08‐119‐23‐23‐0004 $93.43 9710 SUNDANCE RD 08‐119‐23‐13‐0019 $50.00 9715 SUNDANCE RD 08‐119‐23‐24‐0009 $50.00 9720 SUNDANCE RD 08‐119‐23‐13‐0020 $50.00 9730 SUNDANCE RD 08‐119‐23‐13‐0021 $50.00 9733 SUNDANCE RD 08‐119‐23‐24‐0003 $50.00 9800 SUNDANCE RD 08‐119‐23‐13‐0022 $50.00 9805 SUNDANCE RD 08‐119‐23‐24‐0002 $50.00 9820 SUNDANCE RD 08‐119‐23‐13‐0023 $50.00 9825 SUNDANCE RD 08‐119‐23‐24‐0005 $50.00 9831 SUNDANCE RD 08‐119‐23‐21‐0012 $50.00 9840 SUNDANCE RD 08‐119‐23‐13‐0024 $50.00 9945 SUNDANCE RD 08‐119‐23‐22‐0009 $50.00 9950 SUNDANCE RD 08‐119‐23‐12‐0001 $50.00 9955 SUNDANCE RD 08‐119‐23‐21‐0016 $50.00 9980 SUNDANCE RD 08‐119‐23‐12‐0002 $50.00 9990 SUNDANCE RD 08‐119‐23‐12‐0003 $50.00 10010 SUNDANCE RD 08‐119‐23‐21‐0001 $50.00 10020 SUNDANCE RD 08‐119‐23‐21‐0014 $50.00 10030 SUNDANCE RD 08‐119‐23‐21‐0015 $50.00 10080 SUNDANCE RD 08‐119‐23‐21‐0004 $50.00 10300 SUNDANCE RD 08‐119‐23‐21‐0018 $50.00 22107 WOODLAND LN 04‐119‐23‐33‐0012 $89.45 22109 WOODLAND LN 04‐119‐23‐33‐0010 $89.45 22110 WOODLAND LN 04‐119‐23‐33‐0013 $89.45 22115 WOODLAND LN 04‐119‐23‐33‐0011 $89.45 22120 WOODLAND LN 04‐119‐23‐33‐0014 $89.45 22124 WOODLAND LN 04‐119‐23‐33‐0015 $89.45 21565 CATES LONGHORN RD 33‐119‐23‐41‐0006 $40.76 21585 CATES LONGHORN RD 33‐119‐23‐41‐0005 $40.76 21600 CATES LONGHORN RD 33‐119‐23‐41‐0003 $40.76 10115 HIGHLAND RIDGE RD. 03‐119‐23‐44‐0015 $20.38 10120 HIGHLAND RIDGE RD. 03‐119‐23‐44‐0020 $20.38 10135 HIGHLAND RIDGE RD. 03‐119‐23‐44‐0014 $20.38 10150 HIGHLAND RIDGE RD. 03‐119‐23‐44‐0019 $20.38 10185 HIGHLAND RIDGE RD. 03‐119‐23‐44‐0013 $20.38 10200 HIGHLAND RIDGE RD. 03‐119‐23‐44‐0018 $20.38 10205 HIGHLAND RIDGE RD. 03‐119‐23‐44‐0012 $20.38 22314 RUSH CREEK DRIVE 05‐119‐23‐14‐0010 $40.76 22317 RUSH CREEK DRIVE 05‐119‐23‐14‐0012 $40.76 22344 RUSH CREEK DRIVE 05‐119‐23‐14‐0009 $40.76 22355 RUSH CREEK DRIVE 05‐119‐23‐14‐0011 $40.76 22385 RUSH CREEK DRIVE 05‐119‐23‐14‐0023 $40.76 22393 RUSH CREEK DRIVE 05‐119‐23‐14‐0022 $40.76 22405 RUSH CREEK DRIVE 05‐119‐23‐14‐0021 $40.76 22420 RUSH CREEK DRIVE 05‐119‐23‐14‐0017 $40.76 22425 RUSH CREEK DRIVE 05‐119‐23‐14‐0020 $40.76 22440 RUSH CREEK DRIVE 05‐119‐23‐14‐0016 $40.76 22445 RUSH CREEK DRIVE 05‐119‐23‐14‐0019 $40.76 22462 RUSH CREEK DRIVE 05‐119‐23‐14‐0015 $40.76 22465 RUSH CREEK DRIVE 05‐119‐23‐14‐0018 $40.76 22485 RUSH CREEK DRIVE 05‐119‐23‐13‐0009 $40.76 23525 STREHLER RD 19‐119‐23‐21‐0011 $40.76 22362 SUNSET LN 05‐119‐23‐14‐0008 $40.76 22408 SUNSET LN 05‐119‐23‐14‐0007 $40.76 22411 SUNSET LN 05‐119‐23‐14‐0001 $40.76 22434 SUNSET LN 05‐119‐23‐14‐0006 $40.76 22449 SUNSET LN 05‐119‐23‐14‐0002 $40.76 22472 SUNSET LN 05‐119‐23‐14‐0005 $40.76 22475 SUNSET LN 05‐119‐23‐14‐0003 $40.76 22480 SUNSET LN 05‐119‐23‐14‐0004 $40.76 7800 MAPLE HILL RD 24‐119‐23‐43‐0015 $750.00 7995 MAPLE HILL RD 24‐119‐23‐42‐0001 $525.00 STAFF REPORT Agenda Item 10b. Council Meeting: June 10, 2021 Prepared By: Brad Martens Topic: Improvement Hearing – Corcoran Trail East/West Improvements Project Action Required: Hold Public Hearing; Approval Summary: On May 13th, the City Council reviewed a draft feasibility study for the proposed Corcoran Trail East/West Improvements project and provided direction to staff. Additionally, an improvement hearing was called for June 10th. The next step in the process is to hold the improvement hearing in which affected property owners can share their thoughts on the project, including the proposed assessments prior to the Council ordering the improvement. Letters were mailed on May 28, 2021. The project includes proposed assessments as follows: • Properties accessing existing gravel to be new pavement: $10,800 • Properties accessing existing pavement to be new pavement: $3,600 These amounts reflect the 90% of the low range of the benefit per the approved special assessment policy. Additionally, the second category received a $1,800 deduction credit per Council direction due to not receiving an overlay. If after holding the improvement hearing, the Council desires to proceed with the project, a resolution ordering the improvement must be approved. The City must also schedule an assessment hearing at some point in the future. The purpose of that hearing is to receive comment prior to adopting the formal assessment roll. Per policy, the payment can be made in full, or paid over a term not to exceed 20 years with interest. The interest rate shall be one percent more than the rate of the bonds sold for the specific project. If no bonds were sold, the interest rate shall be set using the current bond market. Staff recommends utilizing the last bond sale from the City which had a true interest rate of .83%. This means that the interest rate for the project would be 1.83%%. Staff recommends a term of 10 years. Financial/Budget: The estimated cost of the project is $534,528.80 with proposed assessments in the amount of $176,400. This results in an estimated $358,129 city contribution. That amount as well as the initial coverage of assessments will need to be paid out of the asphalt fund and 2022 budget asphalt line item. Page 2 Options: 1. Hold the public hearing; approve resolution 2021-61 Ordering the Improvement for the Corcoran Trail East/West Improvement Project as presented. Authorize staff to proceed with plans and specifications. 2. Hold the public hearing; approve resolution 2021-61 Ordering the Improvement for the Corcoran Trail East/West Improvement Project with amendments. Authorize staff to proceed with plans and specifications. 3. Send back to staff for further review. Recommendation: Hold the public hearing; approve resolution 2021-61 Ordering the Improvement for the Corcoran Trail East/West Improvement Project as presented. Authorize staff to proceed with plans and specifications. Council Action: Hold the public hearing; consider a motion to approve resolution 2021-61 Ordering the Improvement for the Corcoran Trail East/West Improvement Project as presented. Authorize staff to proceed with plans and specifications. Attachments: 1. Resolution 2021-61 2. Proposed Assessment Roll City of Corcoran June 10, 2021 County of Hennepin State of Minnesota RESOLUTION NO. 2021-61 Page 1 of 1 Motion By: Seconded By: A RESOLUTION ORDERING THE IMPROVEMENT FOR THE CORCORAN TRAIL EAST/WEST IMPROVEMENTS PROJECT WHEREAS, on May 13, 2021 the City Council of the City of Corcoran adopted a resolution fixing the date for a Council hearing on the proposed Corcoran Trail East/West Improvements Project (the “Project”), the improvement by reconstruction of the existing roadways of the following: • Corcoran Trail East and West to the respective connections with County Road 50; and WHEREAS, ten days’ mailed notice and two weeks’ published notice of the hearing was given, and the hearing was held thereon on June 10, 2021, at which all persons desiring to be heard were given an opportunity to be heard thereon. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF CORCORAN, MINNESOTA: 1. The improvements contemplated by the Project are necessary, cost-effective, and feasible as detailed in the feasibility report. 2. Such improvements are hereby ordered as proposed in the Council resolution adopted on May 13, 2021. 3. Such improvements have no relationship to the comprehensive municipal plan. VOTING AYE VOTING NAY McKee, Tom McKee, Tom Bottema, Jon Bottema, Jon Nichols, Jeremy Nichols, Jeremy Schultz, Alan Schultz, Alan Thomas, Manoj Thomas, Manoj Whereupon, said Resolution is hereby declared adopted on this 10th day of June 2021. ________________________________ Tom McKee – Mayor ATTEST: __________________________________________ City Seal Jessica Beise – Administrative Services Director Estimated Roadway Project Cost 482,658.80$ Estimated Storm Project Cost 51,870.00$ Lot Equivilency PID PROPERTY ADDRESS TAX PAYER ADDRESS TAXPAYER NAME Units Estimated Roadway Assessment Amount Overlay Credit Estimated Total Assessment Amount 2311923330002 7715 Corcoran Tr W 7715 Corcoran Tr W Lori K LeighChannon Hale Leigh 1 10,800.00$ -$ 10,800.00$ 2311923330003 7735 Corcoran Tr W 7735 Corcoran Tr W Harold R Hawkins 1 10,800.00$ -$ 10,800.00$ 2311923330004 7755 Corcoran Tr W 7755 Corcoran Tr W Brian & Evelyn Johnson 1 10,800.00$ -$ 10,800.00$ 2311923330014 7785 Corcoran Tr W 7785 Corcoran Tr W John W Herou/Michelle Herou 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330015 7795 Corcoran Tr W 7795 Corcoran Tr W Bradley D PaumenBrian T Paumen 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330016 7815 Corcoran Tr W 7815 Corcoran Tr W Brian Toussaint 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320002 7915 Corcoran Tr W 7915 Corcoran Tr W Barbara A PearsonBradley F Pearson 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320003 8015 Corcoran Tr W 8015 Corcoran Tr W Randal Donnell/Sarah Donnell 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320004 8055 Corcoran Tr W 8055 Corcoran Tr W Floyd Raymond Keen Jr 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320005 8075 Corcoran Tr W 8075 Corcoran Tr W Curtis & Amy Nelson 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320006 8070 Corcoran Tr E 8070 Corcoran Tr E Cody Ellos & Laura Ellos 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320007 8010 Corcoran Tr E 8010 Corcoran Tr E Pamela & Steven Scheiller 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320008 7950 Corcoran Tr E 7950 Corcoran Tr E Douglas Eli & Leah Robideau 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320009 7900 Corcoran Tr E 7900 Corcoran Tr E Thomas J & Karen E Boerner 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330017 7800 Corcoran Tr E 7800 Corcoran Tr E Bemjamin W KorrerStephanie A Korrer 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330018 7790 Corcoran Tr E 7790 Corcoran Tr E Pat A Tabor/Jody A Mills 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330019 7780 Corcoran Tr E 7780 Corcoran Tr E S J Patnode & M Nelson 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330020 7770 Corcoran Tr E 7770 Corcoran Tr E Pat Riley GormanStacy Ann Gorman 1 10,800.00$ -$ 10,800.00$ 2311923330010 7760 Corcoran Tr E 7760 Corcoran Tr E R L Eastborne 1 10,800.00$ -$ 10,800.00$ 2311923330009 7720 Corcoran Tr E 7720 Corcoran Tr E Brian Toussaint 1 10,800.00$ -$ 10,800.00$ 2311923330013 7710 Corcoran Tr W 7710 Corcoran Tr W Molly Gabriele 1 10,800.00$ -$ 10,800.00$ 2311923330006 7730 Corcoran Tr W 7730 Corcoran Tr W Keith Drake & Elise Drake 1 10,800.00$ -$ 10,800.00$ 2311923330021 7780 Corcoran Tr W 7780 Corcoran Tr W Curt D Propson 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330022 7798 Corcoran Tr W 7798 Corcoran Tr W Chris Kuechle & Cher Kuechle 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320010 7888 Corcoran Tr W 7888 Corcoran Tr W Bruce A & Wendy A Koenen 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320011 8030 Corcoran Tr W 8030 Corcoran Tr W Loren George 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320012 7965 Corcoran Tr E 7965 Corcoran Tr E John & Lois Scheunemann 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923320013 7895 Corcoran Tr E 7895 Corcoran Tr E Joseph P StanislawskiGoodrun A Stanislawski 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330023 7801 Corcoran Tr E 7801 Corcoran Tr E Daniel A WoodwardAliecia L O'Donnell 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330024 7775 Corcoran Tr E 7775 Corcoran Tr E Andrew CarpenterDonna Carpenter 1 5,400.00$ (1,800.00)$ 3,600.00$ 2311923330007 7745 Corcoran Tr E 7745 Corcoran Tr E Jaclyn Pikkarainen 1 10,800.00$ -$ 10,800.00$ Corcoran Trail - Street Improvements Preliminary Assessment Roll Alternate 2 STAFF REPORT Agenda Item 10c. Council Meeting: June 10, 2021 Prepared By: Brad Martens Topic: Mandatory Connection Extension Requests Action Required: Direction Summary: In 2016 the City initiated the downtown utility and street improvement project, extending water and sewer infrastructure, and improving streets. The project included a deadline for properties to be connected to the water and sewer system by May 1, 2019. By request, the connection deadline was extended in 2019 until May 1, 2020, and further extended in 2020, to August 31, 2021. Staff has once again received multiple requests for the mandatory connection deadline to be extended. Two emails requesting the extension are attached to this report. Staff has also had a verbal request from Phil’s Quality Automotive. A map showing remaining connections is attached to this report showing eight non-residential properties left to connect. Financial/Budget: Delaying the required connection will have a minor impact on the water and sewer budget revenue expectations. Options: 1. Direct staff to draft documents to extend the deadline for connection until 2022. 2. Take no action and continue with the existing deadline of Au gust 31, 2021. Recommendation Due to the challenges of the COVID-19 pandemic, staff is supportive of one final deadline extension until 2022. Council Action: Direct staff to draft documents to extend the mandatory connection, one final time, until August 31, 2022. Attachments: 1. Extension Request Letter – Heidi’s Growhaus & Lifestyle Gardens 2. Extension Request Letter – DirecTEX, inc. 3. Remaining Connection Map From:Heidi Heiland To:Tom McKee; Jonathan Bottema; Jeremy Nichols; Alan Schultz; Manoj Thomas Cc:Brad Martens Subject:City Sewer and Water hook up Date:Tuesday, February 23, 2021 5:26:43 PM Esteemed Council Members - Thank you for your service to the City of Corcoran, it's residents and businesses. Although I know that the current deadline to hook up to city sewer and water is August 31, 2021, I would like to request an extension. I am hoping to receive your approval for this request. The reasons and my thought process behind this need include: I can not afford the roughly $60,000 estimate for the drilling/excavator contractor. While I have tried to get competitive quotes, no one will touch this but local contractor Ernie Mayer due to the complexities of the installation. I plan to continue identifying other contractors but that takes time. We are only able to perform this work while we are not in season. Thus Jan - April is the time to complete the work. The city prescribed that I hook up on our north property border, in the midsection. This has made the project much more expensive and complex than if I was allowed to hook up along 116. I am fully leveraged after acquiring this 5.5 acre parcel and will not qualify for a loan, nor do I plan on incurring any more debt for a while. For improvements to real property, we typically finance internally and budget to allow for continued growth while still paying down our debt I hope to hook up in the spring of 2022 but can not guarantee we would have the capital by then either. I am eager for this opportunity, I simply cant afford it. Once hooked up, I will need to pay roughly an additional $71,000 $15,000 is already being assessed through property taxes $24,000 for WAC - paid at time of connection or assessed over 10 years $12,000 to Met Council for SAC fees (immediately). FYI I worked with their estimation process and got this fee down from their inaccurate assessment of $32,000 $20,000 to Maple Grove (date TBD) Please accept my request for an extension to the Aug 31, 2021 deadline. I would also accept any counsel for how I might alleviate the other hurdles; 1) the location where we need to hook up and 2) the exorbitant fees required of any small business. Thank you for your attention. NAMASTE Heidi Heiland Where seeds take root to cultivate change Heidi's GrowHaus & Lifestyle Gardens Chief Experience Officer (CEO) 612.366.7766 From:charleen baller To:Brad Martens Cc:Jakob Baller Subject:water and sewer hookup Date:Wednesday, April 14, 2021 3:46:35 PM Attachments:image001.png Brad, I am writing to ask your consideration for an extension to the Corcoran city water and sewer hookup requirement with the current deadline of 8/31/2021 The direcTEX team continues to work remotely and will continue to do so for the next few months until all parties are satisfactorily vaccinated. We have not worked from our office since the governor sent us home in March of 2020. As you know the pandemic continues to impact normal business practices and the interruption continues to impact us negatively. I would appreciate the continuance for one more year or at minimum until the end of spring 2022, so estimating June 2022. This would allow us to work with Ernie Meyer who prefers to execute hook up jobs like ours during the off season. I appreciate your consideration. Kind Regards, Charleen H Baller President 763-416-6700/ directexknitwear.com STAFF REPORT Agenda Item 10d. Council Meeting: June 10, 2021 Prepared By: Jessica Beise Topic: Liquor Licensing Renewal Fees Action Required: Approval Summary: Due to the COVID-19 pandemic local establishments were not open to the public for several weeks and there was concern related to the ability to afford the liquor license renewal in 2020. Staff recommended for 2020 to have allowed businesses to operate with fees due in October, as it allowed flexibility on fee due dates and gave the City time to understand the impact of COVID-19. Due to the limitations on bars through August, Council approved a 3-month reduction in fees (i.e. $1,000.00 for a full-on sale establishment) was implemented for 2020. With the 2021 renewal, staff was approached by one of the on-sale establishments and asked if a further reduction could be made establishments had restrictions in November and December of 2020 as well as continued to have some restrictions through the early part of 2021. Staff has reviewed the request and accommodations could be made by completing another 3-month reduction in fees for this current licensing period should the Council support the request. Financial/Budget: Reducing fees will have an impact on the City budget of approximately ($3,500) based on the number of currently licensed businesses (the 10-50 has not renewed its license). Some of the establishments have had paid the entire license fee and refunds could be provided. Options: 1. Authorize a one-time reduction of on-sale liquor license fees equal to three months of a usual fee for the licensed establishments in Corcoran for the 2021-2022 license period. 2. Decline to make changes to the liquor license fee. Recommendation Authorize a one-time reduction of on-sale liquor license fees equal to three months of a usual fee for the licensed establishments in Corcoran for the 2021-2022 license period. Council Action: Consider a motion authorize a one-time reduction of on-sale liquor license fees equal to three months of a usual fee for the licensed establishments in Corcoran for the 2021- 2022 license period. Attachments: None STAFF REPORT Agenda Item 10e. Council Meeting: June 10, 2021 Prepared By: Brad Martens Topic: 2022 Budget Expectations Action Required: Direction Summary: Staff will soon begin drafting the 2022 budget. In advance of doing so, it is requested to receive expectations from the City Council on expectations. Direction is requested specifically on the following items: • Overall budget target o Previous guidance from Council has been to continue to find ways to lower the overall tax rate of the city, while investing as necessary to manage the continued growth. Staff would like to understand whether this guidance continues or differs for 2022. • Services provided o Due to the significant growth, managing basic services can be a challenge. Staff would like to understand whether additional service expectations are expected due to the pandemic. • Wage adjustments: o The approved contract with the police officer’s union provides for a 3% increase for union employees for 2022. It has been practice for many years that the non-union employees receive the same adjustment as the union employees. Does the Council continue to support this practice? • Other priorities o Staff would like to understand if additional priorities exist for the Council that should be incorporated into the first draft of the budget. Financial/Budget: Direction from the Council will be used to create the first draft of the 2022 budget. Staff will present the draft budget with anticipated tax impacts at a future Council meeting. Council Action: Provide staff direction on 2022 budget expectations. Attachments: None STAFF REPORT Agenda Item 10f. Council Meeting: June 10, 2021 Prepared By: Brad Martens Topic: Code Enforcement Discussion Action Required: Direction Summary: Mayor McKee has requested an opportunity to discuss the ongoing code enforcement program with the City Council. Financial/Budget: The 2021 budget includes $30,000 allocated towards code enforcement. Council Action: Provide staff direction on the code enforcement program. Attachments: None STAFF REPORT Agenda Item 10g. Council Meeting: June 10, 2021 Prepared By: Brad Martens Topic: Future Work Session Schedule Action Required: Direction Summary: Staff would like the City Council to provide direction on the potential for additional work sessions to focus on the following items. • July 8, 2021: Water Supply Finance Plan • July 22, 2021: 2022 Budget and Financial Management Plan • August 12, 2021: Fire Service Work Plan Financial/Budget: Costs associated to work sessions would be tied to staff/consultant time and is budgeted for. Options: 1. Schedule work sessions for July ,8, July 22, and August 12, 2021 as presented. 2. Send back to staff for further review. Recommendation: Schedule work sessions for July ,8, July 22, and August 12, 2021 as presented. Council Action: Schedule work sessions for July ,8, July 22, and August 12, 2021 as presented. Attachments: None. City of Corcoran 2021 City Council Schedule Agenda Item 12. June 24, 2021 • Active Corcoran Planning Applications • Job Description Update – Police Administrative Assistant • Zoning Ordinance Amendment – Westside Tire • Dornsbach CUP – 6805 Rolling Hills Road • Cain Road Vacation Request • Franzen Final Plat • Code Enforcement Appeals (2) • Financial Management Plan update • Commissioner appointment process • Developer Agreement Amendment Request • Conditional Uses in Zoning Districts • Stieg Road Transportation Improvements • ARPA Resolution Authorizing steps to receive funds • City Center Drive Feasibility Study • City Hall Remodel – Pay Request, Change Order July 8, 2021 • 2021 Action Steps Progress Update • Diamond Lake Regional Trail Corridor – Preferred Route • Discuss Open Book meeting vs. local board of appeal and equalizat ion • FEMA Floodplain Mapping July 22, 2021 • Active Corcoran Planning Applications • Country Daze Noise Waiver • Resolution Supporting Hennepin County Bridge Project • Amberly and Bellwether Rezoning, Preliminary Plat, and PUD • Bring Your Own Device Policy • Discussion on Open Book meeting vs. Local Board of Appeals and Equalization (December 1 deadline)